Tag Archives: Nettie Pollard

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader charged with buggery of a 14-yr old.


Update

Croydon headmaster John Coatman spared jail for abusing teenage boy

Jan 12 2018

A former headmaster, honoured for his services to young people, has been spared jail after admitting sexually abusing a 15-year-old boy.

In August 2016 retired John Coatman, 76, was found guilty of gross indecency for an offence committed in the 1970s.

His conviction had been thrown out by the Court of Appeal last April because of an error on his charge sheet.

When the case returned to the Old Bailey for a retrial he pleaded guilty to a charge of indecent assault.

‘Rough and tumble’

Coatman, of Leyburn Gardens, Croydon, south London, was sentenced by Judge Anne Molyneux to 21 months imprisonment, suspended for two years.

He was also made subject to a 12-month supervision order.

The court heard that the teenager would visit Coatman’s home, where they would engage in “rough and tumble”, which later took a sexual turn as the adult touched the boy over his clothes.

Matters escalated when, on three separate occasions, the pair undressed in Coatman’s bedroom and the head teacher touched the boy sexually.

‘Difficult to comprehend’

The defendant was headteacher of St Andrew’s secondary school in Croydon, but the complainant was not a pupil there.

Coatman retired in 1998 after 42 years as a teacher and was awarded an MBE in 2012.

Prosecutor Mark Trafford QC told the Old Bailey: “The defendant’s MBE for services to young people was something that he (the complainant) found difficult to comprehend under the circumstances.”

Claims against Coatman, who has inoperable cancer, surfaced in 2014.

In a victim impact statement, the complainant said the incidents had left him with emotional and relationship difficulties.

Sentencing, Ms Molyneux said: “You were in a position of considerable trust, and he trusted you. He enjoyed being with you over a short period of time.”

http://www.bbc.com/news/uk-england-london-42664643


Retired Croydon headteacher admits sexually abusing 14-year-old four decades ago

The retired headteacher of a Croydon school, honoured with an MBE by the Queen in 2012 for services to young people, today admitted to sexually abusing a 14-year-old boy over 40 years ago.

John Coatman of Leyburn Gardens, 76, was found guilty of gross indecency in August 2016 when volunteering at a Christian youth group called The Crusaders in the 1970s.

However, soon after his conviction it emerged that there had been an error in the level of the charges against him by the Crown Prosecution Service and the judge adjourned sentencing as it became obvious the case would go to the Court of Appeal. The Court eventually quashed his conviction in April this year and ordered a re-trial.

At his retrial at the Old Bailey on Monday, Coatman pleaded guilty to an amended charge of indecent assault.

Coatman was headteacher at St Andrew’s Church of England High School in Waddon. During his trial, he told the jury he worked with over 22,000 young people during a 50-year association with the Christian group for boys but “had never had any sort of complaint”. The jury rejected Coatman’s explanations and found him guilty of two counts of gross indecency but not guilty of buggery.

Claims against Coatman emerged in 2014 after the victim was suffering from problems at work and his marriage broke down.

At his trial, he denied the claims that “rough and tumble” had turned sexual, saying the only physical activity the young people engaged in was the children’s game British Bulldog.

Coatman told jurors he was “shocked” and “deeply shaken” after his arrest, saying the theme of sex cropped up in youth group meetings only in reference to religion.

http://www.eastlondonlines.co.uk/2017/12/retired-croydon-headteacher-admits-sexually-abusing-14-year-old-four-decades-ago/

Former Croydon headteacher John Coatman has buggery convictions annulled by High Court judges due to police and Crown Prosecution Service errors.

18 Apr 2017

A retired headmaster who had been found guilty of gross indecency with a 14-year-old boy has had his conviction nulled due to police and Crown Prosecution Service errors.

John Coatman, 76, a former headteacher at St Andrew’s Church of England High School in Waddon appealed to the High Court to overturn his conviction for historic sexual abuse at the Old Bailey in August.

Senior judges this month overturned the jury’s verdicts that Mr Coatman, who had also been honoured by the Queen for his services to young people, had sexual activity with the teenager in the 1970s.

Three judges at the Royal Courts of Justice quashed his outstanding convictions on April 6, ruling that Mr Coatman should not have faced the charges under section 1 of the Indecency With Children Act 1960 and section 13 of the Sexual Offences Act 1956.

The Right Honourable Lady Justice Hallett DBE stated: “Both (the police and Crown Prosecution Service) were wrong (to pursue these charges).

“The appellant could not be charged with offences under section 1 because of the age of the complainant at the time and could not be charged with offences under section 13 because they were time barred.”

Mr Coatman could not have committed an offence against a 14-year-old boy in 1973 under Section 1 of the 1960 Act because the law did not relate to alleged victims of that age until 2001, Lady Justice Hallett ruled.

Buggery charges levied against Mr Coatman under Section 13 of the 1956 Act – provided at the time under the heading ‘Indecency with Men’ – were ‘inapt’, the judge ruled, because the alleged conduct amounted to an assault towards a victim, rather than a sexual act with another man.

Lady Justice Hallett added: “Over the last few years this court has issued repeated warnings about the dangers of poor drafting of indictments in cases of alleged ‘historic sexual abuse’.”

A Crown Prosecution Service (CPS) spokesperson said: “We have contacted the complainant in this case to explain the issue and apologised.

“The CPS has issued advice to our specialist sexual offences prosecutors about the appropriate offences to charge in these particular circumstances, to reflect the changes in the law and recent Court of Appeal judgements.

“Cases currently before the courts have also been re-checked to ensure the error does not happen again.”

http://www.yourlocalguardian.co.uk/news/15230961.Former_headteacher_has_buggery_convictions_anulled/

The judges said the Crown Prosecution Service (CPS) was “responsible for this deeply regrettable state of affairs” and added a new case could potentially be brought against Mr Coatman alleging different charges.

Mr Coatman was made an MBE in 2012 for services to young people. During his trial he told the court he had worked with about 22,000 young people in his lifetime,

http://www.croydonadvertiser.co.uk/former-croydon-head-teacher-cleared-by/story-30254096-detail/story.html


Ex-head teacher John Coatman appeals conviction after being found guilty of gross indecency

A jury at the Old Bailey in August found John Coatman, 75, guilty of gross indecency with a boy in the early 1970s

Coatman, of Leyburn Gardens, was due to be sentenced at the Old Bailey today, but applied to the Court of Appeal to overturn his conviction. He did not appear in court himself.

The hearing was indefinitely adjourned by Judge Richard Hone, who previously warned Coatman, who taught for 42 years, to expect a jail term.
link

Update: August 26, 2016

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader found guilty of gross indecency with young boy

John Coatman, leader of Urban Saints Youth Group, Croydon was warned by Judge Richard Hone QC that he faced a jail term. He is due to be sentenced on September 30.

Sexual contact took place on about four or five occasions.

In emotional testimony in front of the jury, the man – who was 14 at the time at the time – broke down in tears as he described the alleged abuse taking place 

“… the effects of abuse on a young person can be quite traumatic…”

The survivor also said Coatman had asked whether any other boys he knew “might be interested”.

 link

link

 

377e2a9100000578-3753419-image-a-3_1471886185455
A retired headmaster, John Coatman, has been charged with having sex with a 14-year-old boy he met through a Christian youth group in the 1970s.

Jurors heard that at the time of the incidents, Coatman was not only the headteacher of a secondary school in south London (St Andrew’s Church of England High School), but was also involved in a Christian group for boys.  

The name of the Christian youth group is – Crusaders/now called  Urban Saints Youth Group organisation – Cliff Richard’s group

http://research.omicsgroup.org/index.php/Urban_Saints

http://www.dailymail.co.uk/news/article-3753419/Retired-headmaster-75-head-sex-14-year-old-boy-met-Christian-youth-group-1970s.html

Mr Coatman, who described himself as a bachelor told jurors that the topic of sex did crop up during youth group meetings, but only in reference to passages in the Bible involving “Christian aspects of sexual behaviour”, he added.

link

John Coatman MBE Supporters

From a lonely John Coatman testimonial website (comprised of a handful of supporters)

Testimonial by Victoria Swainson

“…I also did my bronze and silver Duke of Edinburgh awards outside of school, through a group organised and led by John (Coatman), and attended a residential Crusaders weekend on the Isle of Wight, again which he’d organised”

 Testimonial by Dr Amy Kendrick

 My name is Amy Kendrick and I was a pupil at St Andrew’s Church of England School in Croydon between 1992 and 1997.

http:///search?updated-min=2015-01-01T00:00:00-08:00&updated-max=2016-01-01T00:00:00-08:00&max-results=3

Dr Amy Kendrick – related to evangelical songwriter Graham Kendrick?

Graham Kendrick

Special commissions from such charities as Tear Fund, the Children’s Society, Church Army and Care for the Family, have resulted in songs of compassion and justice. They have been sung at major public occasions – including the Dunblane memorial service.

Festival of LightAmong these were Malcolm Muggeridge, Lord Longford, Bishop Trevor Huddleston and Cliff Richard. Among the performers were Cliff Richard, and Graham Kendrick.

link

link

Truthseeker1‏ @thewakeupcall09

Crusaders launch Network for Revival

General Eva Burrows, Rev David Coffey, Rt Rev Michael Hare-Duke, Rev Selwyn Hughes, Rev Dr Donald English, Gerald Williams, Rt Rev Dr James L Weatherhead, Jill Dando, Most Rev Desmond Tutu, Rt Rev Stanley Booth-Clibborn

Gyles Brandreth – part of Lord Longford’s porno junket – (which included Jimmy Savile and Cliff Richard)…

Amongst those who were included, and who stayed the course, were singer Cliff Richard and Radio One DJ Jimmy Savile, alongside more obvious suspects like Malcolm Muggeridge (he had spoken at VALA’s first convention, declaring that ‘if Till Death Us Do Part is life, I cannot see that there would be anything to do but commit suicide’) and the Rt. Revd Ronald Ralph Williams, the Bishop of Leicester,

 

 

Here is a list of people who signed off on Longford’s porn report in 1972

There were 47 signatories, with three notes of reservation from Kingsley Amis, Elizabeth Jane Howard and David Goodbourn (from Times, Sep. 20th, 1972):

Mr Kingsley Amis
Professor J. N. D. Anderson
Dr. G. R. Beasley-Murray
Miss Dorothy Berridge
Mrs Sara Binney
Lieutenant-Colonel Sir Ian Bowater
The Rt Rev Bishop B. C. Butler
Professor Francis Camps
Sir Frederick Catherwood
the Rev Thomas Corbishley SJ
Lord Justice Edmund Davies
Mr Peter Dawson
Mr Dennis Delderfield
Lord Douglass
Lord Dulverton
Dr. Stanley Ellison
Canon S. H. Evans
Lord Fletcher
Mr Frank Gillard
Mr David Goodbourn
Mr Peter Grosvenor
Professor Agnes Headlam-Morley
Mr David Holbrook
Miss Elizabeth Jane Howard
Mr Martin Hughes
Miss Angela Jones
Mr Herbert Kerrigan
Mr Peter Kettle
Mr Ronald H Kirkwood
The Bishop of Leicester, Dr Williams
Mr John Godfray Le Quesne, QC
The Rev Joseph McCulloch
Miss Carol McCullough
Lady Masham
Mrs Mary Miles
Mr Malcolm Muggeridge
Mr Jeremy Murray-Brown
Mr Cliff Richard
Mr Basil Rooke-Ley
Mr Jimmy Savile
Dr. Christine F. T. Saville
Dr. Peter D. Scott
Mr James Sharkey
Lord Shawcross
The Rev. Lord Soper
The Bishop of Stepney Dr. Huddleston
The Rev. K. M. Steven
Colonel S. J. Watson
Mrs Shiela Wiltshire
Mr Peregrine Worsthorne
The Archbishop of York Dr. Coggan
Mrs. P. S. Ziegler

link

 

logo2x

The Tear Fund charity was created out of the Evangelical Alliance (EA) and the Evangelical Refugee Fund created by the United Nations.

In January 1969 Cliff Richard did two fundraising concerts for Tearfund at London’s Royal Albert Hall. He has served as the charity’s Vice President and in 1999 served as its president

article-1053130-026e2fc900000578-126_468x311

Life-long bachelor Cliff Richard – his manager and live-in companion of more than 30 years, Bill Latham (right) was  hugely involved with charity work and was in “on the start of Tearfund”

In 1972  Latham was Deputy Director of Tearfund and had been instrumental in persuading Jean Le Maistre, a Christian politician on the island who was just launching Jersey Overseas Aid, to take a team for his first project to a hospital in Nazareth.

link

cliff tear fund

1978 English pop singer Cliff Richard in concert for the Christian charity, Tear Fund.

jamesogilvyroyalweddingpreweddingdinneriaqmd75ldgtl

Julia Ogilvy  (centre)– a Trustee of Tearfund with Princess Alexandra and James Ogilvy

Julia Ogilvy is a member of the extended British Royal Family. She is the wife of James Ogilvy, the only son of Sir Angus Ogilvy and Princess Alexandra, The Honourable Lady Ogilvy, a granddaughter of King George V and first cousin of Her Majesty the Queen.

link

Jimmy Savile admitted getting knighthood was ‘a relief because it got me off the hook’

His OBE folder contained a handwritten letter from Angus Ogilvy

link

More on the Ogilvys- The Ogilvys

Testimonial by Joshua Woodcock
 John Coatman was at first my leader, then as i grew older my co-leader as i joined the team leading the group and even after i left a dear friend mine. My very first contact with John was at St Andrews school where he was my sisters head master.
I went to Wallington crusaders with John for the best part of 15 years
From mass groups of us walking over box hill in the middle of the night every year to may trips away to Westbrook on the isle of white.

John Coatman reckons he’s been to about 300 Crusaders camps over the years

link

img_0071

westbrook_new_website

westbrook20front

Westbrook started life as a large Victorian residence surrounded by 25 acres of mixed parkland that was purchased by Crusaders Union in 1948

The original intention of the Committee at the time was to use a Memorial Fund of just over £500 to purchase a field as a permanent camp site for the ever developing Crusader holidays

link

 Crusaders Youth Group/Urban Saints

(Notable Crusader Peter Broadbent 

RT REVD PETER ALAN BROADBENTdirector at George Carey’s son Mark Carey’s school ST.JOHN’S COLLEGE NOTTINGHAM LIMITED

Peter Broadbent became a Christian at 14 through ‘Crusaders’, a Christian youth organisation. He trained for the ministry at St John’s College, Nottingham.

link

link

broadbent

Ordained in 1977, His first parish job was as Curate to George Carey, when he was Vicar of St Nicholas, Durham. He  was at St Nicholas’ Church til 1980 and he was an Islington Labor councillor 1982-1990.)

Lord Carey is a director of Christian Weekly Newspapers along with RT REVD PETER ALAN BROADBENT

link

Other notable Crusaders

link

Donald Wiseman worked for military intelligence.

In 1942 he became senior intelligence officer of the Mediterranean Allied Tactical Air Forces.

Wiseman joined a special intelligence group handling the Ultra signals, deciphered at Bletchley Park.

Wiseman worked with the Christian Crusaders

Wiseman also maintained a close connection with the Crusaders organisation. He was leader of the class at Finchley, which included Cliff Richard

Martin J. Selman, “Donald J. Wiseman,” in Walter A. Elwell and J. D. Weaver (eds.), Bible Interpreters of the 20th Century (Grand Rapids: Baker, 1999) p. 309

http://aanirfan.blogspot.com/2016/06/cliff-richard-crusaders-military.html


1979 Margaret Thatcher immediately carried out her promise to slash public spending, recommending that heating be drastically rationed in offices and schools.

This led to a remarkable revolt in Westerham in October 1979 when rebel children from Churchill School, led by senior pupils, burned their text books and walked out in protest against the cold. When headmaster John Coatman went into the playing field to remonstrate, many returned. Around 50 to 60 protesters stayed outside until a caretaker confirmed that the boilers were on.

link

 T H E O L D W H I T G I F T I A N A S S O C I A T I O N , C R O H A M M A N O R R O A D , S O U T H C R O Y D O N , S U R R E Y

John A Coatman attended Whitgift (1952-59) as did his brother Robert William Coatman, MBE, JP

coatman family whitgift
Robert William Coatman, MBE
3007948-large
Robert William Coatman, MBE – ONE of Croydon’s longest-serving councillors.He was first elected as a Conservative for Croydon Central ward in 1966 and went on to represent its successor ward, Fairfield, until his retirement.

Councillor Coatman was elected in 1966 to represent Croydon Central ward, following a family tradition after his great-uncle, GF Coatman, represented Croydon Central in the 1920s

Bob Coatman was educated at Whitgift School and worked for 41 years as a chartered surveyor.

He was best known on the council for his role in planning – serving on the planning committee from 1968 and spending 16 years as its chairman.

 He was Mayor of Croydon in 1977-78.

In 1993, Mr Coatman was made an MBE for his services to local government, and he received a lifelong service award from the council in 2006.

He also served as a magistrate at Croydon Magistrates’ Court for 21 years from 1976.

Outside of council business, Mr Coatman was founder president of both the Rotary Club of Croydon South and the Croydon Mayors’ Association.

He had also been a member of the Croydon South Probus Club and the Old Whitgiftian Association and a longstanding member of the court of the Whitgift Foundation.

His interests included classic cars, he was  a member of the A40 Farina Club and the history of Croydon, and he was a member of the Croydon Corps of Drums.

coatman john

2012 John Coatman. Leader, Urban Saints Youth Group, Croydon – MBE for services to Young People. (London, CR0)

standrews

Coatman was head teacher at St Andrew’s until he retired in 1997 and was awarded with an MBE by The Queen in 2012 for his services to young people.

Life-long youth worker given MBE

A FORMER head teacher who has spent his life working with Croydon’s youth has been recognised for his services to young people.

John Coatman, who taught at St Andrew’s School in Warrington Road, has been appointed an MBE.

Mr Coatman joined youth group the Croydon Crusaders, now known as Urban Saints, in 1949 aged eight and rose to represent the club on a national and international level.

 John Coatman

John is very active “for his years”, keeps fit and loves to travel the world – he’s always looking for travel companions who can keep up with him.

Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people leading expeditions to Austria, a project which has secured European Union funding, and on countless Duke of Edinburgh Award trips.


Imperial College LondonJohn Coatman, BSc Civil Engineering 1962

link

link


Ten English Days or TED – by John Coatman, on behalf of the leadership team:

Coatman TED Austria

The expedition is being run as part of the work of Croydon Crusaders. Crusaders is a registered charity and the expedition is a charitable activity supporting the work of a charity in Austria. Please ask for information about gift aid.
EU GRANTS
In 2001, 2002, 2003, 2004 and 2005 we had generous grants towards the project from the European Union and we may be applying again this year.
This will be my seventh year leading the TED expedition so I know a great deal about where we are going and what we will be doing. For the first 3 years the trip was part of the Crusoe (Crusaders Overseas Expeditions) programme organised by Crusaders. From 2003 the same expedition has been run under my own Croydon Crusaders Group. Apart from that, all is the same and it is a great success. The 2006 trip is open to any Christian young person aged 15 to 25 who wants to serve God on a working holiday. For legal reasons, by applying they become members of Croydon Crusaders. I promise a great deal of fun in one of the most beautiful parts of Europe in a building that you will find tobe very hospitable and lovely. You will live in luxury but I also promise that you will work hard!
We will be going to Schloss Klaus in Upper Austria.

https://web.archive.org/web/20160823154816/http://www.youthblog.org/tedaustria2006.pdf

Schloss Klaus

link


b2zkx5aciaafnbm

One of our loyal readers, John Coatman of The Croydon Crusaders, decided to pop in this morning and say hello!

The Pass is a magazine inspiring the UK’s Group Travel Organisers.


2011 Croydon Council consultant – John Coatman Crusaders

https://www.croydon.gov.uk/sites/default/files/articles/downloads/appendices1-3.pdf


coatman com ck

Nature of business (SIC) – 7020 Letting of own property

https://companycheck.co.uk/director/906652625/MR-JOHN-ANTHONY-COATMAN/companies


WALLINGTON CRUSADER HALL

Crusader Hall in Carshalton, England

Charitable Objects

“To Be Used For All Or Any Of The Purposes Of The Wallington Crusaders’ Bible Class For Public And Private Schoolboys And Young Men In Such Manner As The Leader Of Learders For The Time Being Thereof Shall Think Fit Within The Limits Of The Trusts Hereinafter Declared And Subject To Such Terms And Obligations As May Be Agreed Between The Trustees And The Wallington Crusaders’ Bible Class Aforesaid.”

Operations

Operation Location(s) Domestic
Surrey
Sutton

Trustees

Name

CHRISTIAN AND SPORTING ACTIVITIES MOSTLY FOR YOUNG PEOPLE WALLINGTON 253811

253811 MR BOB HEDDERLY, MR DERRICK CHARLES LEWIN 462944 MR NOEL GODFREY CARPENTER 467551 ROBERT VERNON HEDDERLY 468174 IVAN RATNAYAKE 3266458 JOHN COATMAN 3266459


 

cr1970chtimes08_21x_zps3eca9245

1970 Cliff had just returned from spending two weeks at a Christian Crusader camp. Cliff has entertained many young people on a boat that he moors on the Norfolk Broads

 …………………………………….

Cliff Richard led an armada of five motor cruisers along the Norfolk Broads…Last night with 27 boys from the Crusaders’ Union...in his six-berth Pomander ...

cliff2b-2bnorfolk2bbroads2b

cr1972dexp04_04x_zps256ad2f4

cr1966chtimes11_18x_zps31ab0c54

link

cliff2bbroads

WHAT IS AN URBAN SAINTS GROUP ANYWAY? There was a bumper crop of Urban Saints family members included in the 2012 New Year’s Honours list by Her Majesty The Queen.

This included MBEs for John Coatman (for his work with young people in Croydon, including the Wallington Urban Saints group), Dr Avice Hall & Stephen Hammersley (for their work in education, the community and their own local groups, in St Albans and Harpenden respectively). Former Crusaders Director, Dr Alan Kerbey, received an OBE for his work with young people in education and another former staff team member, Colin Henry, was recognised for with a MBE, for services to education in his role as Chair of Governors at Christ’s College in Guildford.

URBAN SAINTS is the operating name of The Crusaders’ Union, a company limited by guarantee and registered in England & Wales, company number 07771037, charity number 1144923

https://companycheck.co.uk/company/07771037/THE-CRUSADERS-UNION/companies-house-data

http://docslide.us/documents/engage-spring-2012-56f388fd581ab.html


l-r-president-of-crusaders-steve-chalke-sir-cliff-richard

2006
Crusaders, the youth missionary movement, hosted “An Evening with Sir Cliff Richard” recently in Central London to celebrate its centenary.

Alongside Steve Chalke, the President of Crusaders, Sir Cliff shared his personal life and faith, as well as performing a couple of songs from his repertoire.

Sir Cliff shared openly about his early days as a young performer, his big break, his very public conversion to Christ and the significant role played by Crusader leaders in his early Christian journey.

He spoke fondly of his time with Crusaders.

Sir Cliff is Patron of the Crusaders

http://www.christiantoday.com/article/sir.cliff.richard.shares.faith.at.crusaders.centenary/8014.htm

 


Paul O’Grady: “He’s really been through it this year, poor Cliff. He’s had a terrible time.”

Cliff Richard to O’Grady: “…you and I we’ve stood side by side through the storms together and all through the years you have been golden”

sir-cliff-richard-and-paul-ogrady

Cliff Richard’s drag queen friend and supporter, Paul O’Grady worked at care homes where Jimmy Savile abused and where Crusaders (members of the organisation that Cliff Richard is patron of)  were charged with abuse.

lily-savage-580x350_73610a

Paul O’Grady as drag queen, Lily Savage (Carlton Television) worked for Camden Council Social Services

Cilla Black used to go on holiday with Lily Savage aka Paul O’Grady, who worked as a social worker in Lambeth at the time of the paedophile gang and neglect of clients in that Borough. Diane Abbott was Lambeth Borough Council’s press officer/PR person.

http://www.drsallybaker.com/tag/diane-abbott/

 

1004410

O’Grady worked at The Children’s Convalescent Home and School on Meols Drive, West Kirby Meols Drive, West Kirby

link

paul-o-grady-the-devil-rides-out

From his autobiography:

o grady children's home

link

Last night TV funnyman Paul O’Grady told how Savile was banned from being alone on a girls’ ward at a care home where the Lily Savage star once worked.

Paul says: “When I worked in a children’s home in West Kirby in the 1970s, Jimmy Savile came to visit.

O’Grady, recalled the “creepy” DJ, Jimmy Savile visiting the Conny Home in West Kirby, Merseyside, which housed disabled and abused children in the 1970s.

He said: “Some of the house mothers were told not to let him on the girls’
unit unsupervised.”

Esther Rantzen and Paul O’Grady

31d765e700000578-0-image-m-101_1457094029831

link

link

paul o grady crusaders quote

o grady crusaders

link

West Kirby Residential School, West Kirby, Wirral

A group of 10 claimants has already issued legal proceedings relating to claims for severe physical and sexual abuse from the mid 1970s to the early 1990s at West Kirby Residential School in Meols Drive.

Three men (Graham Charles Webb, Henry Christie, Matthew Johnson) received jail sentences at Liverpool Crown Court for their part in the physical and sexual abuse at the residential school.

*Former head of care Graham Charles Webb, was jailed for seven years in July 1997 for abusing boys at the school and at camps he helped organise.

Webb, who also worked for a well known Christian youth movement, admitted abusing 20 children over a period of almost 20 years.

https://theukdatabase.com/2013/05/04/west-kirby-residential-school/

(West Kirby Residential School, West Kirby, Wirral

Matthew Johnson was also at Balliol School, Sedburgh, Cumbria.

The former house parent, of Kirby Stephen, Cumbria, committed the offences on five pupils at the residential school and three boy scouts who were in his care when he was a scout master.)

 

 


And another Crusader leader charged with abusing boys:

Crusader leader vicar Rev David Henry McIntosh:

 

Crusader Graham Webb charged along with

fellow Crusader leader vicar Rev David Henry McIntosh:

Alongside McIntosh in the dock was 41-year-old Graham Webb, who was care head at a West Kirby residential school, and Bournemouth man Robert Moses.

Some of the charges involve both McIntosh and Webb, who were leaders of activity holidays.

FORMER West Kirby residential school head Graham Webb and a vicar face indecency charges.

23 May 1997

Rev David Henry McIntosh, of Fenwick Lane, Runcorn, has been bailed with sureties of £2,000. A condition of bail is to make no contact with Webb. They will appear at Crown Court to plea on June 12, after being directed to the higher court by Wirral magistrates.

http://www.wirralglobe.co.uk/news/7439630.Head_and_vicar_face_sex_trial/?ref=arc

 26 Mar 1997

The Rev McIntosh had been staying at an address in Fenwick Lane, Halton Lodge, Runcorn, but has now been moved to a secret venue which was not revealed in open court.

Reporting restrictions have not been lifted.

link

A Church of England VICAR, the Rev David Henry McIntosh,

who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

The court was told that the “shower games” took place during Crusader holidays at a boarding school in Swindon, Wiltshire, in 1988,1994 and 1995 and at a weekend gathering of boys for a reunion at a church commissioner’s house in Llandudno in 1994.

His position was made more serious by the fact he had helped draw up documents advising leaders about appropriate behaviour with the boys.

The Church of England vicar, who resigned from his post at Barnton, near Northwich, after his arrest last December, used to work as part of a ministry team in Ellesmere Port

He studied maths and physics at Durham University.

He is charged with 19 indecent assault allegations at West Kirby, Swindon, Minehead, Malvern and Cheltenham, four matters of gross indecency at West Kirby and two other offences brought under the Sexual Offences Act.

He had been involved with the Crusaders for longer than his involvement in the church, attending more than 40 holidays during that period of time.

link

link

 December 1997

 PERVERT VICAR JAILED

 A VICAR who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

McIntosh, who was camp chaplain at the holidays at Pinewood boarding school, Swindon, from 1988 to 1991, became overall holiday leader there in 1993.

The two boys whom McIntosh abused in Llandudno were both from an Ellesmere Port school where he was vicar.

https://theukdatabase.com/2012/04/23/david-mcintosh-swindonruncornwarrington/

link

link


 Another Crusader charged with abusing boys at a care home:

image-24m

Mr Gilbart-Smith… who had led the Crusaders children’s group for fifty years was accused of abuse

All the allegations were said to have involved Mr Gilbart-Smith and others at Greenfield House children’s hostel in Maidenhead, Berkshire.

During that time the court heard residents were subjected to sustained, systemic abuse at the hands of the home’s managers and numerous visitors.

The youngsters were repeatedly raped and even ‘loaned out’ to other paedophiles elsewhere.

Mr Gilbart-Smith, a successful businessman, was accused of being one of those who took part in the sex attacks.

http://www.dailymail.co.uk/news/article-1292277/Paedophile-suspect-doused-petrol-victim-court-dock-drama-acquittal.html

Nine men “horrendously abused” by a paedophile ring in a children’s home 40 years ago have received an out-of-court settlement totalling more than £300,000

The civil settlement came despite the fact that no-one has ever been convicted of criminal offences regarding the abuse at the council-run Green Field House in Maidenhead, Berkshire, between 1964 and 1970

The home was then managed by ex-soldier Don Prescott, who died about 19 years ago.

He used to abuse the boys and rent them out to other paedophiles as far afield as Leicester, London, Cambridge and Reading

https://theukdatabase.com/2012/04/21/green-field-house-childrens-home-maidenhead/

“Unfortunately for the boys staying at Green Field House, it was the centre of a paedophile ring numbering so many men some of the boys lost count of those who abused them.

“They suffered the most horrendous abuse – it was the worst type of sexual abuse. They were filmed, photographed and had to take part in the abuse.

“… it went on for six years.”

http://news.bbc.co.uk/2/hi/uk_news/england/berkshire/6195572.stm

Nine men all with children and grandchildren claimed to have been raped by Gilbart-Smith the Lloyds investor during their stay at Green Field House children’s home Maidenhead (Theresa May’s constituency).

Gilbart-Smith, offered no defence other than a denial and a moral smoke screen, as he claimed to be a “Christian” who was a church leader at Foxes Piece School, Newfield Road, Marlow. Gilbart-Smith also told the court that he was a Bible teaching missionary and friends with a David Pawson.

http://www.thepaedotrial.com/crown-court-paedo-defence/

link

Oliver Denham Gilbart-Smith

Theresa May’s reply about Oliver Denham Gilbart-Smith & Green Field House child abuse scandal

https://companycheck.co.uk/director/903650898/MR-OLIVER-DENHAM-GILBART-SMITH/companies

Image result for Oliver Denham Gilbart-Smith

NOTE: Theresa May doesn’t respond to the question that was asked about the secret RBWM paedophile deal, but rather in typical politician fashion, she evades the question with statements like;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

Theresa May was specifically asked whether the secret £300,000 RBWM payment was moral, legal or in the public interest? For whatever reason the now Prime Minister has refused to look into this matter.

Myself and numerous other victims and or their MPs including; Norman Baker MP, Mike Thornton MP, Nick de Bois, MP, John Redwood MP, Mims Davies MP have all written to Theresa May as MP then Home Secretary and now Prime Minister asking the same question and Theresa May has consistently refused to answer this very simple question.

The Prime Minister & The Nobbler

In 1970 the council in Theresa Mays Maidenhead constituency, brushed the horrific Green Field House child abuse scandal under the carpet, hoping  it would never again see the light of day.

The child abuse surfaced again some thirty years later in 2000. Maidenhead police investigated but there was insufficient evidence to proceed with a criminal case, so a civil case was pursued by two complainants.

For the following five years *RBWM, denied the abuse ever took place. However, on the 29th November 2006 RBWM were forced to accept responsibility, and they agreed to settle a £300,000 compensation claim with nine rape victims, plus the considerable legal costs incurred from a five year investigation by solicitors Dyer Burdett.

*When we reference RBWM we are referring to the Royal Borough of Windsor & Maidenhead or Berkshire County Council (BBC) whose responsibilities RBWM inherited and or their insurers.

 

http://news.bbc.co.uk/1/hi/england/berkshire/6195572.stm

RBWM by settling the claims and paying £300,000 in compensation, agreed with the claimants and the Dyer-Burdett legal team that the unnamed man mentioned in the BBC website article, was a paedophile and had raped and abused 4 of the 9 claimants.

To recover their loss, RWBM immediately sued the unnamed man, who promptly paid RBWM £300,000 to cover their loss.

On top of the £300,000 the unnamed man also paid RBWM’s legal bill, including the costs relating to Dyer Burdett’s five year investigation. However, before committing to settle this payment, the unnamed man insisted on the following caveats:

  • RBWM would keep his name secret.
  • RBWM would keep the amount of cash he paid them a secret.
  • RBWM would exclude him from any future claims if they paid compensation to any more of his rape victims. 

With total disregard for the spirit of the law and public funds, RBWM amazingly agreed to the caveats and struck a deal with the now self confessed paedophile. This secret paedophile deal included a substantial payment to exclude the unnamed man from any future claims, if RBWM compensated any more of his rape victims.

THE BELOW STATEMENT IS A FACT!

The amount the unnamed man paid was over £1,000,000!

TO PAY HIS PAEDO-BILL THE UNNAMED MAN TOOK THE FOLLOWING ACTION!

April 12th 2007, the unnamed man sold his family home of twenty five years, Winterberry Jobs Lane, Cookham, SL6 9TX, for £1,475,000,00.

 

Winterberry Jobs Lane Cookham

Around the same time the unnamed man sold Ballyhaise Quarry Road, Marlow, SL7 1RE for £1,251,423,00. Ballyhaise had been a family home for about 35 years.

MORE INVESTMENTS WERE CASHED IN INCLUDING CAPE MARCO HOTELS.

 

By 2010 RBWM had settled 21 individual compensation claims for abuse that had taken place at the Green Field House children’s home. RBWM settled more than 10 compensation claims for rape by the unnamed man. None of the later claimants were made aware that their compensation claim was being paid with money RBWM had received from the rapist in a secret deal. 

After three years of writing to Theresa May concerning the corrupt RBWM paedophile hush payment with ZERO response, the below letter & the book Rich Man Poor Man was sent to 100’s of MP’s.

 

Out of the 300 MPs the letter and book was sent to, one Scottish MP Brian Donohoe responded with a phone call.  Mr Donohoe suggested that I approach Theresa May through my local MP which at that time was Mike Thornton, I acted on Mr Donohoe’s simple advice.

In the below email to Mike Thornton MP, RBWM break their secret agreement and name (Denham) Gilbart-Smith as the unnamed man that paid the RBWM rape bill. 

 

2010 17th May

After a 2 year police investigation, Gilbart-Smith stood trial for 17 charges of raping and abusing 8 kids as young as nine. The secret RBWM deal was not allowed to be mentioned during the trial.

WATCH THE TRIAL VIDEO 

  •  Gilbart-Smith agreed with the prosecution that all of his friends that went to the children’s home were paedophiles.
  • Gilbart-Smith agreed to being an unpaid helper at the kids home and going on holidays with the children and the paedophiles.
  • Gilbart-Smith agreed to being at the numerous places where the children were raped sold and abused by paedophiles.
  • Gilbart-Smith’s only defence during the six week trial was, he didn’t know that his friends were paedophiles, he had no idea that the boys were being raped by his friends, and he personally did not rape or abuse any of the boys.
  • Nine men who for the best part hadn’t seen each other for 40 years all claimed to have been raped or abused by Gilbart-Smith.
    (One of the 9 made a complaint too late for charges to be made)
  • The purpose of a jury is to return a verdict based on the evidence presented to the court, this jury returned a verdict in total contradiction to the overwhelming and robust evidence. All the jury had to decide in what for all intense and purposes was a ‘cut and dried’ case was: “Who is telling the truth, the nine men who hadn’t seen each other for 40 years or Gilbart-Smith?”

Watch the video and cringe at Gilbart-Smith’s pathetic lies, a jury of ten year old kids would have seen through Gilbart-Smith’s nonsense and found him guilty. In The Nobbler it is very clearly outlined how Gilbart-Smith, with no defence WHATSOEVER would once again outsmart the system with his wealth. If Gilbart-Smith had access to one million or fifty million pounds, all of it would be worthless to him in jail. No more Michelin Star restaurants for Greasy-Gilbart just porridge.

With the prospect of disgracing the family name and spending the rest of his life on the monster wing with child murderers, paedophiles, rapists and every other vile creature under the sun. True to his modus operandi, Gilbart-Smith paid out a large sum of *cash to nobble the jury.

*This would be very easy to establish as fact, seven years on a simple financial investigation on the jury members starting with the foreman would prove very interesting.

In 2010 Gilbart-Smith ran *IMS an insurance company that insured policy holders against kidnapping, international terrorism and such like. So Gilbart-Smith was no stranger to spooks and double dealing in the murky world of international intelligence, espionage, and subterfuge. Gilbart-Smith would communicate with spy academy type characters on a daily basis in his work environment.

*Gilbart-Smith is no longer connected with IMS.

http://www.bbc.co.uk/news/10513751

The author of The Nobbler John Affleck was sent to prison for 12 months for contempt of the court for protesting against the corrupt verdict. Gilbart-Smith left court a free man with the tax payer paying his massive legal bill. Had the jury found Gilbart-Smith guilty, he would have had to pay his own legal fees, so if the content of The Nobbler book is truthful, Gilbart-Smith in effect paid for his jury nobbling activities with tax payers money.

Instead of suing John for slander and false accusations including tampering with the jury and the murder of three blackmailers, immediately after the trial at the age of 64 The Nobbler swiftly cashed in his assets and left the UK, leaving behind his children and grandchildren, he became a citizen of Northern Cyprus, a Muslim country that has no extradition treaty with the UK.

…………………………………

After John was released from prison Maidenhead MP Theresa May refused to answer any of Johns correspondence for the following three years concerning this matter. However, Mrs May did write to another of Gilbart-Smiths rape victims who lives in her constituency.

 

NOTE: Theresa May doesn’t respond to the question that was asked about the secret RBWM paedophile deal, but rather in typical politician fashion, she evades the question with statements like;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

Theresa May was specifically asked whether the secret £300,000 RBWM payment was moral, legal or in the public interest? For whatever reason the now Prime Minister has refused to look into this matter.

Myself and numerous other victims and or their MPs including; Norman Baker MP, Mike Thornton MP, Nick de Bois, MP, John Redwood MP, Mims Davies MP have all written to Theresa May as MP then Home Secretary and now Prime Minister asking the same question and Theresa May has consistently refused to answer this very simple question.

ALL MP LETTERS  ARE IN THE JOURNALIST PACK

Prime Minister, instead of giving up salt & vinegar crisps for lent 2017, do you think it might be more appropriate for a person in your position to GIVE UP not answering a straight forward  simple question concerning the £300,000 rapist payment to the authority in your constituency?

 

On the 8th September John received a reply from Sarah Newton the minister for vulnerability at the Home Office. Incredibly Ms Newton advised John to complain to RBWM about the million pound plus payment that RBWM had received from  Denham Gilbart-Smith after RBWM accused Gilbart-Smith of raping around ten children in their care.

QUESTION FOR SARAH NEWTON THE MINISTER FOR VULNERABILITY

Dear Mrs Newton, Should I also complain to Mr Gilbart-Smith for raping me when I was a ten year old kid?

You really couldn’t make this stuff up, it’s taken five years to get that advice from the Home Office. 

http://thenobbler.com/


coatman mbe

Is John Coatman MBE  linked with these other Crusader leaders who have been charged with csa?

Is he part of a ring?

John Coatman reckons he’s been to about 300 Crusaders camps over the years”

link

“Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people”

link

Coatman …”rose to represent the club on a national and international level.”

link

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

“John (Coatman) was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member…”

policy statement urban saints

Coatman on the South East Regional Steering Group of the Urban Saints (formerly known as the Crusaders)

coatman steering group

The South East Regional Steering Group

The South East Regional Steering Group consists of  …

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

John was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member of the Croydon group.

link

John Coatman organised and took part in many residential Crusaders weekend on the Isle of Wight



crusader postcard

link

This Video May Prove Cliff Richard Is A Child Abuser

 “Richard faced accusations from four men, relating to the period between 1958 and 1983, but was never arrested or charged. The case was dropped by the Crown Prosecution Service in June, after it decided there was insufficient evidence to bring an action.”

I believe in the Devil, I spend more time with him than I do with God,” Would a devout Christian admit to that? I don’t think so.

link

proxy

Why does Kitty always refer to just one accuser (he) when he knows there were several?

link

it was 9 accusers…9!!! The file to CPS wasn’t blank! Good wholesome Christian who hangs about with shady characters


Misc info on Cliff Richard’s friend Paul O’Grady who worked at West Kirby Residential School

dsc_0390

Predator Savile’s attack on victim at High Royds Psychiatric Hospital in Menston

High Royds Hospital is a former psychiatric hospital south of the village of Menston, West Yorkshire, England. The hospital, which opened in 1888, closed in 2003 and the site has since been developed for residential use.

The hospital is located within in the City of Leeds metropolitan borough and was first opened on 8 October 1888 as the West Riding Pauper Lunatic Asylum.

It is near Ilkley.

In 1988, Jimmy Savile assaulted a patient at the hospital’s 100 anniversary celebrations.[1]

It was in 1988 that Savile was a guest at a garden party to celebrate High Royds’ 100th anniversary, said local historian Mark Davis.

He was a frequent visitor” said Mr Davis, a trustee of the Friends of High Royds Memorial Garden

http://www.ilkleygazette.co.uk/news/news_local/10168697.Predator_Savile___s_attack_on_victim_at_High_Royds/#
link

At Savile’s auction – a mug etched with ‘High Royds Hospital 1888-1988’ and ‘Presented to Jimmy Savile O.B.E. With our grateful thanks 9th July 1988.

Two victims were at High Royds Hospital, aged five and 45.

 

https://www.telegraph.co.uk/news/uknews/crime/jimmy-savile/10059496/Jimmy-Savile-further-details-of-hospital-abuse-revealed.html

 


I worked there (High Royd) from Oct 1984 to April 1987

Paul O’Grady used to work on one of the wards when I was there. He was a staff nurse and was training to be a comedian at the time.

http://www.highroydshospital.com/galleries/1902-2/

Menston

royds-hospital-to-st-marys-menston

High Royds Hospital to St Mary’s Menston School .6 mile


Menston

St Mary’s Menston Catholic Voluntary Academy

Perverts WILL be allowed to stay in the classroom

  • Teachers already cleared to return to work will not have cases reviewed

Image result for Geoffrey Bettley

Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Child porn: Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Bettley was working at St Mary’s Catholic High School in Menston, West Yorkshire, when he was arrested for downloading nearly 200 images.

He was cautioned and placed on a ‘barred list’ by the Independent Safeguarding Authority, although his name was taken off last June.

His case was heard by the National College for Teaching and Leadership professional conduct panel, which concluded that he was not a risk to children and the DfE backed the decision.

Peter Saunders, of the National Association for People Abused in Childhood, said he had ‘zero’ confidence in the Government’s ability to tackle child-related offences.

Everyone is aghast at the failure to grasp the common sense that everything must be done to ensure that these people can never go near classrooms again,’ he said.

Bettley, who joined St Mary’s in September 2001 from Yorkshire Martyrs Catholic School, in Bradford, West Yorks, was suspended from his job on December 9, 2010, and dismissed a year later.

In October 2011 the Independent Safeguarding Authority banned him from working with children, but removed the restriction on 21 June 2012


Mr Bettley, does not, in the view of the Panel, represent a risk to children and young people.

NAME OF DECISION MAKER: Alan Meyrick
DATE: 17 May 2013

Geoffrey Bettley

Former Employer:
St Mary’s, Menston, variously known as St Mary’s Catholic High School and
St Mary’s Catholic Comprehensive School
______________________________________________

link

National College for Teaching and Leadership (NCTL)

NCTL deputy director Alan Meyrick


LazerLight ‏@lazer_Light23

Alan Meyrick was Assistant Private Sec to Peter Brooke in NI. Hmmm


Image result for peter brooke kincora

Alan Meyrick Assistant PS 1989-91

uk.linkedin.com/in/alan-meyrick-a85aa86


Kincora: ‘Highest profile people connected to abuse’ claim

 Peter Brooke stonewalled.

The Kincora Boys’ Home in east Belfast was at the centre of a child abuse scandal in the 1980s

link

Kincora controversy

In February 1990, Brooke told Kevin McNamara, Labour’s then Northern Ireland spokesman, that the Kincora affair had been investigated ‘as fully and thoroughly as lies within the power of the Government to investigate it, and that no purpose would now be served by a further inquiry’

In October 1990, Brooke conceded for the first time, that the reports about the Kincora home came to the attention of the police.

link


Peter Brooke was sworn of the Privy Council in 1988. He was made Chairman of the Conservative Party in 1987, and then Secretary of State for Northern Ireland in 1989.

During his time as Heritage Secretary, he oversaw the restoration of Windsor Castle following the fire that had struck the state apartments in 1992.

via ww

Image result for peter bottomley i will sue

Peter Brooke’s PPS was a chap called Bottomley.

His PPS for a time was Peter Bottomley (1990). In September 1984, Peter was Parliamentary Under-Secretary of State at the Northern Ireland Office.

I’ll sue if anyone links me to untrue paedophile claims, says Tory grandee Sir Peter Bottomley

  • Worthing West MP issues public denial of any involvement in child abuse 
  • Denied there had been a major Establishment conspiracy to cover up abuse

Curious that after studying economics at Trinity College Peter Bottomley became a truck driver.

a very unlucky MP, Peter Bottomley at 2 disasters..

No it’s 3 ….Kings Cross, Heysel Stadium and Kegworth

No, it’s 4: EGH

 so ice cream van & truck driver Bottomley present at 4 areas of interest – & thrives


Alan Meyrick

Deputy Director Teacher Regulation at the Department for Education

Shrewsbury, United Kingdom
Education Management
Current
  1. Department for Education
Previous
  1. General Teaching Council for England,
  2. General Medical Council,
  3. Home Office – Metropolitan Police Committee
Education
  1. University of Cambridge

Experience

  • Deputy Director Teacher Regulation

    Department for Education
    April 2012 – Present (4 years 7 months)
  • Chief Executive

    General Teaching Council for England
    March 2011 – March 2012 (1 year 1 month)
  • Registrar

    General Teaching Council for England
    2000 – 2011 (11 years)
  • Head of Registration Policy

    General Medical Council
    April 1999 – March 2000 (1 year)
  • Deputy Secretary

    Home Office – Metropolitan Police Committee
    January 1996 – March 1999 (3 years 3 months)
  • Personnel Management and Programme Manager

    Home Office
    February 1991 – January 1996 (5 years)
  • Assistant Private Secretary to Secretary of State

    Northern Ireland Office
    January 1989 – February 1991 (2 years 2 months)
  • Internal Management Consultant

    Home Office
    September 1987 – January 1989 (1 year 5 months)
  • Project Officer

    Home Office Prison Department
    September 1985 – September 1987 (2 years 1 month)

    HM Prison

    Education

    • University of Cambridge

      BA Hons, Theology and Religious Studies
      1982 – 1985
    • King Edward VI School

      A’ Levels, English, Religious Studies; French
      1976 – 1981

    Service


St. Mary’s Menston
Bradford Road
Menston
West Yorkshire
United Kingdom
LS29 6AE

Jimmy Savile:  Two separate attacks in High Royds Hospital at Menston, near Ilkley, which treated psychiatric patients, in the 1970s and 1980s.



09c92615-b2b3-060a-b8836710146cc270

Paul O’Grady appointed MBE by Prince Charles – The star said: “I’m delighted. Now I’m part of the Establishment.”

Prince Charles – friend of  “creepy” Jimmy Savile:

prince-charles-jimmy-savile


 

Paul O’Grady:

Even now, 40 years on, the TV host and comedian shivers as he relives the night he saved the 18-month-old youngster’s life while working for social services. (Camden Council Social Services)

He tells how he fled the flat where he was keeping watch on the baby after a terrifying confrontation with the little lad’s drunken father – and how the drama ended with him making a desperate phone call to the Salvation Army for help.

Paul O’Grady reveals the terrifying moment in 1976 … he feared for his own survival

 Paul O'Grady: The Sally Army and Me

Paul O’Grady, while employed by Camden Council Social Services 

 took a toddler to a pub where Adam Ant was playing

Reliving his unforgettable ordeal in 1976, Paul says: “It was a dangerous situation for the kid, and for me.

“There were a few times when my life and that of The Sally Army crossed paths, but that night is one of the most memorable.”

After heading to London in the 70s, a few years before conjuring up Lily Savage , Liverpudlian Paul, then 21, worked for Camden Council Social Services providing respite care for families at home.

He says: “I remember the mother of this child had to go to hospital for an operation so I was there to look after him. He was only 18 months.

“It must have been about 2am when there was a banging at the door. I answered it …‘What are you doing carrying on with my wife?” he said.

“I tried to explain I was a care worker, but he just told me, ‘I want my kid.’

“‘You’re not getting your kid, mate,’ I said. ‘I’m sorry, you’ve got to get through me first.’

So I took the child in the middle of the night…I hurried into this club next to Camden Town tube. I remember Adam And The Ants* were playing a gig there that night.”

“I asked the manager if I could use his phone to call my duty worker. But I couldn’t get through to him for some reason. So I called The Sally Army instead and said, ‘can you bloody help me?’

“And they came. And they didn’t ask lots of questions. They wrapped the kid in a blanket. We had a place of safety in Kentish Town and they took him there.

http://www.mirror.co.uk/tv/tv-news/paul-ogrady-reveals-terrifying-moment-7635112


Adam Ant’s father, Alfred Leslie Goddard (left), was jailed for preying on runaway boys nearly 30 years ago.

 Leslie Alfred Goddard  worked as a chauffeur.

 

*Stuart Leslie Goddard/Adam Ant’s father- Leslie Alfred Goddard- was jailed in 1987 with Sidney Cooke as part of the Dirty Dozen gang.

http://aanirfan.blogspot.com/2015/08/goddard-cooke-adam-ant-and-security.html

Boys had been hawked around “safe houses” and passed on to other members of the gang which included council porter Alfred Goddard, father of 1980s pop star Adam Ant.

The former council porter was a member of a gang that included Britain’s most notorious paedophile, Sidney Cooke, who was later convicted of the sadistic gang rape and killing of a teenage boy and is suspected of murdering many more.

It has emerged that detectives investigating shock allegations of three murders and systemic child sex abuse by senior Establishment figures are looking into Goddard’s possible involvement.

Image result for westminster

The suggestion is that the child sex ring, dubbed the Dirty Dozen and known to have targeted vulnerable youngsters, could have passed on their victims for the MPs to abuse.

Image result for dolphin Square, Pimlico

At the time, Goddard lived in Eccleston Square, Pimlico, close to the exclusive apartments of Dolphin Square where the VIP child abuse ring is said to have been based.

29th Jan 1999 Sidney Cooke appears before Newbury Magistrates Court, charged with 14 serious sexual offences. which were said to have taken place in Battersea and Stockwell in south London; Twyford, Berks; Canterbury, Kent; Washington, Tyne and Wear and Hatfield, Berkhamsted and Tring in Herts.

link

adam-ant-margaret

Adam Ant’s mother was an embroiderer or the Queen’s dressmaker Norman Hartnell. and worked at Paul McCartney’s house as a cleaner.

Like Sidney Cooke, Leslie Alfred Goddard was also a chauffeur to rich families.
link

Alfred Leslie Goddard had served in the Royal Air Force.

https://en.wikipedia.org/wiki/Adam_Ant

Image result for martin allen missingImage result for martin allen missing

Anthony John Wixted‏ @TrojanManifesto

It looks like a young Harvey Proctor if you ask me…


Cliff Richard’s friend Paul O’Grady is a patron of  the Peter Tatchell Foundation

tatchell1

peter-tatchell-patrons

http://www.petertatchellfoundation.org/node/573

Is this the current CHE membership leaflet with photo of Nettie Pollard & Peter Tatchell from 2011?

“Pollard gave a constant stream of support to paedophiles and promoted their views.”

Photo below: Nettie Pollard (EC Member) with Peter Tatchell at the 2011 Annual Conference:

Nettie Pollard was member number 70 of the Paedophile Information Exchange.

link

tatchell-and-nettie-pollard

 

nettie-pollard

Pensioner backed Paedophile Information Exchange and may hold key to links with left wing groups

Nettie Pollard was a key figure in the London left – a Sunday People investigation reveals her to be a chief apologist for some of PIE’s most chilling demands

Even those who have lived beside her for years have little idea about her life – none of her neighbours has ever been invited inside the home she has lived in alone for almost 30 years.

But 69-year-old Nettie Pollard may hold the key to how the Paedophile Information Exchange infiltrated left wing groups in the 1970s.

She was a key figure in the London left, working for the National Council for Civil Liberties for two decades.

But a Sunday People investigation reveals Pollard to be chief apologist for some of PIE’s most chilling demands.

Our investigation found that throughout her career Pollard gave a constant stream of support to paedophiles and promoted their views. She also:

  • Supported PIE’s call to scrap the age of consent.
  • Argued against the introduction of a bill to protect children.
  • Sat on committees with known ­paedophiles and PIE members.
  • Wrote a twisted essay defending sex between adults and children.

It emerged MP Harriet Harman, ­husband Jack Dromey and former Health Secretary Patricia Hewitt had been involved with the NCCL when PIE was affiliated to it.

Mrs Harman has subsequently moved to distance herself from Pollard and paedophiles, with a spokesman stating they “did not influence any of the work she did there”.

Image result for harriet harman pie

However one source involved with the London left in the 70s claims – ­embarrassingly for Mrs Harman – that she and Pollard did work together on occasions within the NCCL .

The source said: “Nettie was a big presence in the movement back in the 1970s and couldn’t be ignored by anyone wanting to get on in the NCCL.”

Our investigation first places Pollard in 1975 working as the Gay and Lesbian Officer for the NCCL.

And that brought her into close ­contact with the infamous PIE – the child sex group which campaigned to have the age of consent lowered or scrapped.

As well as her role at the NCCL, Pollard was and remains a significant member of the Campaign for Homosexual Equality – a group that defended PIE’s rights at their 1983 conference.

But even after PIE was disbanded in 1984, Pollard made no secret of her ­sympathy for the organisation’s aims.

In 1993 she contributed a ­defence of the ­sexualisation of youngsters to a book called Bad Girls and Dirty Pictures.

Entitled The Small Matter of Children, Pollard’s essay draws on work by known paedophiles such as former PIE vice-chair Warren Middleton to build its case.

Pollard argues child sex should be legal if the act is “consensual”.

It also uses language like “willing partners” to describe sex between adults and children.

But by far the most disturbing section is Pollard’s attempt to justify the sexualisation of children.

She writes: “Far from being ‘innocent’ and becoming sexual at puberty, as was once the common belief, it is now indisputable that everyone is sexual, even before birth.”

The research cited was also used in PIE’s bid to reduce the age of consent to just four.

Pollard continued to work for the NCCL until her mysterious ­departure from the group in 1997.

She was made redundant but reports from Feminists Against Censorship implies murkier reasons ­behind her exit.

A ­newsletter from the time reads: “Within the last several months, two of NCCL’s employees have remarked that the organisation’s longest-serving staff member, Nettie Pollard, was the last civil libertarian left on the payroll.”

Challenging the cost-cutting explanation given it added: “Since she is one of the few indispensable staff members, and the most ­expensive to make redundant, we suspect economy is not the reason.”

Pollard, whose Facebook page currently shows her support for causes including an anti-drones campaign and attacks on the “Big Brother” state, also showcases her taste in music with a link to indie rock band The Donutsh – described by one of their following as sounding “like Johnny Cash biting off Johnny Rotten’s head”.

She refused to answer the door to us when we visited her home.

 Image result for harriet harman and nettie pollard
Harriet Harman and Peter Tatchell

 

link

Peter Tatchell was a leading member of the Gay Liberation Front (GLF) but never knew or met any GLF members that where paedophiles like John David Stamford ?


Harriet Harman, PIE , etc …..

Is Peter Tatchell A Paedophile Or Simply Misunderstood?

Peter Tatchell was born in Melbourne Australia on 25th January 1952, he moved to London in 1971 to avoid conscription. In 1978 Tatchell joined the Labour Party and moved to Bermondsey, South East London. Tatchell ran as the Bermondsey Labour Party candidate in the 1983 General Election. Despite Bermondsey being a Labour stronghold he lost to Liberal candidate Simon Hughes. In February 2000 he left the Labour Party for unknown reasons. In 2004 he joined the Green Party and was chosen to be their candidate for Oxford East in the 2010 General Election, however for some reason he withdrew his candidacy in 2009.
Comrade Tatchell
Peter Tatchell (the UK’s most prominent homosexual activist and a favourite of the BBC) has done more than demand the abolition of the age of consent, he has broken the law on the age of consent in Britain at least once.

Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophilie apologist.
Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophile apologist. They have also refused to state how much they have paid him for appearances.

As a gay 18-year-old Australian anti-Vietnam war draft-dodger, he came to the UK in 1971 and lived with a 16-year-old boy in London. The homosexual age of consent in England at the time was 21. Later he campaigned for lowering it to 16, and now he wants it lowered again to 14. What will he want after that?

When the age of consent for homosexuals was lowered to 16 an Outrage (Tatchell’s organization) banner said “16 is just a start” – it didn’t state what the end goal was.

Mr Tatchell criticises the age of consent laws. Here is a quotation from his own website:

“Nevertheless, like any minimum age, it is arbitrary and fails to acknowledge that different people mature sexually at different ages. A few are ready for sex at 12; others not until they’re 20. Having a single, inflexible age of consent doesn’t take into account these differences. It dogmatically imposes a limit, regardless of individual circumstances“.

Peter Tatchell wrote the chapter “Questioning Ages of Majority and Ages of Consent” for a book openly advocating paedophilia and finding ways “to make paedophilia acceptable“.

This book, published in 1986 and called The Betrayal of Youth (B.O.Y.), was edited by Warren Middleton, then vice-chairperson of the Paedophile Information Exchange, Britain’s number one paedophile advocacy group.

Stephen Green, anti-paedophile campaigner wrote: “The book was part of a campaign to abolish all ages of consent, destroy the responsibilities of parents for their children, deny any ill-effects on children of interference by paedophiles, and withal to make it easier for paedophiles to gain sexual access to children.“

In The Betrayal of Youth Tatchell wrote that the age of sexual consent is “Reinforcing a set of increasingly quaint, minority moral values left over from the Victorian era“.

Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.
Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.

He was not on his own in this belief.Many of his fellow socio-communists and homosexual activists thought the same:

Campaign for Homosexual Equality chairman Michael Jarrett was identifying paedophiles as an oppressed group, and the CHE list of “demands” included the complete abolition of minimum ages for sexual activity. The Labour Gay Rights Manifesto of 1985 said ‘A socialist society would supersede the family household. … Gay people and children should have the right to live together. … It follows from what we have already said that we favour the abolition of the age of consent.’

27092011583[1]


Feminists like Beatrice Faust contributed to The Betrayal of Youth, as well as other homosexual activists besides Tatchell, including Jeffrey Weeks and Eric Presland, who “related his first paedophile experience with an Asian boy of thirteen, and boasted of interfering with a little boy of six“.

The book is considered so toxic that Amazon doesn’t sell it and you cannot search its content in Google Books.

Tatchell is well aware of how much all this is bad publicity for him and keeps rationalizing and adjusting his positions, but only the ideologically blind or pathologically naive cannot see through his self-excuses.

He has prepared a standard self-defence which can be found on his own website and has been repeated verbatim on many outlets. It used to also be on the site of his friend militant atheist, Richard Dawkins, but it’s not there any more. Maybe even Dawkins draws a line at what is morally allowed, even though his motto is “There’s probably no God – now stop worrying and enjoy your life”.

In this article that supposedly should serve to exculpate him, Tatchell has nothing better than this: “The critics also cite Warren Middleton’s 1980s book, Betrayal of Youth, to which I contributed a chapter. I had no idea that he was involved in child sex abuse matters when I was asked to write.”

Considering that Warren Middleton was co-founder and vice-chairperson of the Paedophile Information Exchange (PIE), a prominent group promoting paedophilia, it was impossible for Tatchell not to have known his propensities. In addition, both Tatchell and Middleton were part of the Gay Liberation Front/Angry Brigade, a neo-Marxist revolutionary group of radical students at the London School of Economics, thus making Tatchell’s protestations of ignorance verge on the ridiculous.

Peter Righton of the Paedophile Information Exchange.
Peter Righton of the Paedophile Information Exchange – a Child welfare expert who wanted the age of consent lowering to four.

Were you aware that Tatchell contributed a chapter to this book?

THE BETRAYAL OF YOUTH

The contents and contributors of The Betrayal of Youth:

Chapter 1: ‘Incest’ by Clive Coliman: Described as “An ardent supporter of the children’s rights movement.”

Chapter 2: ‘Child Pornography and Erotica’ by Richard Green: Illustrator for the Paedophile Information Exchange magazine under the pseudonym “Dominik”

Chapter 3: ‘Child Prostitution’ by Warren Middleton of P.I.E.

Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from the anti-Christian Peace News.

Chapter 5: ‘Power and Consent’ by Eric Presland: Homosexual activist. Contributed also to the American paedophile book “The Age Taboo.”

Chapter 6: ‘Love and Let Love’ by Tuppy Owens, Editor of the Sex Maniac’s Diary, and Tom O’Carroll: ex-Chairman of P.I.E. who was convicted in 1981 of conspiracy to corrupt public morals by sending out a paedophile contact list.

Chapter 7: ‘Children and Sex’ by Fr Michael Ingram: Catholic priest, defender of paedophilia.

Chapter 8: ‘The Paedophiles’ by Beatrice Faust: militant feminist & civil libertarian.

Chapter 9: ‘Questioning Ages of Majority and Ages of Consent’ by Peter Tatchell.

Chapter 10: ‘Ends and Means: How to Make Paedophilia Acceptable?’ by Roger Moody of Peace News: “One of the most outspoken advocates of children’s rights in Britain .” Well-documented as a ubiquitous paedophile intellectual.

Chapter 11: ‘Socialism, Class, and Children’s Rights’ by John Lindsay: “ardent supporter of children’s rights.” Member of the Socialist Workers’ Party. Homosexual activist, hates the institution of the family.

Chapter 12: ‘Childhood Sexuality and Paedophilia: Some Questions Answered’ by Warren Middleton of P.I.E.

Chapter 13: ‘The Oppression of the Young: An Inside Perspective’ by Jeff Vernon: Involved in Gay Youth Movement and Campaign for Homosexual Equality.

Appendix 1: “P.I.E., from 1980 Until its Demise in 1985” by Steven A. Smith: ex-chairman of P.I.E. Fled to Holland in 1984, became “active in the Dutch crusade for children’s rights,” was deported back to the UK in 1991 and sentenced to 18 months for sending indecent articles through the post.

Appendix 2: “The Uranians” by Timothy d’Arch Smith: Bookseller. Author of “Love in Earnest.”

Peter Tatchell’s self-defence begins with:

“Unlike many Catholic clergy, I have never abused anyone. Unlike the Pope, I have never failed to report abusers or covered up their crimes.”

These are blatant falsities. It wasn’t many Catholic clergy, it was an extremely small minority. And, as shown in Lies About The Catholic Church Child Sex Abuse Scandal, there is no reason, except bigotry and prejudice, to single out Catholic clergy who in fact have committed fewer of these crimes than any other pedagogic institution, religious or secular.

Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religous values.
Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religious values.

Saying what he does about the Pope is a criminal act, it is slander. The Pope has never covered up for anyone.Tatchell and his friends in the mainstream media (especially the BBC) think that if you repeat a lie enough times your audience will start to believe that it’s true.

But blaming the Church whenever you’re in trouble is a good way to distract the public from your own deviations from the norm. It’s worked so far so why shouldn’t it work now? Maybe because people have started calling your bluff, Pete.

Peter Tatchell has a seething hatred of Christian morals and values.
Peter Tatchell has a seething hatred of Christian morals and values.

The above should tell you how trustworthy and credible Tatchell is, but there’s more.

Look at his defence of the book Dares To Speak:

“Dares to Speak was an academic book published in 1997, authored by professors, anthropologists, psychologists, sociologists, a Dutch senator and a former editor of a Catholic newspaper. It discussed the age of sexual consent and whether all sex between young people and adults is necessarily unwanted and harmful, based on what it said was objective research with young people.

The book does not endorse or excuse sexual relationships with young people that involve coercion, manipulation or damage. The authors queried, among other things, the balance between giving young people sexual rights and protecting them against abuse. These are entirely legitimate issues to discuss.”

Leaving aside the irony (probably lost on humorless Tatchell) about his using a “former editor of a Catholic newspaper” as a guarantor of the morality of a book while he constantly treats the Catholic Church like a den of abusers. The book Dares to Speak, that Tatchell praises so much as an academic achievement, was edited by Joseph Geraci, who was also the editor of Paidika: The Journal of Paedophilia. The book is a collection of articles from the journal.

Before it was quietly removed, this was Wikipedia’s entry for the publication:

Paidika: The Journal of Paedophilia (1987–1995) was a journal published by the Stichting Paidika Foundation whose purpose was to promote the normalization of pedophilia. Its editor was Joseph Geraci and the editorial board included articles by writers Frits Bernard, Edward Brongersma, Vern L. Bullough, and D. H. (Donald) Mader, some of whom campaigned as pro-pedophile activists.

After the normalization of homosexuality, we’ll have the normalization of paedophilia.


Image result for Maloney and Tatchell protesting TOGETHER against the Pope


Image result for Maloney and Tatchell protesting TOGETHER against the Pope

2010

Does Bill Maloney not know about Peter Tatchell?

tatchell1

 

 

Graham Ovenden was a Guest Editorial of Paidika Journal of Paedophilia in 1994

PAIDIKA NUMBER 10 WINTER 1994: Guest Editorial: Fall from Grace, by Graham Ovenden

Paidika: The Journal of Paedophilia
Full-Text Files (PDF, GIF and plain-text searchable HTML)
Documents Not Likely to be Widely Available in Libraries
archived here by
Gerald Jones, Ph.D.
University of Southern California, 1964-2007:
Student, Lecturer, Adjunct Assistant Professor of Statistics, Staff (Retired)

15092011573[1]

http://zoompad.blogspot.co.uk/2013/06/paidika-number-10-winter-1994-guest.html


Here is Tatchell’s letter to the Guardian dated 26th June 1997 (a few weeks after Labour’s General Election win) which he denied writing when I asked him about it. However I can find no record of a complaint to the Guardian, the Press Complaints Commission or any lawsuit for libel:
Ros Coward (Why Dares to Speak says nothing useful, June 23) thinks it is “shocking” that Gay Men’s Press has published a book, Dares To Speak, which challenges the assumption that all sex involving children and adults is abusive. I think it is courageous. The distinguished psychologists and anthropologists cited in this book deserve to be heard. Offering a rational, informed perspective on sexual relations between younger and older people, they document examples of societies where consenting inter-generational sex is considered normal, beneficial and enjoyable by old and young alike.
Prof Gilbert Herdt points to the Sambia tribe of Papua New Guinea, where all young boys have sex with older warriors as part of their initiation into manhood. Far from being harmed, Prof Herdt says the boys grow up to be happy, well-adjusted husbands and fathers. The positive nature of some child-adult sexual relationships is not confined to non-Western cultures. Several of my friends – gay and straight, male and female – had sex with adults from the ages of nine to 13. None feel they were abused. All say it was their conscious choice and gave them great joy. While it may be impossible to condone paedophilia, it is time society acknowledged the truth that not all sex involving children is unwanted,abusive and harmful.
Peter Tatchell.
Picture 9
Peter Tatchell has repeatedly denied writing the letter above. However below is his reply in the Guardian (1st July 1997) to criticism of his original letter. In his second letter (below) he never denies writing the first letter (above) or claims he was edited in any way.
Peter Tachell’s second letter to the Guardian on 1st July 1997.
Peter Tachell’s second letter to the Guardian on 1st July 1997.

Peter Tatchell has often claimed he lives a monk-like existence living on a mere £9,000 income per annum. When I challenged him on this he changed his claim to £29,000 plus expenses. However he has refused to disclose his payments for his numerous main stream media appearances or disclose how much his yearly expenses are.
Peter Tatchell in his Council flat.
Peter Tatchell in his Bermondsey Council flat.

Peter Tatchell has declined to be interviewed for this article, however I will leave him the option of the right of reply in the comments section.

__________________

P.I.E – Paedophile Information Exchange

Members/Activists/Connected of P.I.E
Former PIE Chairperson and current pro-paedophile activist Tom O’Carroll
tom

David Joy, 66 – once No2 in the notorious Paedophile Information Exchange. In 1984 he was jailed for 18 months for publishing obscene material in a PIE newsletter. In 1996 he got two more years after admitting indecent assaults dating back to the 80s. Then in January 2006 cops found 1,129 images of children aged one to 13 at his rundown flat in Loughborough, Leics. Some were in the level 5 category – featuring sado-masochism, torture or bestiality.
david-joy1

DR Morris Fraser – P.I.E founder member & leading child psychiatrist – had a criminal record for taking indecent photographs of children and assault in 1972. Good friends with both Napier, Waters and Righton
morris

Terrence Waters – Former prep school teacher – Closely linked to several P.I.E members incl Andrew Sadler – adopted the alias “James Opphin daler”. The name contains an anagram of the word “paedophile”. In 1994 Waters was sentenced to ten years for possessing child abuse images and the sexual abuse of a 10 year old boy. In 2011 convicted for more sexual abuse against children at Allen House School – More on Waters on this link
Michael Johnson – jailed for four years on six specimen counts of indecent assault against two boys aged nine and 11. In 1988 Dr Morris Fraser and Michael Johnson set up a sailing charity for disadvantaged boys called the Azimuth Trust based in Cornwall.
Andrew Sadler – Former teacher who was jailed abroad for sex offences against boys – Links to Fraser and Napier –
Andrew Sadler

More on Sadler on this link
Leo Adamson helped set up Pie to distribute obscene pictures of young boys while John Parratt aka Warren Middleton was a former vice-chairman of the organisation
Leo Adamson, left. John Parratt right

Former chairman/leader Steven Freeman aka Steven Adrian Smith
freeman

Freeman/Smith was a former Home Office security guard and was described in court in 1984 as the, “powerhouse and engine room of P.I.E, and the life blood of contact which he edited and printed.
The members’ hotline for the Paedophile Information Exchange (PIE) rang, of all places, inside the Home Office. The phone would be picked up by Steven Smith, a paedophile and member of the group who worked in security in Whitehall, from where he would tell callers where to go for the next meeting to discuss issues including decriminalising sex with children as young as four.
John Morrison and Barry cutler – Members
john morrison left. Barry Cutler, right

Geoffrey Prime – Former member and KGB spy
957218

Sir Peter Hayman – Several links to P.I.E and its members – Former High Commissioner to Canada
peterhayman01

Notorious paedophile and TV presenter Jimmy Savile was almost certainly a full member of P.I.E
Jimmy+Savile

Peter Bremner (aka Roger Nash) Member level – Bremner has convictions for indecently assaulting children. Jailed for 6 months in 1994 with David Joy. in 1978 Bremner was given a three month prison sentence suspended for 2 years and fined £150 for indecently assaulting 3 boys, two aged 8 and one aged just 5
peter brmner

John Stamford – A former church minister published international guides for child molesters. He died before his trial. Stamford used a homosexual travel guide called spartacus as a front for a mailing ordering service offering information on child prostitutes in Thailand, Brazil and other nations. The organisation was alleged to have operated through a box number in London. The details of each of the members, including their sexual preferences, the desired age of the children and preferred countries of origin were stored on a computer. The members received personalised lists of children.

For more on Stamford and Spartacus magazine click here
Stephen King aka Stephen Gosling – so called child expert was a member of P.I.E. His unbelievable role was to advise UK judges on sentencing for paedophiles
stephen_king

Richard Bigham – Eldest son of viscount of Mersey admitted he was a member

Former Vicar and millionaire Michael Studdert –financial backer and member level millionaire-michael-studdert

David Wade – The treasurer of P.I.E
Entry level members – Robert Bushell, Geoffrey Taylor, David Hooper, Nigel Beatman – Click this to see summary of their convictions

P.I.E members jailed in 1978

April 1978

‘Sinister Group Passed Boys Round The System’

A CHILD-SEX campaign was branded by an Old Bailey judge as a ‘sinister group’.

‘The Paedophile Information Exchange must cause deep anxiety to people who care about the welfare of children,’ said Judge Brian Gibbons.

His criticism came when he jailed four of the nine men who admitted homosexual acts with young boys and indecent assault. The others were given suspended sentences and fined.

Two of the men had met through the Exchange and a network of communication had been developed among the nine who ‘passed boys round the system.’

One of the men, 26-year-old Robert Bushell, of Golders Green was described by the judge as the worst offender.

He had committed some of the offences in the dormitory of a Surrey boarding school.

Judge Gibbons told him ‘You corrupted the uncorrupted at an early age. I consider you a grave danger to children.’

Judge Gibbons also jailed Geoffrey Taylor, aged 65, for four years for indecent assault; David Hooper, aged 35, four years for buggery; and Nigel Beatman, aged 32, jailed for 30 months for indecent assault.

 

Michael Hanson – First chairman (set up P.I.E. as a special interest group within the Scottish Minorities Group with Ian Dunn)
Keith Hose – 2ND Chairman In the PIE Chairperson’s Annual Report for 1975-6, Keith Hose wrote that ‘The only way for PIE to survive, was to seek out as much publicity for the organization as possible…. If we got bad publicity we would not run into a corner but stand and fight. We felt that the only way to get more paedophiles joining P I E… was to seek out and try to get all kinds of publications to print our organization’s name and address and to make pedophilia a real public issue.’
British antiques expert Keith Harding was active in the Paedophile Information Exchange
Harding was convicted of indecent assault against four children aged eight and nine in the late 1950s and was a “schedule 1” offender – meaning his convictions remained on his police file for life.
But he was later given the Freedom of the City of London and became a member of the Worshipful Company of Clockmakers, meeting business and political figures at the height of his career. The clockmaker and music box expert ran a museum regularly visited by children, despite social services being aware 20 years ago of his convictions for child abuse.
harding1

A document held by police in the mid-1980s listed Keith Harding as PIE member number 329 next to his north London address.
Ian Campbell Dunn – Co-founder (born 01/05/43 died 10/03/98)
iandunn1

Shortly before his death, Dunn, a prominent gay activist, became convener of lobby group Outright Scotland. In 1997, he condemned police over a camera surveillance operation in public toilets in Stirling which led to several gay men being charged – even though the investigation also revealed that some men had sex with a 13-year-old boy. In 1974, Dunn co -founded the Paedophile Information Exchange ( PIE) with Michael Hanson. It became the leading contact group for adults campaigning for the right to have sex with children. In an interview in 1997, Dunn admitted he and Hanson had agreed to facilitate research into sex with children.
Dunn was caught on tape bragging abut interfering with a fourteen-year-old boy. The existence of the tape caused him to abandon a libel action he had brought against a Sunday newspaper, which named him as a paedophile. The encounter itself does not seem to have been a one-off – at his funeral in 1998, a young man claimed Dunn had raped him when he was fifteen. Dunn also supported a paedophile magazine called ‘Minor Problems.’
Charles Napier One-time treasurer of PIE Charles Napier is alleged to have sexually assaulted boys whilst a gym master at Copthorne School. He became an English Language Trainer at the British Council and was convicted of sexual assault against minors in London in 1995 and investigated as an alleged member of a paedophile network operating in British schools in 1996. He set up his own school in Turkey and resumed English Language Training with the British Council after serving his sentence
Charles Napier

Michael Dagnall · Tony Zalewski – Lee Edwards –Named in Daily Express, 26th August 1983

Lee Edwards aka Edward Brand executive committee member of PIE Does the photofit look like him ?

 

Lee Edwards & the Paedophile Friendship Service

Bernard Haunch – Teacher – He was also a member of a group called the Paedophile Information Exchange but apparently claimed it was a discussion group
Bernard Haunch

Dr Edward Brongersma (Deceased) – has written extensively in the area of sexuology, especially on pornography, ephebophilia, pedophilia and the age of consent. His books on this subjects include: Das Verfehmte Geschlecht (in German, 1970), Sex en Straf (“Sex and Punishment”, 1972), Over pedofielen en kinderlokkers (“On Pedophiles and Child Molesters”, 1975), and his last work is his magnum opus and entitled Loving Boys (two volumes, 1988–1990).
Dr Edward Brongersma

Peter Righton AKA Paul Pelham – Righton was the former director of education at the National Institute for Social Work, and a consultant for the National Children’s Bureau. Yet he was also a founding member of the Paedophile Information Exchange (PIE), which wanted the age of consent reduced to four. Righton published essays justifying paedophilia, which he called no more mysterious than “a penchant for redheads”. Police raided his home and found hundreds of letters between him and other paedophiles
peter ri

Warren Middleton, aka John Parratt one of PIE’s first London members – Creater of the Understanding Paedophilia (UP) magazine that was eventually replaced by Magpie
Michael Dagnall – Close friend and fellow abuser with Tom O’carroll Click this , it mentions Dagnall and P.I.E involvement @ page 19
Richard Travell – Active member status – Travell was handed a three-year community order in 2006 for possessing indecent images of children.
Untitled

Alan John Doggett (1936-1978), (pictured above) conductor, composer and choir master. Leader of London Boys Choir – A letter in Magpie 10 reported and commented on the suspected suicide of Alan Doggett weeks before he was due to face child sex charges for having sex with a choir boy. Hit by train. Also has links to a certain Paul Raven aka Gary Glitter
C. J. Bradbury Robinson – American author who wrote several times for Magpie magazine – His pro-paedophile books include A crocodile of choirboys “Bare Knees, Boy Knees.” The latter offers an “unmatched” and “startling trip into the strange world of the Paederast,” says the description on Amazon, which has one used copy for sale for $500
Richard James – Writer at Magpie
Paul Green – Writer at Magpie
Peter Deathman – P.I.E member who was regulary visited in prison by Tom O’Carroll. Deathman served a 10 year sentence not for mere sexual abuse but for child stealing
Den Nichols – Author of paedophilia literature called “Towards a Better Perspective For Boy-Lovers”. Published in 1976. In its preface to ‘serious minded adult males who feel an existential attraction to young boys”. Copies were advertised and sold by P.I.E/Magpie for £1 each, including post & packaging
David Grove – AKA Robin Brabban – born 1904 – secretary and Ex treasurer of PIE
Michael Walker – London – Member level of P.I.E – He did not agree on certain issues of P.I.E but condemned hostility against P.I.E
Anthony Green – Somerset – He attended a meeting of P.I.E that was attacked by the Nation Front. He urged tolerance and understanding of paedophiles
William Thornycroft – He was disgusted at attacks on P.I.E. He was quoted “The sexual freedom of children was needed” – Member of Communist Party Gay Rights Committee in the 70’s
Robert Atkinson – Newcastle teacher was arrested for sexually abusing a 13 year old student. He was fined £200. The headmaster and staff however continued to support him after the his guilt. Member level status in P.I.E
Ian Harvey – P.I.E member – He sought to differentiate bewteen “good paedophiles” and pedarasts, but without defining his terms or explaining why
Micky Burbidge – He supported P.I.E’s proposal to abolish the age of consent laws. Also wrote a book entitled“Evidence on the law relating to and penalties for certain sexual offences involving children for the Home Office Criminal Law Revision Committee” with Kieth Hose
Frits Bernard (1920 – 2006) was a Dutch psychologist,sexologist, homosexual activist, and pro-pedophile activist.Together with the late Edward Brongersma, he laid the foundations of the emancipation movement of boylovers in the Netherlands.
Keith Spence – He applauded the “courage” of the leaders of P.I.E in the face of ; quote – Hysteria, hostility and violence, also wrote several paedophile articles for Magpie about sexual abuse of young boys
June 1983: Scoutmaster Michael Williams of Castle Bromwich. Birmingham, resigned after being exposed as a member of P.I.E
Jane Rule – Canadian Writer of lesbian-themed novels and non-fiction. Co author of Magpie: Journal of the Paedophile Information Exchange – Also supporter of NAMBLA (The North American Man-Boy Love Association (NAMBLA) was founded in December 1978 and is an activist homosexual and pedophilia coalition group. Their primary aim is stated to be the overturn of statutory rape laws and reduction of “age of consent” laws that require a child be of a certain age (which varies by state) before they can agree to sexual intercourse.
John Finnin – Co author of Magpie: Journal of the Paedophile Information Exchange
Peter Saxon – Co author of Magpie: Journal of the Paedophile Information Exchange
Derry Webster – Tom O’Carroll was named in court as a ‘customer’ for Webster’s child abuse images and video collection. Webster was jailed for his part for selling the obscene films, magazines and pictures
Kenneth Plummer – Involved with O’Carroll. He stated “Any study that can take adult-child sexuality out of the zone of shrieking horror and place it in the demystified zone of everyday experience must be welcomed”. sociologist Dr Kenneth Plummer of Essex University, sent a “warm message of support” for “Betrayal of Youth,” and, in company with Nettie Pollard and Professor Donald West (qv), also read, made suggestions and then praised “Paedophilia the Radical Case” receiving “heartfelt thanks” from its author, Paedophile Information Exchange Chairman Tom O’Carroll. Attented several P.I.E meetings
.
.Harman letter PIE http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://www.telegraph.co.uk/news/politics/labour/4949555/Harriet-Harman-under-attack-over-bid-to-water-down-child-pornography-law.html
.
http://cigpapers.wordpress.com/2013/06/05/p-i-e-paedophile-information-exchange-exposed-part-two/
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://en.m.wikipedia.org/wiki/Age_of_consent_manifestations_(UK)
.
http://labour25.com/category/age-of-consent/
.
http://en.m.wikipedia.org/wiki/Liberty_(pressure_group)
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://blogs.spectator.co.uk/nick-cohen/2014/02/when-is-a-scandal-not-a-scandal/.
.
http://ufohunterorguk.com/tag/nccl/
.
http://www.wikileaks-forum.com/united-states/479/the-truth-about-some-politicians-backing-practicing-pedophiles-and-cp/15984/
.
http://www.theguardian.com/society/2014/feb/26/lobbying-paedophile-campaign-revealed-hewitt
.
http://aangirfan.blogspot.co.uk/2013/02/nspcc-mi6.html?m=1
.
PIE’s new name
http://www.libertarian.co.uk
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-
love/p-i-e
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-love/p-i-e/
.
Tony Blair part of PIE
http://www.thedailybeast.com/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html#url=/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html
.
PIE & HMqueen
https://m.facebook.com/story.php?story_fbid=638499922852151&id=100000764465111&refid=7&_ft_=qid.5988561366331161130%3Amf_story_key.1134116637656814874
.
http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://dailybalenews.com/2014/02/08/paedophiles-plan-to-build-village-in-devon-update/
.
http://m.couriermail.com.au/news/opinion/opinion-why-does-the-left-support-this-avalanche-of-pedophile-filth/story-fnihsr9v-1226861620956
.
Liverpool (NICHE)
http://sindonax.wordpress.com/2014/03/25/paedophile-cover-ups-the-hows-and-whys/
.
PIE
http://spotlightonabuse.wordpress.com/category/pie-paedophile-information-exchange/
.
https://docs.google.com/file/d/0B4PQp1NQ39MPYzU5NDVhY2QtMWViYi00MDRkLWE4OWQtOTc2NjA5MWZiNWI3/edit
.
http://ianpace.wordpress.com/2014/03/15/pie-and-the-home-office-three-memberssupporters-on-inside-funded-magazine-printed-and-phone-line/
.
http://web.archive.org/web/20041116144121/http://home.wanadoo.nl/host/wilson_83/index.htm
.
Labour controlled BBC
http://gaiusmarcellus.blogspot.co.uk/2010/03/unacceptable-links-between-labour-and.html

Silent
http://www.silentlambs.org/
Silent
http://iamthewitness.com/listeners/Jewish.child.molesters.that.are.never.on.the.NEWS-WHY.htm
.

https://gettingreadyfor2015.wordpress.com/2014/01/18/a-bill-maloney-up-date/
.
http://www.real-whitby.co.uk/savilejaconelli-yewtreehibiscus-sborough-paedo-ring-time-line
.
http://www.nationalarchives.gov.uk/a2a/records.aspx?cat=097-hcagrey&cid=-1
.
https://m.facebook.com/story.php?story_fbid=747913618599372&id=100001422211809&refid=28&_ft_=qid.6033289562555813767%3Amf_story_key.2800040682799693877&__tn__=%2As&fbt_id=747913618599372&lul&_rdr#s_ff81768c6432b3819fe18456041bb4e6
.
http://order-order.com/2014/07/08/watch-former-tory-whip-boasts-about-paedo-mp-cover-up/

LINK

Arlo Tatum,[1] the executive secretary of the Central Committee for Conscientious Objectors, sued Melvin Laird, the Secretary of Defense. Tatum sued after Washington Monthly published an article revealing that US military intelligence units were gathering https://twitter.com/cassandracognointelligence on civilians and civil organizations in the US.[2]

8

Arlo Tatum moves to UK & joins Albany Trust after suing US army for alleged unlawful “surveillance of lawful citizen political activity.”

Tatum had composed and sung songs for Aldermaston peace marches during the 50s and had also become the Director of Peace News. [Arlo Tatum obituary, The Guardian 7 May 2014]

And Jack Straw’s autobiog reveals his MI5 file started from the Aldermaston marches

During 1975, while Paedophile Information Exchange member Roger Moody was working for Peace News he was promoting the organisation in its pages.

https://bitsofbooksblog.wordpress.com/2015/02/23/march-1977-albany-trust-arlo-tatum-peace-news-and-paedophiles/

2 female authors/contributors to PIE’s Warren Middleton’s B.O.Y were also involved with Peace News like Roger Moody

(Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from  Peace News.)

Peace/anti-nuclear campaigners heavily targeted by state surveillance since pre1970s to current day:

So how with all the surveillance were the paedophiles for peace lobbyists missed?

 

Or were they a useful control/eye on non-paedophile peace campaigners?

Were paedophiles used as informants on anti-nuclear protestors?

Perusing Peace News from 1975+ I was glad to find ONE letter to Editor saying what I was thinking….

paraphrased: “What’s with Peace News new preoccupation with paedophile rights? What’s it got to do with anti-nuclear/peace activism?”

Writer of letter was an extremely disappointed long-term subscriber who just couldn’t fathom what had changed for Peace News


Government lawyers…in a vain attempt to keep a lid on Peter Wright’s revelations, seem to be turning a blind eye toward Peace News – the paper published passages from Spycatcher.

The Guardian London, Greater London, England Wednesday,  September 2, 1987 – 36


November 29th 2006 Maidenhead council paid out £300,000 + five years legal costs to nine men who were raped as children whilst in the care of the council at the Greenfield House care home Maidenhead  Berkshire. The council immediately sued one of the men they had paid compensation claims on behalf of, for raping children in their care.

This man immediately settled out of court with a payment in excess of £1,000,000.00. Amazingly the council agreed to a gagging order, so the name of the man and the amount the man had paid the council would remain a secret. Furthermore in this corrupt deal, if the council paid out more compensation claims to anymore of this mans rape victims, the council would not pursue the unnamed man for any further financial contributions.

Due to the councils corrupt immoral dealing with this matter, this secret paedophile deal, would now forever pervert any future criminal investigation and prosecution, involving the unnamed rapist. By 2010 Maidenhead council had compensated 21 abuse victims 12 of the 21 had been compensated for being raped by the unnamed man.

In 2013 under the freedom of information act, I received the following information from David Davies representing Maidenhead Council. The total amount the council paid out was £569,750 compensation and £732,500 legal costs. (to view this document just scroll down) If the council received a payment of more than £1,302,250.00 from the unnamed man, which I very strongly suspect they did, the council have actually profited from the children in their care being raped, and abused by this unnamed man in the gagging order.

In February 2014 Christabel Shawcroft the MD of Maidenhead council in an email to Mike Thornton MP, incredibly broke the gagging order and named the unnamed man as Mr Gilbart-Smith. (to view this document just scroll down)

In May 2014 Theresa May Home Secretary addressed parliament regarding the governments position on paedophiles.

Since Mrs Mays 2014 speech, I have written to Mrs May the Maidenhead MP on numerous occasions, concerning this corrupt paedophile payment with the council in her constituency, and I have never received a reply from the Maidenhead MP.

Another of Gilbart-Smiths rape victims visited Mrs May’s Maidenhead surgery concerning this matter, and the matter was totally ignored as can be seen in Mrs May letter (to view this letter just scroll down) The MP’s of five of Gilbart-Smiths rape victims namely; Mike Thornton, Mimms Davies, Norman Baker, Nick de Bois, and John Redwood have also written to Mrs May as the Home secretary concerning this secret paedophile hush payment. However, none of the MP’s received a reply either.

The only reply I have had was from Sarah Newton at the Home Office when Mrs May became PM. Unbelievably Miss Newton advised me to complain to Maidenhead Council about the paedophile payment. (to view this letter just scroll down)

In light of Mrs Mays 2004 speech I now am seeking help from a professional to ask these three questions and get three answers from Mrs May;

Mrs May,

  1. “Is it proper for the council in your constituency to enter into a SECRET million pound plus agreement, and also agree a gagging order, with Denham Gilbart-Smith, the same man the council were suing, for raping numerous children in their care?”
  2. “Did Maidenhead council receive from Denham Gilbart-Smith more than the £1,302,250.00 they paid out in compensation and legal costs?”
  3. “If the council did receive more than the £1,302,250.00 from Denham Gilbart-Smith, is it proper for the council to profit from children in their care being raped, especially as the payment was received from the same man they were suing for raping the kids?

Below is an overview of this massive

story of blackmail corruption and three murders!

©2019 John Affleck is legally responsible for all content on this website. 

1964 – 1970 numerous children were raped and abused at Greenfield House children’s home in Ray Park Road Maidenhead Berkshire, by Donald Prescott the warden of the children’s home, and numerous other men invited to the home by Prescott.

1966 Prescott a career paedophile, met 19/20 year old Denham Gilbart-Smith at St Marys Church Maidenhead. Gilbart-Smiths wealthy parents Oliver & Doris Gilbart-Smith had recently introduced Billy Graham an American evangelist to the Uk. It was rumoured that Doris Gilbart-Smith had paid or contributed a large amount of cash for the rent of the Royal Victoria & Albert Hall in London, for some of Mr Graham’s meetings.

1967 Prescott convinced young Gilbart-Smith to register with the council as an “unpaid helper”. Wealthy Gilbart-Smith, was now forever officially connected to this nest of paedophiles within the council’s records.

1967 Tony Knott a Reading photographer photographed Willy Walters (GFH resident) raping *Eddy Allen (GFH resident). Knott also photographed Ted Burkett a paedophile friend of Prescott’s and regular visitor to Greenfield House with different boys. Knott photographed JD with MS, MM with EA, and other Greenfield House kids, being raped and abused by each other, but the identity of the adult abusers were always hidden in the photos.

*Eddy Allen committed suicide age 23.

Tony Knott  66 and boyfriends, Florida Court Bath Road Reading RG1 6NG

1967 In May 1967 Gilbart-Smith got a green MG reg KMO 124B for his 21st  birthday. Gilbart-Smith gave 17 year old Willy Walters his bubble car reg WLH 858. Walters had officially left the children’s home, but under Prescott’s control Walters stayed on and would rape and abuse the younger boys, with Gilbart-Smith and other men.

1967 Prescott groomed Gilbart-Smith with the anonymous photos and Gilbart-Smith was subsequently photographed by Tony Knott. However, in this photo set, Gilbart-Smith was fully identified sexually abusing a young boy RA, the blackmail plot was now on. Police became aware of some indecent photos and in the August of 1967, Tony Knott was arrested.

1968 Tony Knott was sent to prison for eighteen months in March 1968, for taking indecent photos of young boys at his studio 30 Minster Street Reading RG1 2JF, but the blackmail plot and the connection to Greenfield House remained undiscovered.

1970 Prescott left Greenfield House in the December of 1970 when the police began an investigation into the paedophile ring. Burkett a baggage handler at Heathrow for B.O.A.C. fled to Australia to escape the criminal investigation. Prescott confronted Gilbart-Smith senior with the photo’s saying; “If I go down I am taking your son with me!” Gilbart-Smith senior paid Prescott a large amount of cash, part of which Prescott used to bribe DC Carstairs a detective from Bracknell police station who was leading the investigation.

1971 After receiving the cash Detective Carstairs interviewed numerous boys. Carstairs’ tactic to close down the investigation was to completely overpower and intimidate the boys. One such interview with sixteen-year-old MM who had been abused for the previous five years went like this: “Are you telling me he put his cock up your arse? You expect me to believe that?” The detective concluded the interview by stating: “That’s fucking disgusting, nobody will ever believe that! Are you some sort of fucking poofter?” After this series of interviews the police investigation was wound down and eventually closed.

1970 – 1986 by 1986 Gilbart-Smith had been blackmailed for sixteen years by Prescott. When Gilbart-Smith became a Lloyd’s name, knowing the blackmail would never end he ordered a hit on Prescott. (Read the book) Upon Prescott’s demise, Burkett who had previously returned from Australia, visited Walters parents to be told that Willy was in Wandsworth prison. Burkett visited Walters in jail and when Willy was released the pair retrieved a set of the Gilbart-Smith photos from the attic of Burkett’s sisters bungalow in Virginia Waters Surrey, Burkett and Walters together blackmailed Gilbart-Smith.

With the first blackmail payment, Burkett paid cash for a substantial town house property in the King Charles area of Kingston, KT5. Gilbart-Smith put a hit on Burkett (Read the book) after Burketts demise Gilbart-Smith paid off Willy Walters. Walters an ex Greenfield House abuse victim, had played a minor role in the blackmail plot as Burkett’s errand boy.

1986 Around 1986 Walters who was 25/26 still lived in a council flat with his wife and two children. Walters had spent all of his adult life in and out of prison. However, with Gilbart-Smiths help, Walters managed to purchase 16 Clive Road Colliers Wood London (£585,592 current zoopla valuation) Walters also purchased each of his two sisters council properties in Howletts Close Eastbourne, with the government right to buy scheme. Walters also purchased a caravan that he used for family holidays and rental income. Walters also set up a scaffolding business with Gilbart-Smiths help.

1987 & 1989 For the first time in his adult life Gilbart-Smith was free from blackmailers. Then in the 1987 and 1989 stock market crashes, Gilbart-Smith was wiped out as a Lloyds name and set up IMS, Insurance Market Services. IMS insured individuals and organisations against kidnapping, acts of terrorism, industrial espionage and such like.

1990’s Gilbart-Smith was expelled from his position of elder and senior Bible teacher alongside his good friend Alistair Bullen at the River Church Maidenhead, for inappropriate sexual conduct with members of the congregation, including a five year extra marital affair with Julie B. After being disgraced, Gilbart-Smith travelled to to Africa, Portugal and Jamaica with his very close friend Peter Butt, where Gilbart-Smith taught the Bible to disadvantaged people who had problems with their home life.

Peter Butt http://www.SchoolofMinistries.org        Alistair Bullen http://www.RiverChurch.org.uk

2000 Gilbart-Smith was arrested and charged with two rapes but the charges were later dropped due to insufficient evidence. The two complainants JD and MM were advised to seek compensation from the owners of the care home Maidenhead Council, through the civil court. The two men instructed a solicitor named Alan Collins to pursue a civil claim on their behalf.

2006 November 29th Alan Collins reached an out of court settlement with Maidenhead Council and or the councils insurers for £300,000 compensation (plus five years legal costs) for nine claimants. At least four of the nine abuse victims were compensated by Maidenhead Council for being  raped by Denham Gilbart-Smith, the man unnamed  in the BBC article below.

http://news.bbc.co.uk/1/hi/england/berkshire/6195572.stm

2006 immediately after the compensation pay outs, RBWM or MMi the RBWM insurers sued Denham Gilbart-Smith to recover their loss.

2007 in the spring of 2007 Gilbart-Smith made a seven figure payment to RBWM MMi to keep his paedophile activities a secret. Included in this out of court settlement;

  1. RBWM/MMi agreed to keep the name Gilbart-Smith a secret.
  2. RBWM/MMi further agreed to keep the amount of money Gilbart-Smith paid a secret.
  3. RBWM/MMi further agreed to exclude Gilbart-Smith from being pursued financially, if RBWM/MMi paid compensation to any more of Gilbart-Smiths rape victims.

2007 early in 2007 totally unaware of this court case and compensation payout, I was asked by the publisher Verite to consider writing my autobiography. In consideration of this request, I googled all the names of my known childhood abusers. After finding a photo of Denham Gilbart-Smith on his company website, I contacted Child Abuse Lawyers and chose to contact Alan Collins from a list of solicitors Child Abuse Lawyers emailed me. I chose Alan Collins solely because he was geographically the closest, being only an eighteen minute drive from my home. I was very surprised to find out that Mr Collins had recently closed a case for nine other kids that went to Green Field House.

2007 on the 27th March 2007 Alan Collins submitted the below letter to RBWM.

2008 Verite published my book and I sent a copy to Windsor police.

RBWM denied all responsibility for my claim for the next eighteen months. The reason Alan Collins (solicitor) advised me was, RBWM were waiting for a ruling on a case the law lords were making, where Shirley Woodman was attempting to sue the the rapist Iorworth Hoare, who had won £7 million on the lottery whilst on day release from prison. Apparently until that ruling was made, RBWM would not accept any responsibility. What the lotto rapist had to do with me being abused in a Maidenhead childrens home I really have no idea, especially as RBWM had already in a secret deal been pre-paid by Gilbart-Smith for having raped me.

On 22nd September 2008 RBWM agreed to pay me £50,000 compensation for being raped by Denham Gilbart-Smith and others. Had I known RBWM had been paid upfront by Gilbart-Smith for raping me when I was a ten year old kid, I would never have settled the claim. I would have probably considered a private prosecution against Gilbart-Smith.

There is a very strong possibility that RBWM received more money from Gilbart-Smith than they actually paid out in rape claims. If that is the case then RBWM MMi have actually made money from children in their care being abused and raped by Gilbart-Smith and others.

2008 after a twelve month police investigation, Gilbart-Smith was eventually charged with seventeen counts of rape and child abuse, thirteen of which can be seen in the below charge sheet.

2010 by 2010 RBWM/MMi had paid compensation to 21 abuse victims, between 10 -13 of these claimants, had been compensated by RBWM/MMi for being raped or sexually abused by Gilbart-Smith.

The six week trial started on Monday 17th May at Reading Crown court case number T20097272.

For some reason not yet understood Tony Knott the photographer, was not involved in the police investigation or the six week trial. As a result of the secret contract RBWM MMi had entered into with Gilbart-Smith, at the 2010 trial, this out of court settlement had to be kept a secret from the jury, so the jury had ZERO chance of being told the truth from the outset.

On Wednesday 19th and Thursday 20th May 2010, Willy Walters gave evidence that he was raped and abused at Greenfield house. Walters also told the court that he would rape and abuse the younger boys as Prescott commanded. Walters then committed perjury by saying he had little to do with the posh man. (meaning Gilbart-Smith).

The following morning Friday 21st May, as Gilbart-Smith sat in the dock at Reading Crown Court, Walters was murdered! Walters died in the exact same way as Gilbart-Smiths two other blackmailers. All three blackmailers felt well enough to get out of bed to go about their daily business, all three blackmailers had a heart attack in a public place, all three blackmailers died of the heart attack immediately before reaching hospital.

With Walters now dead, Gilbart-Smiths defence challenged one of his rape victim stating that; he was confused and mistaken, as it was not Gilbart-Smith that had driven him in his green MG to the Tudor House on Wandsworth Common London, to be raped  by a group of men at a bonfire party, as the witness told the court, but rather it was Willy Walters that had driven him in the bubble car from Maidenhead to South London to be raped by this group of men. (The bubble car only had one seat) To use this ridiculous defence strategy Gilbart-Smith 100% knew Walters was dead!

If Walters was still alive he would have been EXTREMELY angry and 100% would of told the truth about what really happened concerning the police corruption and the blackmail payments etc. Walters would have 100% blown Gilbart-Smith right out of the universe with the truth of what really happened.

Nine men who live in different parts of the country and hadn’t seen each other for forty years gave compelling evidence of how they were raped and abused by Gilbart-Smith.

  • Gilbart-Smith agreed with the council’s records that he was an unpaid helper at the children’s home
  • Gilbart-Smith agreed with the prosecution that all of the other men that visited Greenfield House were paedophiles.
  • Gilbart-Smith further agreed that he went on holiday with the paedophiles and the boys to London, Kent, Sussex and Cornwall.
  • Gilbart-Smith agreed that he now understands the boys were raped in these locations, but at the time he didn’t know that his friends were paedophiles, he didn’t know that the boys were being raped and he didn’t rape any of the boys.
  • Gilbart-Smith’s only defence other than character witnesses was his personal denial which was nonsense being peppered with ridiculous lies, which can be read in the court transcripts or seen in the below video.

Based on Judge Johns instructions, the jury had to reach a verdict based on who was telling the truth, the nine men or Denham Gilbart-Smith. Below is a seventeen minute factual overview of the six week trial and its conclusion. To make complete sense of this story, watch the video before continuing.

I was totally disgusted with the trial outcome and was sent to prison for twelve months for contempt of court. I was ecstatic and feeling very pleased with myself as I got Gilbart-Smiths mugshot on the six o’clock & ten o’clock news, and in every single UK newspaper.

Before the trial in 2010 Gilbart-Smith sold his insurance business IMS, after the trial Mr & Mrs Gilbart-Smith became residents and deserted their children and grandchildren fleeing to Northern Cyprus, a Muslim country that is residency to numerous UK criminals, as Northern Cyprus have no extradition treaty with the UK. Mr & Mrs Gilbart-Smith also travel to other countries that don’t have an extradition treaty with the UK such as Vietnam.

http://www.visaforvietnam.org/Vietnam-visa-for-tourist-purpose.html

2013 in November 2013 under the F.O.I. (Freedom of  information act)  David Davies of RBWM publicly admits to entering into a gagging order made with an unnamed man who was named as an abuser. Compensation claims totalled £569,750, whilst legal costs were £732,500.

The cheque Gilbart-Smith paid RBWM MMi was seven figures. There is a strong possibility that RBWM received more money from Gilbart-Smith, than the £1,302,250 they eventually paid out in compensation and legal costs. If that is the case as I suspect it may well be, RBWM technically are paedophile pimps, as they would be guilty of making a profit from children being raped by Denham Gilbart-Smith.

2014 on 21st March 2014 DB visited his Maidenhead MP’s surgery and asked Theresa May what her policy would be, concerning the secret £1m paedophile hush payment made to RBWM with a gagging order to protect the man accused of raping a dozen or so young children. Mrs May avoided giving an answer which can clearly be seen in the below letter.

NOTE: This letter was written a few months before Mrs Mays now famous 2014 parliament speech on child abuse. Notice how in direct contradiction to Mrs May’s speech, she swerves answering DB’s concerns;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

As Home secretary and after Mrs May’s famous 2014 speech, Mrs May has been asked the same question by Mike Thornton MP (09/01/15), Mimms, Davies MP (02/03/16), Norman Baker MP (03/03/15), Nick de Bois MP (2015), and John Redwood MP (10/03/15). The MP’s letters and dates can be seen in the journalist pack. Mrs May never answered any of the above MP’s.

2015 Mike Thornton MP received the below email from Christabel Shawcross MD of the RBWM council. Christabel Shawcroft amazingly breaches RBWM’s secret million pound contract by naming Gilbart-Smith as the man RBWM was accusing of raping numerous children in their care. Shawcroft then tells us that after RBWM MMi had compensated numerous rape victims of Gilbart-Smith, Gilbart-Smith reimbursed these costs to RBWM MMi.

I can tell you with 100% confidence, the payment made by Gilbart-Smith was seven figures. I wonder if Gilbart-Smith will sue RBWM for the return of his million pound paedophile payment, as RBWM are now clearly in breach of the legal terms of their 2008 paedophile deal.

As well as breaking the secret agreement, Christabel makes some very naive statements in light of the Home secretaries 2014 speech concerning paedophiles.

As a direct result of RBWM and MMi the insurers of BCC entering into a secret agreement with Gilbart-Smith RBWM MMi;

  1. Perverted any future criminal investigation as the police were no longer allowed to use the information contained in this now secret agreement.
  2. Perverted the course of justice as in any future court case this massive paedophile payment has to be kept a secret, so the facts can no longer be used as evidence.
  3. At the 2010 trial each prosecution witness was asked if they were aware that Gilbart-Smith had settled a claim out of court with RBWM. Each witness was warned by John Price Q.C. that if they mentioned this to the jury the case would be thrown out of court.

CHRISTABEL SHAWCROFT QUOTE: “At the time of the compensation claims Mr Gilbart-Smith was not subject to any criminal prosecution”.

MY RESPONSE: Exactly Miss Shawcroft! This is precisely why RBWM MMi should have given their files to the police to assist a criminal investigation instead entering into a SECRET agreement and hindering any future police investigation…..

You really couldn’t make this stuff up, it’s taken five years for the Home Office to advise me to complain to the council for receiving a £1M hush money payment from a man they are suing for being an active paedophile in one of the council run homes. Dear Mrs Newton, Should I also complain to Mr Gilbart-Smith for raping me when I was a ten year old kid?

Mrs May, recently with the Brexit negotiations, you have had a lot of practice making deals! As the MP for Maidenhead, in the light of your 2014 speech, can you please let me understand your policy regarding the secret £1m paedophile payment, made between Denham Gilbart-Smith & Maidenhead Council.

In the anticipation of your very late response,

THANK YOU

 

more here:

http://thenobbler.com/


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.

Advertisements

PIE list had been all but ignored until recent paedophile allegations surfaced.

Detectives knew of 300 names in a secret club that advocated sex with children

Police kept the secret membership list of a controversial group which advocated sex with children  and let it “sit in a drawer”, leaving several of those named on it free to commit serious child abuse.

http://www.independent.co.uk/news/uk/crime/paedophile-register-of-controversial-group-ignored-by-police-allowing-several-members-to-commit-a6941526.html

Truthseeker1 ‏@thewakeupcall09

So many cases where police have obtained membership lists and done nothing.

Why police not questioning the PIE members that are currently in prison?

 

 

Anyone who is connected to PIE & any other organisation should be held to account.They wouldn’t be accepted as a volunteer 4 an organisation

Where’s the inquiry strand looking into Peter Righton?

He was advising the inquiry’s founding dept Home Office during 70s 80s until 1992

Cop Saw Documents In 1990s Suggesting Existence Of Establishment Paedophile Network

 

Cop Saw Documents In 1990s Suggesting Existence Of Establishment Paedophile Network

 

Steering Committee – Peter Righton, G. Godfrey Issacs, Miss Mary Joynson (Director of Child Care of Dr Barnado’s), Miss Janet Matlinson (Tavistock Centre), John Rea Price (Director of Social Services for the London borough of Islington. Nicolas Stacey (Director of Social Services Kent)

The Guardian

London, Greater London, England

Wednesday, March 28, 1979 – 13
Thornham Estate – Righton’s Sanctuary
henniker-thornham-ad

The Guardian

London, Greater London, England

Wednesday, May 8, 1985 – 27
righton-thornham-manor

The Ancestral Home Of The 8th Baron Henniker In Thornham Magna Suffolk.

Peter Righton Who Is At The Centre Of An Inquiry Into The Abuse Of Boys Is Living In A Stable Block On The Estate.

6 May 1993
Freemasons /Senior Police Officers in Islington 1988 by David Rose
Despite being billed as a philanthropic venture by Lord Henniker, Islington Council was picking up the tab to send selected Islington children from schools, day centres and play schemes to spend 4 day weekends camping at the Project’s Thornham Magna campsite.
Islington Gazette, March 1988
IMG_7445

 Image result for john whittingdale and napier

John Whittingdale, half-brother of convicted PIE secretary Charles Napier, was SPAD to Leon Brittan who was close friend of (PIE member) Keith Harding. Coincidence?

Dame Alun Roberts ‏@ciabaudo

Image result for "david napley" + "harvey proctor"

Image result for "leon brittan" + "whittingdale"

I also worked for Leon Brittan, the man who went to visit PIE member Keith Harding with Cyril Smith and Jeremy Thorpe

Image result for leon brittan and keith harding

Keith Harding appears to be the link between that paedophile Home Secretary Leon Brittan and PIE.

Image result for leon brittan and keith hardingImage result for leon brittan and keith harding

Is it just a coincidence that the Freedom Association, GCHQ and Brittan mate Keith Harding of PIE were all based in Cheltenham?

Northleach = Peter Ball = Keith Harding = Rev David Jennings (lifelong Peter Ball friend) = BigEars Coincidence?

Keith Harding, Bugger Brittan’s chum, was once a Dominican monk

This obit links Keith Harding to just about everything: Railways, CoE, RAF pilot,…

Related image

Top Freemason at GCHQ’s Cheltenham Masonic Lodge

Image result for harding Northleach Museum

A top Freemason, well protected, his Northleach Museum was in old urban Council offices


 

 

Did BHH ask Ms Brittan why her paedophile husband regularly visited Keith Harding, PIE membership secretary, while being asked to ban PIE?

harding-biggest-ring

IslingtonSurvivorsNetwork ‏ @theIslingtonSN

28 May 1977: PIE held its third AGM at 274 Upper Street N1 at London Friend islington – Peter Righton resigns as “Community Liaison Officer” – Tom O’Carroll takes over as Chair – Social Worker Jonathan Simon new organiser local groups PIE Central

‘Stop Press – Stop Press’, p. 12
AGM took place at Islington HQ of London Friend on May 28th.
Resignations from EC: Hose (as Chairperson) and Peter Righton (as Community Liaison Officer).
Full national EC election results: ex teacher/journalist Mr Tom O’Carroll, new Chairperson
Former lecturer/assistant JP Mr David C Grove new Secretary
Ex-teacher Mr Charles S. Napier, Treasurer (returned)
Social Worker Mr Jonathan Simon, new Organiser Local Groups
Private Businessman Mr Warren Middleton (p), Magazine Editor (returned)
Teacher Mr David Brownough (p), new Newsletter Editor
University lecturer/sociologist Dr. Humphrey Barton* (p), new Research Director (*subject to confirmation)

link


Image result for leon brittan and keith harding

Remember the Jim’ll Fixit episode featuring Keith Harding? Guess who did the sinister film work outside the shop and shop window!

david-secrett-keith-harding

It was David Secrett, a trusted employee at Keith Harding’s shop.

Have a guess where Secrett lived and worked in the 90s!

Thornham Magna.

david-secrett-thornham-magna

David Secrett – Clocks and Automata – Eye Suffolk

Peter Righton PIE Member #51, Keith Harding PIE Member #329

Image result for peter righton and charles napier

Righton and Napier

After Righton’s 1992 conviction on child pornography, he moved to live in a cottage on the estate of the eighth Lord Henniker, in Thornham Magna, North Suffolk, and was allowed to use the estate for special holidays for vulnerable children from Islington (at the very time when there was an epidemic of child abuse in Islington care homes – see here and here for vital material

The Chief Constable of Suffolk visited Henniker personally to warn him that Righton was a career paedophile, but he ignored this advice, and Righton was able to continue hosting children on the estate until his death in 2008.

link

link

napier-righton-2 napier-righton-1

Through PIE (Righton) made contact with the campaign’s treasurer, Charles Napier, a teacher who had banned from working in all English schools after he was convicted of indecent assault on five infants.

(Charles Napier, half-brother to MP John Whittingdale)

napier-righton-2

 

The Guardian

London, Greater London, England

Wednesday, August 28, 1996 – 27

Lord Henniker offered Peter Righton and Richard Alston refuge there when they fled Evesham in 1992. He employed Napier..

in senior positions teaching abroad with British Council and ran Islington‘s Suffolk children’s scheme.


Peter Righton was questioned about child sex offences in November 1994

A recently discovered press cutting shows that Peter Righton was questioned about indecent assaults on children by the Obscene Publications Squad in November 1994 – several months after the Hereford & Worcester investigation had been shut down, and after the BBC documentary Secret Life of a Paedophile had been broadcast. It can be assumed by the absence of any further news reports that he was never charged with an offence, despite clear evidence from his diaries including names and ages of victims, along with the name of the institution where he abused them. The November 1994 arrest took place in Eye, Suffolk – presumably at Lord Henniker’s estate, where he had been living since his 1992 arrest.

Henniker was needing cash for his stately pile upkeep – quite a business he had going – somehow the cash kept flowing in…………….

No wonder he considered Righton a good tenant?

From what I have been hearing, it is virtually proven that Harding liked to take boys to Amsterdam.


Image result for prince philip and henniker

Lord Henniker of Thornham Magna – was a close friend of the royal family

Image result for prince philip suffolk

 Prince Philip is godfather to his son.

 


philip-godfather-henniker
Image result for lord henniker and prince philip

Lord Henniker – close friend of the royal family

link

 

BBC News – How did the pro-paedophile group PIE exist openly for 10 years?

2014

The government gave them £500,000 maybe that’s reason enough plus a lot of them were PIE members.

 

Is that with or w/o the free Home Office funded office at Elgin avenue?

 

link


 

 

Image result for savile and prince philip

as was paedophile Sir Jimmy Savile

I think I am probably one of the last surviving members of the old Thursday Club, the gang of cronies that the Duke of Edinburgh used to gather round him in the 1950s to have a bit of fun away from his serious life at Buckingham Palace.

On an average night of the Thursday Club there would be 10 or 15 members present. There would be Lord Louis Mountbatten, Arthur Koestler, Prince Philip, Cecil Beaton, and little Larry Adler playing his mouth organ in the corner, and maybe one or other of the Kray brothers.

link

According to the Mirror:

SECRET files about Prince Philip’s private life are to remain locked behind closed doors for 100 years.

Most confidential Cabinet documents relating to relating to the royals and government are covered by the “30-year rule”.

But at least 27 royal files in the vaults of the Public Records Office at Kew, West London and many of , are considered so delicate they are labelled: “Closed for 100 years“.

More than 10 concern astonishing MI5 and Scotland Yard reports on the Duke Of Edinburgh’s private life.

As an explosive new biography of the Queen hints that the Greek-born Prince was unfaithful to the Queen, we can reveal that Buckingham Palace courtiers and security chiefs were once so concerned about Philip’s non- royal activities that they ordered round-the-clock surveillance.

They feared the Royal Family would be compromised and that there would be a constitutional crisis if news leaked out of how the Prince was behaving.

He was known to be “letting his hair down” with celebrities of the day at weekly meetings of the Thursday Club above exclusive Wheeler’s Restaurant in Soho.

One senior detective, now retired, who was attached to the Prince’s protection team, said: “It’s true we had to report back on where we had been and who had been present.”

But he refused to discuss the Prince’s private visits.It is not known what details of Prince Philip’s private life were made known to the Queen or the Privy Council. But it will not be until the years 2052 to 2060 that they will be released – if then.”

link

https://youtu.be/BM_RlWkE52w

Henniker ran the Islington /Suffolk Project – a scheme for disadvantaged children from Islington to have country holidays in rural Suffolk.

Charles Napier joined the British Council after his 1972 conviction.

Henniker was also Director of the British Council (1968-72).

The Observer
(London, Greater London, England)
05 Mar 1972, Sun  • Page 40

Henniker has links to MI6 and the Royal family.

Lord Henniker, who gave refuge to Peter Righton was at Stowe School, Rifle Corps and Foreign Office with paedophile Peter

Image result for peter hayman and rosemary blo

via walkerdine:

HAYMAN ARRESTED IN 1984

The Guardian
(London, Greater London, England)
17 May 1984, Thu  • Page 4

 

‘Official’ papers may not tell whole story of historical paedophilia scandal

The discovery and release of government papers detailing the investigation into the alleged ‘unnatural’ sexual conduct of diplomat Sir Peter Hayman generated substantial press coverage. Unreported, however, were alternative contemporary accounts offering a different story of the legal proceedings brought against members of the Paedophile Information Exchange (PIE) in the early 1980s.

The official National Archives documents confirmed what we already knew about Hayman. A retired diplomat and former High Commissioner in Canada, he was exposed in Private Eye in 1980, named by the MP Geoffrey Dickens under parliamentary privilege in 1981, and scrutinised in the press, where he was linked to PIE.

It is not surprising to learn that reports on Hayman crossed Margaret Thatcher’s desk and that a press ‘line’ was agreed. The authorities’ main concern seems to have been the possible national security implications of Hayman’s indiscretions, demonstrative of long-standing Cold War anxieties about the subversive potential of sexual blackmail.

While the National Archives files – known as PREM 19/588 – suggest there was no official protection of Hayman, that he was not immune from prosecution, and that there was no evidence linking him to specific crimes, a different story exists in alternative archival sources. In particular, the National Council for Civil Liberties (NCCL) Gay Rights Sub-Committee documented events differently.

As with many organisations from the ‘gay left’, this sub-committee was concerned about the potential implications of the PIE prosecutions on the future policing of ‘non-normative’ sexual behaviour, including homosexuality. Civil libertarians more generally were anxious about the vagueness of conspiracy charges in general. The sub-committee was also close to the defence team, and its Gay Rights Officer, Barry Prothero, attended committal proceedings outlining the evidence gathered in relation to PIE.

In November 1980, Prothero corresponded with campaigners in Canada about the case. He wrote: ‘The DPP [Director of Public Prosecutions] seems to be negotiating to drop the conspiracy charges [because] there is another man who may have been charged and who was not because of his connections and blowing the cover-up is likely to be worse for the DPP than proceeding with the prosecutions.’

Prothero noted that ‘although assisting in a “cover-up” may be distasteful, not only the defendants but the entire gay movement in this country would be delighted if this one succeeded in order to keep the case out of court.’

A second letter was more specific. Prothero wrote that the DPP used only a ‘tiny fraction of the evidence presented at the committal proceedings’ and called just four of the 13 witnesses present at the earlier hearing: ‘Of the hundred-odd boxes of material that were used at the committal, only five magazines and a handful of letters were used at the trials.’

Accordingly, Prothero observed that it was ‘clear that most of the evidence that was not used was dropped because Hayman, the erstwhile HC [High Commissioner] to Canada, was the central figure in its production. The defence barristers tell me that he began the “round Robin”, as the letter writing circle is called, which generated most of the material upon which the committal was based.’

While the Gay Rights Sub-Committee’s interest in PIE was problematic, it did mean that it was well-informed about the case. Its documents suggest that questions must still be asked about these competing accounts, as well as the evidence disregarded by the DPP and how decisions were made at that level.

The contents of these documents also show some difficulties in searching for accounts of historical sex offences. Official archives are often limited and partial; there are constraints on the past that they capture. The processes permitting the assembly and compilation of material influence what has been included, excluded and catalogued.

More will be revealed if additional files can be found and those which are under closure orders are opened. Now that the official inquiry into historic child sex offences is mobilising, it is important that official reports and documents are properly investigated. It is equally vital, however, that evidence produced outside of the state and, perhaps most importantly, the testimonies of survivors, are properly and sensitively gathered and evaluated. Consideration of the abused is absent from PREM 19/588.

If the files fail to show the ‘establishment’ cover-up that NCCL members felt occurred, they are still demonstrative of an official attitude favouring protection over investigation; shutting down inquiries rather than opening them up. It remains unclear if that attitude has entirely changed.

A version of this article first appeared on the University of Birmingham’s Modern British Studies: Birmingham blog.

Dr Christopher Moores

http://www.birmingham.ac.uk/news/thebirminghambrief/items/2015/02/official-papers-may-not-tell-whole-story-of-historic-paedophilia-scandal-19-02-15.aspx

Roy Jenkins & Co

…there was a major effort, near the Labour to push a multi-channel (academic / political / media) pedo agenda slipstreamed in as part of the nascent gay rights movement.

Nice summation. And it appears to be sourced in Fabian (Havelock Ellis, Edward Carpenter, Wilfred Trotter/Bion, Norman Glaister) ideas about socio-spiritual engineering via sexual interference/”liberation” – currently being promoted as “the evolutionary power of trauma” by LSE-grad Whitley Strieber and Esalenite Jeffrey Kripal, among others.

rigorousintuition.ca/board2/viewtopic.php?p=541102


Alderman Robin Goodman

The Mayor of Islington hanging out at Harding Antiques 1971

robin-goodman-and-arsenal-manager-bertie-mae-1971

Arsenal manager Bertie Mee (1918 – 2001) with the borough mayor Robin Goodman and a mace bearer at a celebration of Arsenal’s FA Cup victory.

link

Intriguing FOI request regarding Dolphin Square, hospitals, Islington, Henniker estate, Nick, suspicious deaths etc.

Richard Card 6 January 2017

Dear Metropolitan Police Service (MPS),

I am referring to the Dolphin Square Inquiry made re child abuse complaints by “Nick”. And whether historical inquiry explored the implications of Sir John’s death 1991 concerning his casework that was cut short.

Without knowing what further correspondence took place between attorney general and police minister and Sir John I can only say that it was inevitable his casework would have led to questions about the six years of disabled child deaths 1966 to 1972 in Islington and Hackney care at The Beeches Ixworth. A village close to the Henniker Estate later home to Peter Righton and allegedly abusive Islington Suffolk project.

Yours faithfully,

Richard Card

Metropolitan Police Service (MPS) 18 January 2017

Dear Mr Card

Freedom of Information Request Reference No:2017010000144

I respond in connection with your request for information which was
received by Metropolitan Police Service (MPS) on 01/01/2017.

DECISION

I have decided that, in accordance with Section 8 of the Freedom of
Information Act 2000 (the Act), your enquiry is not considered a valid
request.

Dear British Broadcasting Corporation,

Would you disclose how far advanced the BBC is in providing the Panorama broadcast, the research and the follow up deliberations to the CSA Inquiry please ?

The programme featured Edwin BAARS a mental patient discharged homeless to Margate. In time he ended up in one of the resort’s many “Section 37” Homes. Former boarding houses registered as care homes (not nursing homes and hence no requirement to employ qualified nurses)

At the time Barbara Castle MP was DHSS minister with special advisor barrister jack STRAW. And a question arises about two dogs that neither barked nor bit. BBC and MIND where Peter RIGHTON was an executive I think.

The most recent Commons question then re Section 37 homes avoiding qualified staff expense was 1972 by Barbara Castle MP about Sue Ryder HQ Cavendish. Sir Keith Joseph refused care inquiry. He also refused inquiry into six years of child deaths of disabled children in social services London care at the Beeches Ixworth Suffolk a village adjoining the now notorious Henniker estate (abusive Islington Suffolk Project)

For public record I should also point out that Sue Ryder’s husbands charity had been subject of Dept of Health commissioned group psychiatric research by Tavistock Institute. Possibly as a consequence the Leonard Cheshire inmates of Le Court Cheshire home had revolted in 1972 after Sir Keith Joseph’s refusals I think of care inquiries at the Sue Ryder HQ of the charity. This led to the creation of disabled persons human rights movement. In fact Dr Laurence Clarke years later wrote a study of Leonard Cheshire versus the Disabled Persons Rights Movement.

By 1975 I would have thought the inmate revolt was sufficiently well known that Barbara Castle would have raised the care inquiries Labour MPs had called for only 3 years earlier. The European Convention of Human Rights provisions re inmates of Leonard Cheshire Homes being subjected to Tavistock Institute research commissioned by govt. The attorney general says the legal advice situation is still secret.

Dame Janet Smith conducting your Savile review at BBC ruled both the Sue Ryder deaths cases 1972 (and a related Regional Crime Squad inquiry into GP death registration malpractice) and the 6 years of questions about death certifuications at Beeches Ixworth as beyond her terms of reference SHIPMAN Inquiry. To examine and make recommendations to improve death registration practices.

Clearly now we can see that at the time, of the two dogs BBC and MIND that neither barked nor bit thus rather letting Mrs Castle off the hook, 1975/76 SAVILE was getting away with abuse at Sue Ryder Child Hospice Leeds.

It was always open to Mrs Castle to order care inquiry re Sue Ryder and the Beeches. But she did not. Even when one of the MPs calling for inquiry was Islington’s Michael O’Halloran. Islington where STRAW was a Labour Cllr with Mrs Hodge and PIE set up its HQ.

I think you should fwd this FOI to Dame Janet Smith as she may care to make a submission to the CSA Inquiry explaining how she was not in fact compromised to conduct Savile Inquiry at BBC.

Yours faithfully,

Richard Card

link

The Queen meeting Grp Capt Leonard Cheshire during a visit to the Sue Ryder Foundation in Cavendish. Picture: ANDY ABBOTT

The Queen meeting Grp Capt Leonard Cheshire during a visit to the Sue Ryder Foundation in Cavendish.


Peter Campbell was a director of Jim’ll Fix It and directed the episode in which Keith Harding appeared in 1980.

He had the freedom of the City of London (as did Harding). Campbell died in 1985 at 42 after drinking heavily and a heart attack.

Image result for peter campbell jim'll fix it

Dame Janet Smith BBC report:  It was much more likely that the episode was set up by Peter Campbell as a means of giving some publicity to Mr Harding.

harding-janet-smith-report

Jimmy’s Special Award at the RAF Piccadilly

Image result for peter campbell and savile

Peter Campbell and Jimmy Savile OBE  with Mary Whitehouse and Roger Ordish

savile-and-campell-jimll-fix-it

The Dream Machine

Jan 29th 1982 – Jim`ll fix it and a photo of the crew with Jimmy Savile at TV theatre.

Director Peter Campbell was on Jim`s right and producer Roger Ordish on his left.

link

 

Paedophile register of controversial group ignored by police – allowing several members to commit abuse

20/3/16

Detectives knew of 300 names in a secret club that advocated sex with children

Police kept the secret membership list of a controversial group which advocated sex with children  “sit in a drawer”, leaving several of those named on it free to commit serious child abuse.

Detectives were given the membership list containing more than 300 names and addresses of the Paedophile Information Exchange (PIE) group in the 1980s, but effectively did nothing with it.One member of the group, which publicly campaigned for adults to be allowed to have sex with children from the age of 10, was convicted 27 years after police were first given the names.

The list has now been passed to the independent Goddard inquiry

Claims of police inaction over child sex abuse allegations comes as Scotland Yard was reportedly planning to announce this week that it will end Operation Midland, its controversial investigations into allegations of VIP child sex abuse and murder.

Labour MP Tom Watson said: “The PIE list shows that there were clear intelligence lines that could have been investigated at the time.

One of those on the list and later convicted was Leo Adamson

Another PIE member later convicted was Charles Napier.

He bragged of easy access to young boys and how he could send obscene images back to Britain in diplomatic bags.

link

via walkerdine:

ADULTS ONLY P.I.E

The Guardian
(London, Greater London, England)
19 May 1977, Thu  • Page 11

A group of Mps, including Sir John Eden MP for Bournemouth East, are waiting to receive a full report on PIE from the Minister of State at the Home Office.

https://twitter.com/i/status/1158707414025342977


The Paedophile Information Exchange PIE was allegedly given £70,000 by the Home Office between 1977 and 1980 – the equivalent today of about £400,000.

A former Home Office worker revealed that Jim Callaghan’s Labour government and Margaret Thatcher’s Conservative administration, which took over in 1979, may have provided funding for PIE.

The whistleblower said senior civil servant Clifford Hindley, who was head of the Home Office’s voluntary services unit, signed off a three year grant for £35,000 in 1980.

http://www.dailymail.co.uk/news/article-2571632/Home-Office-gave-Paedophile-Information-Exchange-70-000-Group-allegedly-given-taxpayers-money-1977-1980.html

childrens-homes-supply-line

Children’s homes were ‘supply line’ for paedophiles, says ex-minister

Lord Warner says an inquiry he conducted in 1992 showed how children’s homes were targeted by powerful people
West Mercia police has seven boxes of evidence including letters between Righton and other alleged paedophiles.
link

Cassandra Cogno‏ @CassandraCogno:

Gisburne House was in Watford @Observer_Owl used by Islington council to send children out of borough – several abusers amongst staff

Importantly @guyadams reported Gisburne House cater Michael Taylor revealed as PIE member in his 2000 trial & conviction


Ex Anglican Franciscan Michael Taylor, PIE member, abuser of boys at  GisburneHouse,

#Islington & #Bersham Hall, #Clwyd

So this is where it comes full circle back to Peter Righton – also an Anglican Franciscan for a while – & the @c_of_e monastic movement(s)

so favoured by Bishop Peter Ball he simply had to set up his own entire movement, just like Father Trevor Huddlestone’s alma mater the college & community of the Resurrection, Mirfield

Peter Righton’s time in retreat as an Anglican Franciscan is also central to the involvement of the Southbank Trio & Albany Trust

Hubert Brasier, Theresa May’s father joined the priests at the Community of the Resurrection Seminary School in Mirfield, West Yorkshire. In years to come the Community of the Resurrection would become known for the systematic sexual abuse of children at the seminary by the Italian Verona brothers, who were rampant sex offenders in the 1960’s and 1970’s. 


The horrors of Gisburne House

https://lizdavies.net/2017/07/28/the-horrors-of-gisburne-house/

July 2000

A social worker who abused two boys at an Islington Council children’s home in the 1970s was sentenced to four years’ imprisonment earlier this week.

Michael Taylor pleaded guilty at London’s Snaresbrook crown court to seven counts of indecent assault at Gisburne House.

When he left Gisburne House he became deputy superintendent of Bersham Hall children’s home in North Wales where he repeatedly assaulted two 11-year-old boys in his care.

Taylor was arrested after the people he abused, now adults, went to the police. He was previously convicted of two indecent assaults in 1980. His name will be added to the sex offenders’ register.

https://theukdatabase.com/2012/03/20/michael-taylor-islingtonbersham-hallgisburne-house/

 


Pedophiles arrested
‘more powerful than the Mafia
by Mark Burdman
On Feb. 2 , in London’ s Old Bailey court, four men were convicted for running a ring of pedophiles-adults who sex­ usually use children-which had recruited at least 150 young boys , some as young as nine, for repeated sodomic abuse.
It is the biggest ring of pedophiles yet uncovered in Britain.
British newspapers Feb. 3 said it had been run as a “Mafia­
like conspiracy. ” One man arrested was too frightened to
testify, declaring that the ring was “more powerful than the
Mafia. “
According to experts on child abuse in Britain, this case is only the beginning. Interviewed on British television Feb. 3 , Dianne Core, head of the Childwatch organization, stated that “people in high places” were involved in pedophiliac activities , and that the whole matter would “explode” during the coming months.
The London Daily Telegraph’s crime  correspondent reported Feb. 3 : “Despite the convictions , po­lice believe there is still a flourishing pedophile network in Britain, with a sophistication said to resemble the Mafia. “

The most prominent figure in the ring, Colin Peters , was trained at Oxford, and was formerly a senior adviser in the British Foreign Office. Following his Foreign Office work, he prosecuted cases for the British Customs and Excise.

Investigators working on the case had interrogated at least one senior member of the House of Lords , one vicar in West London, and officials in Whitehall , “but the police did not have sufficient evidence or manpower to pursue their suspi­cions ,” the Telegraph reported.
Alan Delaney, the official head of the ring, is a cleaning company director. Delaney would procure young boys for pedophiles , by putting job advertisements in the press .
The ring would also procure boys who were members of a junior soccer team.
Many of the youngsters had been at special boarding schools for educationally below-normal children.
Others were runaways , who were caught up by members of the Delaney-Peters ring, who would roam” the streets of Lon­don scouting for boys .
According to the Feb. 3 Telegraph account, the young boys were “passed around its members for sexual degradation and, when the attraction faded, abandoned to a life of pros­titution, drugs , and petty crime . . . . The boys were tempted off the unfamiliar London streets with promises of food, accommodation, money, and a sympathetic ear. Some were plied with drugs, including cocaine, and sexually assaulted while under their influence.”
When he was brought before presiding Judge Pownall for sentencing Feb. 3, Colin Peters was told: “On your own admission, you found boys to satisfy your lust. You were prepared to encourage them to drugs or to lace their drinks­ and you have made matters worse by trying to get witnesses not to attend court. You did that to save your own skin. That was disgraceful. You of all people should have known that. “
‘A permanent conspiracy’ British deputy police superintendent John Lewis , who oversaw the investigations , is calling on Scotland Yard to create a special squad to deal with pedophile rings. Lewis declared Feb. 2 that “these people are as organized and so­phisticated as any other  criminals, and are involved in a permanent conspiracy which is renewed daily as they hunt for new boys. They need to be targeted like bank robbers. It
is important that we should not feel complacent. Positive policing should be continued.”
British police investigators were reportedly angered by the light sentence meted out to Peters , Delaney, and their two  collaborators. The four received, in total, only 34 years of sentences. Peters received only 8 years, for combined charges of conspiracy to commit buggery (sodomy), buggery and conspiracy to pervert the course of justice. Delaney was jailed for 1 1 years , on conspiracy to commit buggery, indecent assault, taking indecent photographs , indecency with a child, and attempted buggery. One of the four was given only 6 years.
A senior British police officer told the Daily Express Feb.
4: “It should have been more. The damage these people have
done to young lives is very severe.”
In an editorial entitled, “Is This Justice?” the Express Feb. 4 called the sentences “woefully inadequate . . . weighed against the enormity of
their crimes and the emotional and physical damage they did
to their victims , some of whom were only nine years old. “
Moncini and the Satanist track
The London case has refocused attention on another recent case, in Trieste, Italy, involving one Alessandro Mon­cini, a businessman nabbed by law enforcement in the United States and convicted in 1988 for importing child pornography (although he received a paltry one-year sentence and was released “on good behavior” after serving less than three
months in jail).
Investigators in Trieste working on the Mon­cini case have recently been to the United States, attempting to accumulate more information on what they believe to be a “most exclusive ring of international pedophiles.”

Informed sources in Britain believe that the Delaney­ Peters ring and the Moncini-linked networks are connected,

and that both are part of an international pedophile conspir­acy.

U. S. law enforcement officials have in their possession tapes of Moncini attempting to procure a young girl, for Satanic-ritual abuse purposes.

Experts on ritual abuse stress that pedophile rings , as horrifying as they are in and of them­ selves , are actually fronts for, or extensions of, hard-core Satanist cults , for whom the pedophiles provide young boys.

In Britain, however, the Home Office has repeatedly
indicated its opposition to allowing the matter of satanism to
be pursued by police and in the courts.

Should this attitude continue, it will be impossible to crack the command-struc­ture controlling powerful pedophile rings.

Investigative leads

Experts in pedophilia and Satanism report to EIR, that
that the dossiers on previously publicized cases of European­
based pedophile rings have never been fully closed, and may
now be reopened. These involve pedophile rings that were
either cracked or exposed in the 1 986-87 period. Three of
them are worth noting:
On June 1 8, 1987, the head of the Belgian national
office of UNICEF was arrested for involvement in a large­
scale child pornography and pedophilia ring. Ring leader
Jozef Verbeeck had used his influential position in UNICEF
to procure children, often from broken homes, some as young
as eight months old, for some 400 wealthy clients across
Europe. The basement of UNICEF in Brussels was used to
store pornographic pictures of children.
• In spring-summer 1987, Dutch authorities uncovered
one of the worst cases of collective child sex abuse in record­
ed history. In a small town called Oode Pekala, during the
Easter holidays , a gang of pedophiles , dressed as clowns,
lured more than 70 children into taking part in pornographic
movies.
On Aug. 3, 1986, the Sunday Times of London “In­sight Team” exposed the activities of a secretive organization called the Spartacus Club, based near Amsterdam in Holland, which sent pedophile literature to 25 ,000 subscribers in Great Britain, and which specialized in procuring boys from the Philippines for pedophile activity. Headed by one John Stam­ford, the club was part of Spartacus International, which published homosexual literature and the Paedo Alert News, “a magazine about boy love. “


James Fraser Darling member of the Spartacus Club 33 years FOR THE SCOT WHO PREYED ON THAI KIDS – serves only 2

Sentenced to 33 years for paedophile offences in Thailand. Released on appeal and deported. Served a grand total of 2 years inside.

James Fraser Darling – who preyed on boys as young as eight – gives one-to-one lessons to the children of wealthy families.

Darling, 56, who lived in Morningside, Edinburgh, before going to the Far East, is working in a private language school in Zhuhai in south China.

We discovered the pervert – the son of an Oxford don – posing as a respectable teacher in the same week as pop paedophile Gary Glitter jetted back into Britain.

But while Glitter, 64, was placed on the UK sex offenders’ register, Darling is subject to no monitoring or restrictions.

At his school in Zhuhai, Darling, who is paid pounds 450 a month, refused to speak to the Sunday Mail.

School principal Li Lulin said she knew nothing about Darling’s crimes – but would not sack him.

She said: “Give him a break. His performance here has been good. I won’t tell parents.

“It’s not up to the Chinese government to punish him for his past. His contract finishes in September. I’ll let him go peacefully.”

A Foreign Office spokswoman said: “It is a matter for the Chinese authorities if they admit him to the country. We wouldn’t necessarily know if Mr Darling was there.”

At the Chinese Embassy in London, a spokeswoman refused to say whether any action would be taken to remove Darling.

 CHILD SEX SHAME OF SCOTS TOFF: He molested Thai lads, court told

Fraser-Darling and other Westerners allegedly molested the boys at the picnics and in Fraser- Darling’s cottage near the poor village of Rawai.

The boys showed investigators photos of themselves naked with the man they knew as “Uncle James”.

Image result for James Fraser Darling

More nude pictures were found at Fraser-Darling’s home, along with a Spartacus magazine article on “boy love” written by a J.Darling. Fraser-Darling denies being the author.

Fraser-Darling, who went to posh Repton school, was arrested in November 1995 after a colleague at the university reported him.

He was about to leave Thai-land for Cambodia when police swooped.

The pervert was taken from prison to court in his brown jail uniform early yesterday. His ankles were chained.

Fraser-Darling admitted he was a paedophile.

But he denied the charges, claiming he was a scapegoat in Thailand’s “witch- hunt” against child sex perverts.

Fraser-Darling’s father is Scots academic Sir Frank Fraser-Darling, an expert on Scottish birds and Hebridean wildlife.

He also has a brother in the Diplomatic Corps.

Someone was pulling strings to get him out of Thailand.

A PAEDOPHILE has arrived in Scotland to claim a family inheritance – still lying about his sleazy past.

Toff James Fraser Darling, 51, is in the Highlands to get what is left of his family’s cash after being freed from a Bangkok jail.

But while the former teacher claims he won an appeal against all convictions, the truth is that the Thais kicked him out after only reducing his jail sentence.

Fraser Darling was left a small fortune while languishing behind bars and used some of the money to win his freedom.

Now the pervert, who preyed on young boys in the seedy resort of Phuket, is staying at an pounds 18-a-night guest house in Forres near his former family home while he plans his future.

Local residents are unaware that he is a convicted paedophile.

 LIES OF DEPRAVED TOFF

Fraser Darling’s father, Sir Frank, died in 1979 at the age of 73 after his retirement as chief officer of the Imperial Bureau of Animal Genetics in Edinburgh.

Edinburgh-born Christina was his third wife and met him when she was taking care of his children after his second wife’s death.

Since Fraser Darling’s arrest he has been too ashamed to contact his brother Richard, 52, a senior Foreign Office intelligence officer, and his sister Francesca, 46, who lives in the USA.

He says he has spent his time in Scotland trying to register for work after a lifetime working abroad in Thailand, Iran, Sri Lanka and El Salvador.

Frank Fraser Darling lived on the island of Tanera Mor.

Tanera Mor is  notable as the location for Frank Fraser Darling’s book Island Years.

Accused Scot was ‘like an uncle’ to Thai boys

THE paedophile son of a Scottish knight was jailed for 33 years in Thailand yesterday for preying on young boys.

Teacher James Fraser Darling, 47, whose father, a leading academic – was an authority on Scottish wildlife, was chained by the ankles as he was led away to the cells wearing regulation brown prison shirt and shorts.

The appalling sex acts he was convicted of were carried out on boys from a sea gypsy community at a Thai beach resort.

He was sentenced to five years each on nine counts of separating children from their parents.

Darling is the son of Sir Frank Fraser Darling, an Oxford don and expert on Scottish bird-life and Hebridean wildlife, who became chief officer of the Imperial Bureau of Animal Genetics in Edinburgh. He died in 1979.

Darling’s mother, Lady Christina Darling of Forres, Moray, died while he was on trial.

His brother Richard, a senior intelligence officer specialising in the war against drugs, works for the Foreign Office in Britain and did not attend the court.

Richard Ogilby Leslie Fraser Darling Counsellor, Foreign and Commonwealth Office.

Pervert Darling, a London University arts graduate, travelled the world teaching in Brazil and Sri Lanka before arriving in Thailand four years ago.

A book published by the Spartacus organisation – a European group linked to paedophilia – was found in his house, and a chapter inside, written by J Darling, described Roman orgies with young boys.

However, Darling denied that he was the author of the work.

The court’s decision was welcomed by FACE, the coalition against Child Exploitation, which has been monitoring suspected paedophiles in Thailand.

Almost everybody on Phuket knew James Fraser Darling.
 How disgusting can you get 2 years then deported back too our country!! Bloody loose around innocent children! Thank you for sharing this



CHARLES’S SEX FILES

Prince Charles has been given access to secret files on the sex lives of the world’s most powerful men and wome – to make sure he is fully informed when he finally becomes king.

The Sun 10-14-12, p9

Prince Charles has been given access to secret files on the sex lives of the world’s most powerful men and women, to make sure he is fully informed when he finally becomes king.

The Crown Jewels of classified intelligence, normally seen only by the queen and senior ministers, are understood to contain details of Princess Diana’s death and the IRA assassination of Lord Mountbatten. he will also see files on UK security threats.

a senior whitehall source said “ he can see everything but not the files on him and Camilla as he is not allowed to see the dossier where he is the subject”

ww:

The inference must be that maj has this information – or how could she be the reigning mollusc?

Which means she would have had all the info from Dickens Dossiers- the dossiers to Maggie Thatcher – Blunt – Prime – Hayman- – all the MP’s so far named – and those as yet unnamed-

and – of course

Jimmy Savile

Image result

“I’ve got eight names of big people, really important names, public figures. And I am going to expose them in Parliament.” (read more)

Although he had previously named senior diplomat Sir Peter Hayman as a paedophile, he never made good on his promise to expose the eight public figures. Just over two months after making the threat, Geoffrey Dickens’s name and address was found in a ‘hit list’ in a notebook belonging to Arthur Hutchinson, who was wanted for three brutal murders and was already on ‘a serious sex charge’.

During his trial, on 11 September 1984, Hutchinson accused Mike Barron, then a reporter with the Sunday Mirror, of committing the murders.

He even pointed to him in court, saying “That’s your killer there”. He explained his prints had been on the champagne bottle because he had picked it up to use as a weapon to defend himself against Mr Barron. Hutchinson claimed that the media had had a vendetta against him, and that:

“Every week for the last 10 months, that man there has been going to my mother’s house threatening her. I was frightened for her and wanted to get the truth out. There’s your killer.”- Arthur Hutchinson

link

Guardian31183

The Guardian, 3rd November 1983

link

 

Triple Hartlepool killer Arthur Hutchinson will die in jail after arguing his treatment was inhuman and degrading

 Now that all chance of release is gone, perhaps he will reveal why he had Geoffrey Dickens details in his notebook?


 

Charles Napier and half -brother John Whittingdale MP
Charles Napier’s arrest took place at the £500,000 home of the MP’s mother.

John Whittingdale MP is a fan of “torture porn”

 At the time of his arrest, Napier, a retired languages teacher, playwright and theatre director, was living in Sherborne with their mother in her home just  1/2 mile from royalty/freemason/establishment-linked Sherborne Schools
In 2012 he gave a lecture on William Shakespeare at the town’s literary festival and was to have a play in winter

Amateur Players of Sherborne: Mr Napier has acted in, directed, or designed the set for the last six productions for the players prior to his arrest

Sherborne School for Girls, the leading public school gives free places to children helped by Kids Company and was attended by founder Camila Batmanghelidjh in the 1970s.
Kids Company boss Camila Batmanghelidjh admits she cheated to get into a the top school Sherborne School for Girls when her mother took an exam for her

Sherborne was a major financial donor to Kids Company – investigated by Parliament, the Charity Commission and the police, before the charity collapsed insolvent in August amid allegations of sex abuse on its premises.
Kids Company’s number one cheerleader in the Cabinet, Oliver Letwin, is a governor and former trustee of Sherborne School for Girls.
Oliver Letwin, the MP for West Dorset, visited the Little Gryphons Nursery School
Margaret Thatcher Arrives to support Oliver Letwin with “noted pederast” Peter Morrison

William Hague appointed Letwin as a member of his Shadow Cabinet as Shadow Chief Secretary to the Treasury in September 2000.

Image result for Mustard heir, Mr Colman, and his wife Susan

Mustard heir, Mr Colman, and his wife Susan, a former spiritual director of the defunct charity Kids Company  funded pervert John Smyth QC for nearly 30 years

 

Mr Colman was an Eton contemporary of the Most Rev Justin Welby, while his father, Sir Michael, oversaw the Church’s investment portfolio between 1993 and 1999, holding the post of First Church Estates Commissioner. He was subsequently awarded the Archbishop of Canterbury’s Cross of St Augustine.

http://www.telegraph.co.uk/news/2017/02/10/colmans-mustard-heir-admits-charity-funded-child-abuse-barrister/

A catastrophic charity collapse. Two inquires that hit the buffers. As a musical lampoons the fiasco… Will Kids Company Camila and her BBC stooge EVER face the music?

  • Stage production depicts the hugely publisised fall of Kids Company charity
  • Comes two years after the controversial charity met its demise amid allegations
  • Inquiries are ongoing but there is not indication of when they might conclude
  • Camila Batmanghelidjh’s autobiography, due out this year, is similarly delayed

Alan Yentob, BBC creative director, throws up his arms in despair. His rich baritone trembles with bathos as he sings: ‘Michael Gove even said it was an inspirational charity!’

The audience titters. The line does not have the lyricism of a Rodgers and Hammerstein, but it is genuinely funny.

And true. The real Mr Yentob — rather than the actor playing him in this stage production — really did say, rather than sing, it.

Just like the BBC bigwig himself, who became embroiled in the scandal surrounding the collapse of the Kids Company charity of which he was chairman, there is something more than a little unconventional about this new musical being previewed in London last week.

First, there is the title: ‘The Public Administration And Constitutional Affairs Select Committee Takes Oral Evidence On Whitehall’s Relationship With Kids Company.’

Then there are the lyrics, taken verbatim from the Hansard transcript of the testimony given by two witnesses who appeared before that committee of MPs on October 15, 2015.

One was Mr Yentob. The other was enigmatic charity supremo Camila Batmanghelidjh, once known as ‘the angel of Camberwell’.

The pair had been summoned to the Commons to explain how Kids Company, the charity of which Ms Batmanghelidjh was founder and CEO, had gone bust amid allegations of financial irregularity and sexual abuse, having received almost £50 million of public money.

That was almost two years ago. And while the musical is opening this week, the public still awaits a definitive official explanation of the charity’s controversial modus operandi and dramatic demise.

The select committee had no powers to act on its own damning findings of an ‘extraordinary catalogue of failures’. Two statutory bodies that do have such powers — the Charity Commission and the Insolvency Service — were supposed to deliver their own reports on Kids Company last autumn. They did not.

Both bodies say inquiries are ‘ongoing’ but there is no indication as to when they might end. Ms Batmanghelidjh’s autobiography, due out late last year, is similarly delayed.

And so the extraordinary saga rumbles on.

The woman at the centre of it all, 54-year-old Camila, keeps, in contrast to her life before the scandal, a low profile these days.

On a rare outing last summer, she was photographed as she went to lunch with representatives of a foreign government ‘which is having to deal with a lot of young refugees’ at the Michelin-starred Pied a Terre restaurant.

Ms Batmanghelidjh says she is continuing to help many Kids Company children, with the financial backing of donors who stayed loyal.

Kids Company rented a £4,000-a-month Grade II-listed art-deco mansion in North London, in which a member of the finance department and one of Ms Batmanghelidjh’s PAs lived

While the Metropolitan Police found insufficient evidence to press any criminal charge, anecdotal evidence of institutional anarchy and excesses at Kids Company still has the power to shock.

Brown envelopes stuffed with cash were handed to troubled children as a matter of course. Twelve-year-old clients were given £150 trainers; others were flown first class to America. Some £50,000 alone was allegedly spent on taxis at the charity’s Christmas party.

Kids Company received £46 million from the UK taxpayer over 13 years, including £3 million days before it shut. Former Mayor of London Boris Johnson is pictured with Camila Batmanghelidjh London Evening Standard's '1000: London's Most Influential People' in 2014

Kids Company received £46 million from the UK taxpayer over 13 years, including £3 million days before it shut. Former Mayor of London Boris Johnson is pictured with Camila Batmanghelidjh London Evening Standard’s ‘1000: London’s Most Influential People’ in 2014

Flamboyant, Iranian-born Camila could charm the birds from the trees. Then prime minister David Cameron was said to be ‘mesmerised’ by her, while his wife Samantha was a backer, along with Prince Charles and a host of other A-list celebrities and City financiers.

Kids Company received £46 million from the UK taxpayer over 13 years, including £3 million days before it shut. Rock band Coldplay ploughed in a further £8 million from royalties.

Ms Batmanghelidjh claimed her charity had 36,000 young ‘clients’.

No doubt there was and remains a very real need for children from splintered families to be supported in Britain’s troubled inner cities.

But something within the organisation was not right. It needed only a small push for the already teetering edifice to collapse. That pressure came from an unlikely quarter.

Pensioner Joan Woolard was the catalyst to Kids Company’s spectacular downfall and remains one of Ms Batmanghelidjh’s fiercest critics.

Having heard the charity boss speak on Radio 4, Mrs Woolard was inspired to sell her home and donate the proceeds — more than £200,000 — to the Kids Company.

Doubts began when she asked how the money had been spent.

The answers were unsatisfactory. Her experience of spending some time at Kids Company offices alarmed her further — and she asked for her money back.

Hers was the first public voice of dissent against this fashionable and feted good cause. Ms Batmanghelidjh denied any wrongdoing.

But the money remained in Ms Batmanghelidjh’s hands. Kids Company needed it desperately.

Encouraged by Mrs Woolard’s public stand, whistle-blowers from inside the organisation began to come forward.

The unsubstantiated allegations of sexual abuse were the final straw.

In August 2015, the charity shut down, laying off scores of staff and abandoning thousands of children.

Some of the evidence subsequently given to the Commons select committee presented a shocking litany of financial chaos, rampant nepotism and very dubious methodology.

The committee concluded: ‘There appears to have been a catastrophic confluence of factors that have conspired to allow this charity to operate as it did, for as long as it did.’

Their report said the ‘approach of successive governments and ministers towards Kids Company has proved to be an improper way to conduct government business or handle public money’.

Alan Yentob had failed to restrain his ‘unaccountable and dominant’ CEO. His employer, the BBC, was also ‘accused of poor leadership for failing to take action against him when he tried to make suggestions about the BBC’s reporting of Kids Company’.

One of the committee’s witnesses, a high-ranking worker who was granted anonymity, gave a particularly damning insight into what Kids Company had become.

She said: ‘The charity was run by the CEO as her personal fiefdom, with no regard whatsoever for the financial implications. It was simply unsustainable to continue to take in anyone who asked for assistance and, in certain specific areas, ridiculous amounts of money were spent wantonly and inappropriately.’

Ms Batmanghelidjh had favourites among the youngsters she helped. ‘One group of young adults — many of them in their late 20s — were known throughout the organisation as “Camila’s kids” and inordinate amounts of money and resources were lavished on them; creating envy and resentment among others.’

But staff were also treated lavishly, the witness stated, and nepotism was rife. ‘Sasha and Jamie Handover (the children of former WH Smith boss Richard Handover, a trustee) were both employed at KC,’ the witness said.

‘The so-called “Operations Manager” — a sweet but totally inefficient woman who kept odd hours — turned out to be the mother of one of the IT chaps.

‘Magbule Mulla — who worked in the finance department — is the sister-in-law of Jeton (Tony) Cavolli, who was Camila’s driver.’

(While her Linked In page still describes her as ‘Assistant Accountant Kids Company’, Mrs Mulla was described by Ms Batmanghelidjh in one interview as ‘the woman who sews for me’.)

Ms Batmanghelidjh would eventually admit that her charity had paid for both of Mr Cavolli’s children to be put through private schools; one of them a boarding establishment where the chairman of governors was one Richard Handover (a trustee).

Mr Cavolli had been described by Ms Batmanghelidjh as a ‘therapist tasked with dealing with difficult young men and only had a car in order to go to their aid late at night’. But in the time she worked there, the witness only ‘heard him referred to as “Tony the Driver”.’

Some of the evidence subsequently given to the Commons select committee presented a shocking litany of financial chaos. Squatters are pictured at the former offices of Kids Company in Kenbury Street, Camberwell

Some of the evidence subsequently given to the Commons select committee presented a shocking litany of financial chaos. Squatters are pictured at the former offices of Kids Company in Kenbury Street, Camberwell

 But staff were also treated lavishly, the witness stated, and nepotism was rife. A toy is pictured tied to a gate at he former offices of Kids Company

It was ‘Tony the Driver’ who was pictured holding the car door open for Ms Batmanghelidjh prior to that lunch at Pied a Terre restaurant last summer.

He was not her chauffeur, she later explained. He was working as an Uber driver and had given her a lift as a ‘favour’.

A university academic whose role as an Ofsted inspector in South London alerted her to Kids Company more than 15 years ago had watched its progress with alarm.

‘The whole history of Kids Company is one of a failure of due diligence by local government, donor charities, the Tory Party, Prince Charles. They all failed. It is astounding,’ she told me.

Hers is only one of many critical voices. But there is an approaching counterblast. Approaching, but repeatedly delayed. Ms Batmanghelidjh’s autobiography was due to be published last autumn. Her ghost-writer is Tim Rayment.

In early 2015 he was sent by his newspaper to investigate Ms Batmanghelidjh. Now he is firmly in her camp.

One view is that Rayment fell under her spell; like so many financiers, pop stars, politicians and royals before him, he was ‘hypnotised’, one colleague said.

‘I want to give voice to someone who has been silenced,’ Mr Rayment told me last year, rather generously of someone who had the ear of royalty and prime ministers.

‘Have I been naïve? Have I been mesmerised?’ he asks. ‘The time to make that judgment is on publication.’

The fall-out has indeed been complex and messy for those involved. Last December, Mr Yentob stepped down as Creative Director of the BBC as a direct result of his involvement in the Kids Company collapse

Last night, a spokesman for Ms Batmanghelidjh’s publisher, Biteback, said she expected the book to appear in August. She explained: ‘We had initially hoped to do a very fast turnaround on this title, and therefore gave it a very ambitious publication date.

‘But it has turned out to be far more complex, both legally and in terms of the science involved, than we had first anticipated.’

The fall-out has indeed been complex and messy for those involved. Last December, Mr Yentob stepped down as Creative Director of the BBC as a direct result of his involvement in the Kids Company collapse.

Earlier this year, it was reported that the Insolvency Service had written to lawyers acting for Kids Company’s former board members to warn them it was minded to ban them from holding directorships.They included Ms Batmanghelidjh, Mr Yentob and Mr Handover. Which brings us back to the musical.

Flamboyant, Iranian-born Camila could charm the birds from the trees. Then prime minister David Cameron was said to be ‘mesmerised’ by her

Flamboyant, Iranian-born Camila could charm the birds from the trees. Then prime minister David Cameron was said to be ‘mesmerised’ by her

‘Mr Yentob’ bewails the sudden denial of the public purse gold seam. He had mined it for years thanks to his contacts with David Cameron and the latter’s desire to give his Big Society slogan some substance and street cred.

Last night, a Charities Commission spokeswoman said: ‘When an inquiry is under way, we do not provide updates on when it is likely to conclude.

‘This is a high-profile case and when a report is available it will be posted online with full findings.’

An Insolvency Service spokesman said: ‘Our investigation into Kids Company remains ongoing. Each case has its own complexities and differences depending on the number of directors involved. There is no timescale for us to reach any conclusions. As such, it would not be appropriate for us to comment further at present.’

Miles Goslett, the journalist who first raised questions about Kids Company, in February 2015, is sceptical about the delay.

‘Both inquiries were set up the best part of two years ago and I was told privately last year they’d be published by Christmas 2016 at the latest,’ he said this week.

‘Even if these bodies are short on manpower, I’d have no difficulty believing that someone in Whitehall has taken the decision it would be politically sensible to keep them from public view for a while yet.’

http://www.dailymail.co.uk/news/article-4659936/Will-Kids-Company-Camila-BBC-stooge-face-music.html


Image result for peter hayman and rosemary blo
Another name that appears is that of a known paedophile, the late senior diplomat Sir Peter Hayman

The Napier and Hayman families had a long record of imperial service at the highest levelMany members of the family were senior Freemasons:

Sir Peter’s grandfather Canon Henry Hayman was Provincial Grand Master of Nottinghamshire and a Past Grand Chaplain of England; while Charles Napier’s ancestors included a Grand Master Mason of Scotland.

Charles Napier’s parents were cousins: his maternal grandfather Brigadier Arthur Napier had top level intelligence connections as military adviser to the Ministry of Supply.

Embedded image permalink

At the time of his paedophile offences, Napier’s  cousin Rosemary Blomefield was married to Sir Peter Hayman, a senior MI6 officer who was later himself exposed as a paedophile though never prosecuted.

Napier was jailed for 13 years in 2014 for hundreds of sex attacks on schoolboys.

Peter Righton was a founder of PIE, Napier its one-time treasurer. Righton, incredibly, was also one of Britain’s leading child protection specialists when Virginia Bottomley was Health Secretary

The file also contains a John Napier, who had been convicted for running a “child brothel” in London in the early 1970s.

“The police had the lists from the late 1980s…The files sat in a drawer, metaphorically speaking, until 2012, when Operation Fairbank decided to go back and have a look.

Jimmy Savile and Keith Harding on BBC’s Jim’ll Fix It

Keith Harding invited to show to mend a 13-year-old girl’s music box, which her brother says was a “set-up” by the production team.

MUSIC box collector and clock maker Keith Harding, whose staff restored antiques for royalty, played a vital role in Britain’s biggest child sex ring. He is also on the list.

He was a “schedule 1” offender – meaning his convictions remained on his police file for life.

But he was later given the Freedom of the City of London and became a member of the Worshipful Company of Clockmakers, meeting business and political figures at the height of his career.

The clockmaker and music box expert ran a museum regularly visited by children, despite social services being aware 20 years ago of his convictions for child abuse.

He had been convicted of indecent assault against four children aged eight and nine in 1958 when he was a teacher. 

Harding was influential among high-profile paedophiles


 

 

Dame Alun Roberts‏ @ciabaudo

I stumbled across this tweet referring to John Whittingdale having used the alias John Napier ‘in those days’.

His name appeared ‘namely’ right next to that of his half-brother Charles Napier who affectionately referred to Whippo in correspondence as ‘Little Johnny’, a man who he would entrust stuff to for safekeeping. Charles, a prolific abuser, was a very close friend of Peter Righton.


HRH Crafty Muvva @craftymuvva

Another John Napier to add to the mix… this one’s a doctor, living at Dolphin Square in 1976…


 


Paedophile Mason Keith Harding ran lodge set up for GCHQ

ONE OF Britain’s most influential paedophiles was the head of a Masonic lodge founded and frequented by GCHQ spies.

A PIE list seized in 1984 records Harding, as member 329

http://www.express.co.uk/news/uk/579523/Paedophile-Mason-lodge-GCHQ

The pervert met regularly with MPs Leon Brittan and Cyril Smith at his world-renowned workshop. 
John Whittingdale was pps to Leon Brittan

One of Harding‘s staff, who worked for him between 1980 and 1987, said: “Leon Brittan and Cyril Smith were both regular visitors to the shop.Usually they would come in via the side door, other times they would ring the bell at the front entrance and come in.
“They’d straight away ask for Keith who would be coming down the stairs. “Then they would then either go up to his office for a private meeting or they’d go out for several hours.”
Keith Harding  was very upper class and mixed in those sorts of circles.
Jeremy Thorpe, Cyril Smith, David Steel
………………………………………………………………………………………………
Jeremy Thorpe and Cyril Smith would also drop by
along with key members of the vile Paedophile Information Exchange
including  Tom O’ Carroll and Steven Adrian Smith:

 Steven Adrian Smith (who worked at the Home Office and kept PIE files stored there) boasted that he ran the Paedophile Information Exchange (PIE) from behind his desk at the Home Office
 

Keith Harding’s shop: The former worker added: The shop had many high profile customers, including the Royals.”

Keith Harding he was asked to build a special clock in honour of the Queen’s Silver Jubilee in 1977.

link
 photo clock philip_zpsajp1rlx6.jpg
The Worshipful Company of Clockmakers : memorial slab in the floor of Westminster Abbey, London, was unveiled by HRH The Prince Philip
 
The stone memorial slab in the floor of Westminster Abbey, London, was unveiled by HRH The Prince Philip Duke of Edinburgh in 2006 at a special celebration of the life and achievements of John Harrison, arranged by The Clockmakers’ Company.
 

14-PIE-list.jpg

There are 307 names on the list seen by The IoS, including four women.

There are several members living abroad, and one of them currently appears to be a children’s entertainer.

Some of the PIE members also feature on a list amassed by the US Customs child pornography and protection unit which collected a list of British customers of American suppliers of child abuse images.

The US list was also supplied to UK law enforcement agencies but little if anything was done about it.

One of those on both lists is former school teacher Terence Waters. In 1994, he was jailed for 10 years for possessing indecent images of children and sexually abusing a 10-year-old boy.

Leading anti-child sex abuse campaigners said that they were astonished at the police inaction over the PIE membership list.

“We know that those who look at sexual images of children often go on to become ‘contact’ offenders, so had more action been taken as a result of the police having the lists, many children would not have been abused, as is clear from the case of Adamson. There still seems to be a mindset that says we should all just move on and leave the past in the past, yet people have a lifetime of trauma to deal with and the police should have recognised that in their handling of these cases.”

Read more http://www.independent.co.uk/news/uk/crime/paedophile-register-of-controversial-group-ignored-by-police-


gojam-pie-list

 ^ How did he get that? (Full police PIE list)

……………

spotlightonabuse.wordpress.com/2013/02/22/blackmail-after-man-applied-to-join-paedophile-organization-4-2-77/

Jo Richardson MP, the National Council for Civil Liberties and the Labour Campaign for Gay Rights are among the several individuals and organisations that have protested to the Lord Chancellor, on PIE’s behalf, over a judge’s comments at a recent Old Bailey trial.

They are demanding that the judge be disciplined, and are supporting the Exchange in its claim that the remarks may well have been a “serious breach of legal ethics.

When sentencing Andre Stephen Thorne (21) to 3 years for theft and the attempted blackmail of a PIE applicant, the judge, Mr Justice King-Hamilton, said that PIE had “access to potential dynamite,” and added: “On the face of it, some sort of an offence is being committed by the person or persons running this organisation (THE SUN, Feb. 4th).. I wonder if the membership forms are collected from members of the public for the purposes of blackmail (SOUTH LONDON PRESS)?

PIE’s reaction was fast and furious. Secretary, Tom O’Carroll drafted an immediate letter to THE GUARDIAN; and on March the 17th, Deputy Leader, Warren Middleton despatched a press release announcing that the group would lodge the “strongest possible protest” with the Lord Chancellor and the Home Secretary.

Soon after, PIE’s Chairperson, Keith Hose, contacted the NCCL, finally requesting Jo Richardson (Labour, Barking) to table a question in the Commons. She declined, but has since filed an official complaint with Elwyn Jones.

The first of the protests, from the NCCL (29/3/’77), described the comments as “extremely unfortunate” and accused the judge of “misusing his position to make comments which were unwarranted and without any apparent foundation.”

Prompted by the reply which, said a Council official, was “totally unsatisfactory,” the NCCL then approached Lord Beaumont of Whitley asking him to raise the matter in the Lords. But he, too, declined.

Now, the Council is seeking the advice of Lord Hailsham, himself a former Lord Chancellor, and will act in accordance with his reply.”

bitsofbooksblog.wordpress.com/1976-80/

Truthseeker‏@thewakeupcall09

Members of the NCCL Executive Committee, Known Professions and Associated Organizations, 1974-1981.

……..

MISC

bobchewy‏ @bobchewy

Guess What I found at NCCL archives

U DCL/688/9 File. Heterosexual women and ‘Under-age’ boys 1 file 1977-78

U DCL/688/10 File. Adult males and under-age girls 1 file 1977-1978

U DCL/688/11 File. Heterosexual sex under age PIE (Paedophile Information Exchange) Trial 1980 -1981


Truthseeker1‏@thewakeupcall09

PIE members Thomas Victor O’Carroll aka Carl Tom (ex-chairman) & Reginald Burnham

Sherborne School, PIE etc

Entrance to Sherborne School, Dorset, UK.

Sherborne School, Dorset

Sherborne Schoolis a British independent boys’ school, (for ages 13-18 yrs) located in the town of Sherborne in north-west Dorset, England.

It has close partnerships with the nearby girls’ school Sherborne Girls

Sherborne School has educated prominent figures for hundreds of years since it was founded by Edward VI in 1550.

Sherborne School Alumni – Stanley Johnson, Alan Turing

Sir David Spedding: Former Head of Secret Intelligence Service


Stanley Johnson (center) with friends

Other Establishment connections with Sherborne School:

Christopher Bournes Rhys-Jones – The father of Sophie Helen Rhys-Jones (married to Prince Edward) was a geography master at Sherborne School, Sherborne

Tory MP’s half-brother who was known as ‘Rapier Napier’ by his pupils and helped run Paedophile Information Exchange is jailed for 13 years for HUNDREDS of sex assaults on young boys in the 60s and 70s

assaulting 21 victims aged as young as eight

Acting Detective Chief Inspector Keith Braithwaite said: ‘Napier is an arrogant, controlling and manipulative individual who has shown no remorse for the serious sexual offences he committed against young and vulnerable victims.

He has offended throughout most of his adult life; exploiting opportunities to continue his criminality against children through his employment and standing within society.

Mr Napier said:

“I agreed to take part in the literary festival months before I knew where the talk would be held. Then it never crossed my mind that it would be problem.

“I am devastated that I cannot be involved with the APS and with A Winter’s Tale anymore. I think I might not ever be able to take part in something like this again.

“It is sad that something like this has happened

I hope at least that I will be able to remain in Sherborne

where I live with my 92-year-old mother.”

http://www.westerndailypress.co.uk/Paedophile-director-shock-resignation/story-17328992-detail/story.html#ixzz3tAiHYUDF

http://www.dailymail.co.uk/news/article-2885152/Tory-MP-s-half-brother-known-Napier-Rapier-pupils-jailed-13-years-HUNDREDS-sex-assaults.html

………………………………………………………………………………………………

Sherborne School in the news:

  • Chris Davis, 53, was dismissed from £34,000-a-year Sherborne School
  • His personal assistant Micaila Vivier was then fired after ‘leaking emails’
  • She claimed Mr Davis was sacked after disagreement with governors
  • Ms Vivier said headmaster wanted pupil to move to a different school  

 A statement posted to the school’s website insisted: ‘There is absolutely no element whatsoever of untoward activity on the part of the outgoing Headmaster, or any other member of the staff, that has led to or contributed to this decision.’

….I think it was odd that he was dismissed after only three days of term and it would be helpful if the governors had told us more about the reason behind his sudden departure. It would put an end to what will doubtless be endless speculation.”

Speaking to The Times, Mr Davis’s wife Innes, 52, declined to comment on the reasoning behind the departure.

Mr Davis previously taught at Eton, where he himself was educated. He joined after a career in the City, and was the head of Warre House, of which David Cameron was a member in the 1980s.


Sherborne School Inspirational Speaker Programme

 Speakers have included David Aaronovitch,

David Aaronovitch, a columnist on The Times well known for dismissing claims about paedophile VIPs as “conspiracy theory”, …an article by Aaronovitch in The Observer in 2003 … attempted to diminish the seriousness of “child porn”.
David Aaronovitch’s column “Let’s See Some Evidence. Then We Can Panic” published in the Times on July 10th. As a general rule of thumb, anyone who refers to public inquiries and investigative journalism into organised child sexual abuse rings as “paedogeddon” is already starting from a position of disbelieving the statements of victims of child sexual abuse.

Royalty/Establishment Links to Sherborne School

Freemasons: Last year’s Provincial Grand Lodge meeting was held at Sherborne School

Last year’s Provincial Grand Lodge meeting was held at Sherborne School on Thursday 30th October. Prior to the meeting, the 2014 Dorset Masonic Magazine was delivered by post to all Brethren subscribing to a Lodge in the Province of Dorset and this contained a removable agenda for the Provincial meeting.

Lord Montgomery at Sherborne 1959

 photo lord montgomery sherborne_zpsuiwvoj0c.jpg
re: Hamilton’s Biography of Lord Montgomery:
“Hamilton himself referred to Monty’s (Lord Montgomery) “romantic friendships with young boys” in the original book, specifically the 12-year-old Swiss lad Lucien Trueb “who engaged Monty’s affectionate attention”.
The question Hamilton is really posing now is not whether Field Marshal Lord Montgomery of Alamein was gay, but whether he was a repressed paedophile.”
Lord Bramall was awarded the Military Cross by Field Marshal Montgomery in 1945.

Mountbatten at Sherborne School 1964 Commemoration

 photo mountbatten sherborne_zpss5jyqqlk.jpg

 http://oldshirburnian.org.uk/wp-content/uploads/2014/03/A-History-of-Sherborne-School-resized.pdf

Truthseeker1‏ @thewakeupcall09

Lord Louis Mountbatten former chauffeur Norman Nield exposed him

Meanwhile, in New Zealand, there have been such newspaper headlines as, “‘Uncle Dickie’ the Sex Pervert” (N.Z. Truth, Sept.  8, 1987), since Mountbatten’s former chauffeur, Norman Nield, started revealing details of the late Lord Mountbatten’s alleged sexual exploitation of boys.

Image result for mountbatten on boat

Edward Prince of Wales and his cousin Lord Louis Mountbatten “relax” in a canvas swimming pool on board H. M. S. Renown during their 1920 Empire Tour.

Lord Louis was a great grandson of Queen Victoria and the uncle of Prince Philip (consort of Queen Elizabeth II). Mountbatten was also a promiscuous bisexual who was famously rumored to have had an affair with Edward VIII (who was Prince of Wales at the time) when he accompanied him on his Empire tours (see photo above).

link

Related image

Image result for mountbatten and queen elizabeth

The Queen. Like any human being, she is subject to the influence of those around her. While he lived, Lord Mountbatten was a persuasive counsellor, and he formulated the plan for Prince Charles’s unusually rigorous education.

http://www.nytimes.com/1981/07/26/magazine/an-informal-look-at-the-royal-family.html?pagewanted=all


Letwin insisted on giving £3 million of public money to Kids Company in July, against the advice of Whitehall mandarins.

The BBC has commissioned a documentary about the charity, scheduled to be shown next year. Insiders have expressed surprise about this, given that £330,000-a-year BBC executive Alan Yentob was Kids Company chairman of trustees between 2003 and 2015.


Kids Company

The leaked email shows how Yentob, currently the BBC’s £330,000-a-year creative director, mounted a concerted operation to lobby the Labour Government to cancel the bill. The bill was waived the following year. The message, sent using a BBC email address to nine Kids Company colleagues – including Ms Batmanghelidjh – revealed he had contacted Dawn Primarolo, then the Paymaster General in the Treasury, and Paul Boateng, the Chief Secretary to the Treasury, about the tax bill.
 photo boat and kid co_zpsvkjejth8.jpg
Mr Yentob said he had been advised by Ms Primarolo’s aides to put the charity’s case to her in a letter, so she could refer the matter to the Inland Revenue – which Mr Yentob said he would be doing ‘with a little bit of help from my friends’.
Both Ms Primarolo and Mr Boateng worked at the time for the then-Chancellor Gordon Brown.
 Mr Yentob also says in the message: ‘Paul Boateng and I have managed to miss each other on the telephone but his office has been extremely co-operative and concerned and a phone call is being set up for tomorrow morning.’

A few months later, £589,957 was written off using taxpayers’ money, with an additional £100,000 debt met by an unidentified donor.

The charity’s unpaid bill was first revealed by The Mail on Sunday last week, which led to this newspaper obtaining the Yentob email.

The charity has received about £4 million from the Government every year for the last decade.

Ms Batmanghelidjh claims the Government has targeted her because she has a list of Establishment figures allegedly involved in historical child sex abuse.

Mr Boateng said last night: ‘I do not recall the details. I would not be prepared to comment without consulting Treasury papers. I was responsible for spending, not tax.’


Wealthy Cabinet minister Oliver Letwin takes in lodgers at his London home
Oliver Letwin, David Cameron’s close ally, takes in lodgers at the south London home which has hit the headlines in the past.

en.wikipedia.org/wiki/Oliver_Letwin#cite_note-24


Celebrities and the royals were bewitched by Camila's charms (she is pictured with Prince Charles)

Swathes of London would ‘descend into savagery’. There would be riots in the streets, and widespread looting. Angry mobs would carry out ‘arson attacks’ on government buildings.

This apocalyptic scenario formed the basis of an extraordinary document sent to the Government from the email account of Kids Company chief Camila Batmanghelidjh.

As a sort of ransom note to ministers, signed by her charity’s chairman Alan Yentob, its message was simple: hand over a £3 million emergency grant to my charity or London will burn.

To a degree, it had its desired effect because that money was promptly given.

Yet those millions weren’t enough. Kids Company hit the wall. Around £1.2 million of the £3 million was lost. And now three major inquiries are investigating the collapsed charity, which over the past decade has got through more than £30 million in public funds.

Born in Tehran on New Year’s Day 1963, Camila Batmanghelidjh is one of four children of Fereydoon Batman-Ghelidj, a property developer and doctor who belonged to one of pre-revolutionary Iran’s wealthiest and most influential families.

Her uncle, Hooshang, was the Iranian ambassador to Turkey. Grandfather Mehdi was a wealthy property developer, too. And a great uncle, Nader, was an army general and loyal henchman of the country’s ruling Shah.

In interviews, her mother, Lucile, has been described as ‘a Belgian aristocrat’

http://www.dailymail.co.uk/news/article-3214710/Why-does-Kids-Company-Camila-tell-tall-stories-life-troubling-investigation-reveals-colourful-acount-past-doesn-t-quite-add-up.html

 photo cam20and20kenn_zpsscxjeaol.jpg

Camila Batmanghelidjh talks to NCCL/Liberty’s Patron Helena Kennedy

 https://www.hayfestival.com/p-2431-camila-batmanghelidjh-talks-to-helena-kennedy.aspx?skinid=16


From Liberty/NCCL’s website

International Women’s Day

The Women of the World WOW festival, which begins today and runs over the weekend, includes an impressive list of speakers from the spheres of politics, popular culture and activism. Mumsnet founder Justine Roberts, Eve Ensler, Camila Batmanghelidjh, Erin Pizzey and Helena Kennedy are just some of the women who will be appearing at the festival – and of course our own director, Shami Chakrabarti, will be at a number of the events over the four days. The festival will cover issues as diverse as domestic violence, sustainable business, Mary Whitehouse and Margaret Thatcher.

https://www.liberty-human-rights.org.uk/news/blog/international-womens-day


PIE Keith Harding antique piece in the Garrick Club

Harding, fig. … (front base) Prov: Btby R. B. from Keith Harding Antiques, Hornsey Road, London Source: One of seven figures based on engravings in John Tallis’s Shakespeare Gallery (1852-53); also an engraving by T. Sherratt, after H.

Garrick Club Members

In 2011, the Garrick Club newsletter compiled a list of 100 notable deceased members (since updated), yielding:

Michael Havers, Baron Haversthe brother of Baroness Butler-Sloss

Sir Michael Havers was appointed as Attorney General by Margaret Thatcher in 1979, and was made Baron Havers in 1987. He intervened three times between 1981 and 1983 to stop the investigation and exposure of Establishment paedophiles, and to prevent the publication of stories which showed that Establishment figures were members of the Paedophile Information Exchange.

 

Sir Douglas Bader beside Janner

via cassandra cogno

Bader interested in Leics PHAB group– 1 founder was albany trust’s youth worker Ric Rogers

given Hon Presidency of PHAB in 1974 & it’s spun off as separate charity from NAYC

wondering if jimmy Martin a member-under ex HBOS chairman lord Dennis Stevenson savile

There are various articles about Janner taking up the cause of that young boy with thalidomide

In the picture with, them, cutting the cake are (left-to-right): Eric Parker, Reg Varney, Bill Cotton Jr, Jimmy Savile, Nigel Broackes, Sir Douglas Bader, Lord George Brown, and Denis Compton.

Sir David Napley – Janner’s solicitor

Isnt it weird that Sir David Napley was both solicitor to Sir Peter Hayman and a certain prominent ex-mp, (Proctor) fond of spanking

twitter.com/REBELTROOP

1987, May – Harvey Proctor resigns as MP for Billericay shortly after his trial and after being fined pounds 1,450 for acts of gross indecency;

he was involved in homosexual spanking sessions with young male prostitutes.

His lawyer is Sir David Napley:
influential solicitor, who represents also Commander Trestrial who is also on the Elm Guest House list.

Liz Davies comment

Keith Harding’s shop closed just a year before I was working in Islington in my social work office in the same road.

Another centre of PIE was also just a street away.

Some of the children who were being sexually exploited in that area may have known about this shop but I had no idea about it at the time.

They will now be in their 40s. Some of the social work staff must have known about the shop as Harding made a point of having a high profile locally. The Islington child abuse story reached a peak in 1992 and again in 2003 but it isn’t over as yet.

 photo sav20harding_zps2v1ojx9w.jpg

Dr Liz Davies, who originally blew the whistle on the borough’s paedophile ring, says

I firmly believe there was a link between Savile and Islington children’s homes.”

Savile, Haut de la Garenne

Postcards From Jersey To Islington

The astonishing thing regarding the exchange “holidays” for care home children that took place between the child abuse hot spots of Islington care homes and Haut de la Garenne in Jersey is the distinct lack of evidence.

The exchange trips took place and yet there appears to be no official record. That lack of bureaucratic paperwork  in itself raises extremely disturbing questions, regardless of whether child abuse took place, as former residents claim.

How can young children be transported from one local authority across the English Channel to another without any record of the trips existing ?

Either the exchange trips did not take place (yet we know they did) or someone has been extremely careless or negligent with the paperwork.

link

In 1987, Harding moved to Gloucestershire where social services were aware nearly 20 years ago of his criminal convictions.

Gloucestershire County Council declined to comment on the fact that he continued to run a music box museum in Northleach, which was regularly visited by children, until his death aged 82 in June.

www.bbc.co.uk/news/uk-30051756

books.google.com/books?id=PoxJAQAAIAAJ&q=keith+harding+antiques&dq=keith+harding+antiques&hl=en&sa=X&ved=0CCoQ6AEwAmoVChMI0InswKfXxwIVRvI-Ch2ZBQBY

article-2581913-1c54532500000578-893_634x554

Lord Justice Fulford was revealed to have been a founder of a ‘defence committee’ for the Paedophile Information Exchange while it was openly calling for the age of consent to be cut to just four.

He discussed holding courtroom protests at meetings with PIE chairman Tom O’Carroll – who was jailed for two years in 1981 for conspiracy to corrupt public morals – and wrote articles claiming O’Carroll’s trial was an ‘act of oppression’ because the child sex campaigners only wanted to ‘make friends’.

http://www.dailymail.co.uk/news/article-2581913/Now-Chief-Coroner-exposed-paedophile-apologist-wanted-age-consent-14.html

 

2014

Lord Justice Fulford, named as an adviser to the Queen

http://www.belfasttelegraph.co.uk/news/uk/judge-sorry-after-pie-support-claim-30076221.html

Press release

Investigatory Powers Commissioner appointed: Lord Justice Fulford

The Prime Minister has approved the appointment of Lord Justice Fulford as the first Investigatory Powers Commissioner.

Judge Adrian Fulford – Can we trust him?

Judge Fulford

Judge Fulford presided over Roger Laing 2015 Oct 2 Court of Appeal  [7] No aspersions are being made about whether the right decision was made in this particular case of child abuse.

However the appeal brought to mind that Judge Fulford was accused in 2014 by the Mail of backing the Paedophile Information Exchange PIE and being in groups that supported it. High Court judge and the child sex ring: Adviser to Queen was founder of paedophile support group to keep offenders out of jail [8]

He has apologised for some of his links but says he has no memories of others, states the Guardian,  Judge apologises for involvement with NCCL group linked to PIE [9]

The Mail on Sunday states “But he said he had “no memory” of being a founder member of the Conspiracy Against Public Morals, which the Mail continues was set up to defend PIE leaders facing criminal charges.”

An official investigation by the Judicial Conduct Investigations Office took place by Lord Kerr of Tonaghmore. It concluded on 18 June 2014, that the allegations against Fulford were “without substance” and he “was not and had never been a supporter of PIE or its aims”. Following his exoneration, Fulford resumed sitting as a judge on the full range of appeals [10]

Unfortunately the Ministry of Justice and the Judicial Conduct Investigations Office have not been transparent about the investigation.

They issued a dismissive press statement [11a] and below, stating that Fulford was exonerated after after two “lengthy” interviews with “searching questions” put to him by fellow Justice, Justice Lord Kerr, a Justice of the Supreme Court of the United Kingdom to which Adrian Fulford reponded!

 

How much easier if their names were given as well..

Just for information the Lord Chief Justice was Lord Thomas of Cwmgiedd, who is John Thomas, Baron Thomas of Cwmgiedd [18] and without the titles just plain John Thomas. The Lord Chancellor was just plain Chris Grayling  [19]. Lord Kerr of Tonaghmore turns out to be Brian Kerr, Baron Kerr of Tonaghmore or just plain Brian Kerr [20]

The Ministry of Justice has refused to publish a copy of the report on grounds of confidentiality and personal information [11b]. They even took the statement down from their website after a year as revealed by this FOI request [11]

Whilst the Mail group is often gossip from the gutter, the MOJ statement, undated and unsigned is breathtaking in its arrogance. It does not even address the issue of group that Adrian Fulford is supposed to have founded – “Conspiracy against Public Morals” which supported PIE.

It is not denied that Fulford (Adrian) was there at the third meeting on 11 Sept 1979 nor even that he founded the group. In October 1979 the Mail says Fulford wrote a full-page article in gay rights magazine Broadsheet, in which he was described as ‘the founder’ of the PIE support group.

Among those also attending the 11 Sept meeting were Sandy Marks and Tim Brown.

Sandy Marks and Tim Brown were both members of the radical Fallen Angels collective who according to Charlotte Russell, the pre-eminent researcher in this field, “the Fallen Angels took it upon themselves to call the Gay Movement to account, their final three sentences underlined concluding their case” [16]

  • “The question is whether gay complicity in the oppression of children and pedophiles is to persist”
  • “The ILGA must acknowledge adult-child relations as crucial to the development of a coherent sexual politics.”
  • “We demand the right to form alternative relations with kids – on their terms, and to affirm the erotic in those relations.”

Tim Brown wrote “Show me an adult who is not a paedophile…Sex with children is wonderful… Children are wonderful they should not be subjected to any kind of guilt trip or legal shit about their bodies and their sexuality. It is theirs and nobody else’s.” Tim Brown, London N19 [16]

Sandy Marks chaired the Islington social services committee during the children’s homes scandal of the 1990s, attended a conference with a radical pro-paedophile activist group called Fallen Angels in 1980.

Her other paedophilic  links are explored in this article Islington kids’ homes scandal: Shame of ex-mayor Sandy Marks’ pro-paedophile past [17]

These articles by Ms Russell confirm the agenda of the Fallen Angels and much else

  • CONSPIRACY AGAINST PUBLIC MORALS: PAEDOPHILIA & PUBLIC MORALS (OCTOBER 1980) [13] 
  •  IGA Conference April 1980: The Fallen Angels take PIE’s fight to Barcelona  [14]
  • Little Angels? A letter to Socialist Challenge from Fallen Angel Tim Brown (October 1979) [15]
  • Fallen Angels: Paedophilia – Summary Submission to the ILGA Conference, Barcelona 1980 [16]
  • Islington kids’ homes scandal: Shame of ex-mayor Sandy Marks’ pro-paedophile past [17] 

“.. Islington had become a focal point for the politicisation of paedophilia,” said Ms Russell.

Although Adrian Fulford is reported as saying that Tom O’Carrolls presence ‘left me feeling extremely uncomfortable’, he does not mention that the Fallen Angels made him feel at all queasy.

Sandy Marks has said various things about the time, one of which is she cannot remember events of this time due to illness. Islington Council have said they are shocked and that there will be an investigation by a “top lawyer”. It is not clear who the “top” lawyer is, or how “top” they will be, whether the investigation has begun or when the Report will be published.

It is essential that Adrian Fulford must give evidence to this inquiry. He clearly would have first hand evidence, from the inside, of what happened at the time. Perhaps he could be “top witness”.

Clearly if someone of his position does not give evidence, then the Islington investigation cannot be remotely to be said to be a thorough investigation. It would be negligent not to.

It would also be very interesting as to what Sandy Marks might have to say about Adrian Fulford..

As long as the MOJ is secretive and dismissive, and justice is not seen to be done then there naturally will be suspicions. The public obviously do not know the detail of what was considered, but would be right to demand further information. Is it right that Judges investigate themselves and then publish the report? These Judges could even be friends.

Ministry of Justice and Child Protection Policy

Also worrying is that the Ministry of Justice does not have any child protection policy  [11c]

  1. Can you email me the Child Protection Policy of the Ministry of Justice?”

The MoJ adheres to the requirements of the Children’s Acts 1989 and 2004. To establish whether the information was held I conducted a thorough search, and made enquires within Judicial Office as well as Civil and Family Justice Policy areas.  It may help if I clarify that the information being requested is not held by MoJ because there is no legal or business requirement for MoJ to do so.  There is no MoJ wide Child Protection Policy each business area would consider the need for a specific policy given the context of the work which that area carries out.  The work of the MoJ is vast and diverse and as such one policy would not necessarily encompass the entirety of its business sufficiently and different areas of the MoJ have policies designed to address their unique needs.

Judges and Blackmail

If a Judge was a paedophile supporter it would be quite within the bounds of possibility, in fact the very MO of the “security” services that the judge was blackmailed by the deep state, the secret services. He could be put into positions of power to do the bidding of those very services. Indeed the secret services are often accused of running the child abuse networks for this very purpose.

Lord Justice Fulford, is now a Lord Justice of Appeal and as of 1 January 2016, is the Senior Presiding Judge for England and Wales. He was also appointed as the Investigatory Powers Commissioner for a 3-year term on 3 March 2017 [10]

Fulford’s job is to “authorise and oversee the use of snooping powers by public authorities” [12].

Some people may still be worried that he is “authorising and overseeing” authorities who could have control over him by blackmail.

Some may be worried that as Senior Presiding Judge for England and Wales, Sir Adrian Fulford has not been publicly exonerated of being free of any sinister influence over him in the public positions he holds.

Is it right that a Judicial Report about the links to paedophile and child abusing groups, of a man who is Investigatory Powers Commissioner and the Senior Presiding Judge for England and Wales, is kept secret?

Shame on the murky Judicial Conduct Investigations Office and MOJ.

The Judicial Conduct Investigations Office  – a body that is supposed to investigate complaints into the judiciary.

  • Is that not extra reason for justice to be seen to be done?
  • Is that not extra reason to be transparent?
  • Is it the same old story that power breeds arrogance?
  • Is it the illusion of justice that is being propagandised to the people?
  • Are the judiciary being blackmailed by the deep state?
  • How do we know that the following is not the true scenario?

Brian had a couple of chats with his friend Adrian, perhaps at the urinals down at the club. Adrian replied. Brian told John and Chris who were in the bar, that there was nothing to it.  Squeaky clean old boy, squeaky clean. It was all dressed up as legit, titles added, committee names, hyperbole, as per, so on and so forth. Jobs a good un.

John, Chris, Brian and Adrian all know Andy. Its in the interest of national security, after all.

Apparently so is raping children….

If its not, then the Report of the Inquiry into Sir Adrian Fulford must be published.

https://cathyfox.wordpress.com/2017/07/25/judge-adrian-fulford-can-we-trust-him/



Keith Harding was given the Freedom of the City of London and made a member of the Worshipful Company of Clockmakers. 

He moved to Gloucester in 1987 after PIE disbanded, setting up Keith Harding’s World of Mechanical Music, a museum in Northleach, near Cheltenham.

He was exposed as a member of PIE last November when footage emerged of him appearing alongside Jimmy Savile on a Christmas special of Jim’ll Fix It. 

It later transpired that he had been convicted of indecent assault against four children aged eight and nine in 1958 when he was a teacher. 

He apparently confessed to a friend he had the list of names kept in a safe.

One of his staff, who worked for him between 1980 and 1987, said: “Leon Brittan and Cyril Smith were both regular visitors to the shop. Usually they would come in via the side door, other times they would ring the bell at the front entrance and come in. “They’d straight away ask for Keith who would be coming down the stairs.“Then they would then either go up to his office for a private meeting or they’d go out for several hours.” The former worker added: “The shop had many high profile customers, including the Royals, because we were one of the few antique dealers in the world that specialised in restoring clocks, music boxes and automatons. “It’s only now, with what I know about Brittan and Smith, and of course Keith, that has made me wonder what they were doing. Jeremy Thorpe too was an occasional visitor.” link

Stuart Hall

Stuart Hall is known for his eccentricity and is a collector of antique clocks

http://www.express.co.uk/news/uk/414945/FIVE-new-allegations-against-Stuart-Hall-including-a-rape-of-12-year-old

The former worker added: “The shop had many high profile customers, including the Royals, because we were one of the few antique dealers in the world that specialised in restoring clocks, music boxes and automatons. 

Convicted paedophile Stuart Hall would most likely have known Keith Harding??

Queen, Stuart Hall, OBE

stuart-hall-clocks-1

stuart-hall-clocks-2

stuart-hall-clocks-4

The Impostor


The Chairman of PIE told the Daily Mirror: “There would be no penalty for a paedophile having sex with a child under three years old. But he would probably be prevented from it by a system of injunctions which we would like to see brought in.”

pie-1977

Readers’ responses to Gay News editorial ‘The PIE Affair’ in Gay News No 127 [22 Sept – 5 October 1977]

‘Over-Dramatised Report’ from Graham Wilkinson, Hove, Essex [CHE’s organiser of the Nottingham Conference which caused controversy over Dr Brongersma delivering a speech and a workshop scheduled to discuss Paedophilia]

‘Smug, Self-Righteous’ from Charles Napier, Treasurer of PIE

‘False Sentiment’ from Patrick Wilson, Kent is concerned about PIE’s exploitative lack of regard for the inequality of infancy in adult-child sexual “relationships”

‘Back Stabbing’ from Keith Hose, ex-Chairman on behalf of PIE

‘Straight Paper’ from Terry Waller, N4

‘In Perspective’ from Ian Harvey, W2

‘Lack of Sympathy’ from Tony Deane, N4

‘Nothing Sacrosanct’ from Micky Burbidge, N19 [co-drafter of PIE’s submission to the Criminal Law Reform Committee alongside Keith Hose, Chairman]

‘Slippery Slope’ from Julian Carter, Dorset – a lone voice “Whatever next for CHE – necrophilia perhaps?”

‘Personal Courage’ from Keith Spence, SW4

link

IslingtonSurvivorsNetwork‏ @theIslingtonSN

40YearsAgo:Two masterminds of , Peter Righton & Micky Burbidge, convene the Joint Council for Gay Teenagers (JCGT) upstairs at Grapevine, 296 Holloway Road. Righton & Burbidge want to create an umbrella organisation to gain dominion over grassroots gay youth groups


Dr Richard Barker‏@swrb1

Peter Righton has since died. His partner, Richard Alston, who lived with him at Thornham Magna, has since been convicted and imprisoned for sexual offences against children.

This Year 35 years ago in 1983 Islington BC gave a grant of £3,233 to the Islington Suffolk Project which a decade later in 1993 gave haven to Peter Righton after his conviction

 

@CassandraCogno

Righton was PIE’s bridge between the far left (Micky Burbidge) & the far right (Ian Greer)

Why did Peter Righton hide out in Thornham Magna @ Islington Suffolk Project?

Cassandra Cogno‏ @CassandraCogno

If Lord Henniker was such a philanthropist why was he taking money off  islingtonBC for Islington Suffolk Project? Also as @ian_pace noted Richard Alston thanks Islington resident & PIE lobbyist Micky Burbidge in the foreword of Sir Colin Davis bio

Colin Davis - For The Record

via Troy

Front Cover

Why was the Family Welfare Association promoting PIE in 1981?

link


Secret service infiltrated paedophile group to ‘blackmail establishment’

2014

BRITISH security services infiltrated and funded the notorious Paedophile Information Exchange in a covert operation to identify and possibly blackmail establishment figures, a Home Office whistleblower alleges.

The former civil servant has told detectives investigating the activities of paedophiles in national politics that the Metropolitan Police’s Special Branch was orchestrating the child-sex lobbying group in the late 1970s and early 1980s.

It emerged late last year that PIE was twice gave amounts of £35,000 in Home Office funding between 1977 and 1980, the £70,000 total equivalent to over £400,000 in today’s money.

Until now, speculation about the grant has centred on Clifford Hindley, the late Home Office manager who approved the payments. However, the whistleblower told the Sunday Express he thought higher and more sinister powers were at play.

He has given a formal statement to that effect to detectives from Operation Fernbridge, which is looking into allegations of historic sex abuse at the Elm Guest House in south-west London.

PIE, now considered one of the most notorious groups of the era, had gained respectability in political circles. Its members are said to have included establishment figures, and disgraced Liberal MP Cyril Smith was a friend of founder member Peter Righton.

In 1981, Tory MP Geoffrey Dickens used Parliamentary privilege to name Sir Peter Hayman, the deputy director of MI6, as a member of PIE and an active paedophile. In 1983 Mr Dickens gave the Home Office a dossier of what he claimed was evidence of a paedophile network of “big, big names, people in positions of power, influence and responsibility”. The Home Office says the dossier no longer exists.

Whistleblower Mr X, whose identity we have agreed to protect, became a very senior figure in local government before retiring a few years ago. In the late 1970s and early 1980s, he was a full-time consultant in the Home Office’s Voluntary Services Unit run by Clifford Hindley.

In 1979 Mr X was asked to examine a funding renewal application for PIE, but he became concerned because the organisation’s goal of seeking to abolish the age of consent “conflicted” with the child protection policies of the Department of Health and Social Security and asked for a meeting with Mr Hindley, his immediate boss.

Mr X recalled: “I raised my concerns, but he told me that I was to drop them. Hindley gave three reasons for this. He said PIE was an organisation with cachet and that its work in this field was respected.

“He said this was a renewal of an existing grant and that under normal Home Office practice a consultant such as myself would not be involved in the decision-making process.

“And he said PIE was being funded at the request of Special Branch which found it politically useful to identify people who were paedophiles. This led me not to pursue my objections. At that time, questioning anything to do with Special Branch, especially within the Home Office, was a ‘no-no’.

“I was under the clear belief that I was being instructed to back off and that his reference to Special Branch was expected to make me to do so.

“Hindley didn’t give me an explicit explanation of what Special Branch would do with information it gleaned from funding PIE, but I formed the belief that it was part of an undercover operation or activity. I was aware a lot of people in the civil service or political arena had an interest in obtaining information like that which could be used as a sort of blackmail.”

He said he asked for a file the Home Office kept on PIE, but his request was refused. However, he was certain then Tory Home Office Minister Tim Raison, who died in 2011, must have signed the 1980 funding application.

Mr X has given a formal written statement to the inquiry set up last year into former Home Office links with PIE but has refused to meet the inquiry in person because he fears “repercussions” under the Official Secrets Act.

link

U DCL/858/4 File. Paedophile Information Exchange Aug 1977 – Feb 1978
View U DCL/858/3 File. Paedophile Information Exchange 1978 – 1987
View U DCL/688/11 File. Heterosexual sex under age: PIE (Paedophile Information Exchange) Trial 1980 – 1981

http://www.hullhistorycentre.org.uk/dserve/dserve.exe

File. Heterosexual sex under age: PIE (Paedophile Information Exchange) Trial

Reference No:
U DCL/688/11
Dates:
1980 – 1981
Format:
Archive Item
Extent:
1 file
Access Conditions:
Access will be granted to any accredited reader
Repository:
Hull University Archives
Collection:
Archives of Liberty (formerly The National Council for Civil Liberties) (1934 – )
http://catalogue.hullhistorycentre.org.uk/catalogue/U-DCL-688-11

via walkerdine

Grants ‘help child sex group’

 16 Dec 1977  The Guardian

grants-help-pie

Two trusts which receive grants from Government funds are supporting the Paedophile Information Exchange – the group which wants to legalise sex between adults and children -an MP claimed in the Commons yesterday

Sir Bernard Braine (C, SE Essex) said he had evidence that both the Albany Trust and the Princedale Trust gave encouragement and publicity to PIE.

Home Office Minister of State, Mr Brynmor John, told Sir Bernard that the Voluntary Services Unit had paid £43,625 to the Albany Trust and £86,000 to the Princedale Trust since 1974.

A final grant of over 3,000 was still due to Albany and the Education Department was giving it £5,717 in 1976/77.

Later, Mr John told Mr Alan Clark (C, Sutton) that he was still examining information on child pornography. On the legal side there were difficulties…He was having discussions with Mr Cyril Townsend (C, Bexleyheath), who has a Private Members Bill on the subject.

https://www.newspapers.com/clip/9279184/pie_grant_1/

T

Trust Deeds
Antony Grey: The Trust’s involvement with this group occurred after its then chairman, Harold Haywood, OBE; and I attended a workshop on Sexual Minorities organised by MIND (the National Association for Mental Health) some two years ago (1975)…
Mr Haywood suggested to me that the Trust …should convene a meeting of psychiatrists, social workers, probation officers, and other interested in the problem, and also ask some paedophiles to come along and put their points of view.

The Guardian

 
Harold Haywood alterations on paedophile document

tiggr talk‏ @tiggrtalk

Harold Haywood at yet another P.I.E meeting?!

photo-2-57.jpg (1936×2592)

HH

Haywood Albany Trust Runaway problem vice trial playland Sept 27 1975

The Guardian
(London, Greater London, England)
27 Sep 1975, Sat  • Page 10

PRINCE CHARLES HAYWOOD HOMELESS 25 OCT 1985


prince-charles-haywood-homeless-25-oct-1985

 

how-the-albany-trust-keeps-the-sexual-debate-alive

The Guardian
(London, Greater London, England)
24 Jan 1978, Tue  • Page 10

HOW THE ALBANY TRUST KEEPS THE SEXUAL DEBATE ALIVE


HRH Crafty Muvva @craftymuvva 

Both the Albany Trust and the Princedale Trust gave money to PIE:

Advert for Peter Katin’s piano recital in aid of Albany Trust, with a speech by Clement Freud

Date: 19/09/1968
Source: New Christian
Headline: Advert for Peter Katin’s piano recital in aid of Albany Trust, with a speech by Clement Freud
Notes:

In 1968 (paedophile) Clement Freud gave a speech at a function to raise money for the Albany Trust:


 

 Ruan Bone & Jimmy Savile BBC Broadcasting House – Studio Six

15 Mar 2017

 Albany Trust – Ruan Bone / David Porter

ago

Lunch was published by CHE from 1970 to 1974 and run by Ruan Bone.

 Ruan Bone interview with Jimmy Savile

 

Alan Francis OBE – Head of Security at Mecca Leisure

 

Alan Francis Metropolitan Police

  the off the square masonica on the table, very drole

PHAB Princess Jean Galitzine, Savile & Paul Daniels

 



The site of the former Elm Guest House in Barnes

Westminster paedophile ring allegations: Scotland Yard detectives trace ‘victim’

Alleged victim of paedophile sex abuse interviewed in United States at request of Scotland Yard

link

^ If the 2 persons referred to here are Eric Kasir and Leon Brittan, why is The Telegraph allowing Brittan’s name to be whitewashed?

My question was whether Leon Brittan was implicated by the US victim mentioned in your Telegrah article.

Yes.


Germany’s secret paedophilia experiment

via

West Germany’s Paedophile Group were DSAP – any archive of theirs would include a lot of PIE correspondence – and mention of Fallen Angels

PIE Newsletters always extolling virtues of paedophiles working with most difficult or deprived children always the most vulnerable

Image result for charles napier and whittingdale

Charles Napier (left) argued that paedophiles were a social benefit to society because they would look after children for low pay in bad conditions

John Whittingdale, half-brother of convicted PIE secretary Napier was SPAD to Brittan who was close friend of (PIE member) Keith Harding. Coincidence?

The Guardian
(London, Greater London, England)
28 Aug 1996, Wed  • Page 27


In Lambeth paedophile Michael John Carroll was supported in their fostering efforts – maybe west Germany’s “experiment” not so rare?

DSAP & a French group were only 2 foreign p’phile groups to pledge support to PIE in 1980 at 2nd international gay association Barcelona

With passports handed in PIE five defendants awaiting trial on bail couldn’t attend IGA so it was up to N19’s Fallen Angel Collective to

Represent British paedophiles though they later fell out bcse FAC thought o Carrolls book was not radical enough

One of the Fallen Angels lived with Barry prothero the NCCL gay rights officer after Nettie Pollard PIE member

In some socialist circles in N19 there would be no revolution without children’s liberation & their right to have sex with adults


Westminster paedophiles: Bulic Forsythe, when PIE went gay and the death of scepticism

Operation Cayacos: investigating allegations of a paedophile ring linked to dead convicted paedophile Peter Righton – a founding member of the Paedophile Information Exchange. PIE suggested that, as homosexuals had become “gays”, paedophiles should be called “kind persons”.  It wasn’t rape, they argued. It was just sexual freedom. PIE members  – which numbers around 450 at it speak – were keen to be seen as an oppressed group, like homosexuals.

PIE got a good write up in Community Care, the social workers’ trade paper. A four-page article in 1977 mused “Should we pity the paedophiles?”

paedos-new-stateman

community-care-paedophile-abuse

link

Dr Ken Plummer

Paedophilia in Academia: Dr Ken Plummer, University of Essex

The German Green Party recently apologised for their part in promoting paedophilia. Read more The Green’s co-leader, Jurgen Trittin, was accused of signing off a 1981 pamphlet calling for the decriminalisation of sexual acts between adults and children “that occur without the use of threat or force”. People who promote paedophilia may not be paedophiles themselves, but they provide paedophiles with the intellectual justification to perpetrate crimes against children.

In the UK it is a crime to incite racial hatred – why doesn’t a similar law apply for inciting sexual crimes against children?

Dr. Ken Plummer has been associated with the University of Essex since 1975, and was once Head of the Sociology Department. In his biography he states that his main interests “have always been in the development of a humanistic method and theory to help towards a better social world where there will be less socially produced suffering”. University of Essex website

It could be said that he has done the opposite – he has helped create more suffering by promoting paedophilia and providing ‘academic’ opinions which support the views of those who sexually abuse children. In fact he openly admits his intentions:

By applying sociology to the field of paedophilia we may partially relativise it, humanise it, normalise it, and politicise it. (1)

Ken Plummer attempted to redefine the language surrounding child sexual abuse. In his world, child victims are ‘partners’, sexual abuse is ‘consensual’, a  child being sexually abused by an adult is ‘a relationship’, and long term effects of sexual abuse are mostly ‘a myth’.

…there is the stereotype that the child is “innocent”, “uninvolved” and “non-participating”: this can be so (notably in rape cases) but this is usually not the case with paedophilia. (2)

A sixth stereotype suggests that the consequences to the child of paedophilia are devastating. They can be, but frequently they are not. This is a complex issue and three crucial distinctions must be made here; the first requires distinguishing between experiences that are consensual (paedophilia) and those that are not (child rape)… (3)

His language is very similar in tone to that of the Paedophile Information Exchange (PIE), an organisation that campaigned for the age of consent to be reduced to 4 years old, effectively legalising paedophilia. This might not be a coincidence, as it has been said that Ken Plummer was member no. 236 of PIE, and regularly corresponded with other members of PIE, including Peter Righton.

Righton was a highly respected child care expert who had helped create a network of paedophile academics and intellectuals that preyed on children in schools and children’s homes across the UK. BBC Inside Story: The Secret Life of a Paedophile

paedophile-information-exchange

Plummer and Righton both contributed to a book called Perspectives on Paedophilia. The book was a supposedly objective look at paedophilia, and was designed to be used on social work training courses. If Plummer was a member of PIE at the time, or was supportive of their views, he should have declared this interest and therefore his lack of objectivity.

He refers to paedophiles sexual abusing children under 6 years old as ‘a relationship’, and uses inverted commas around the word ‘victim’:

But again, studies suggest that relationships with children under 6 are rare – and that relationships with early adolescents are the most common. (4)

A second group of assumptions highlights the nature of childhood and “child victims”. (5)

Plummer concedes the shortcomings of research of the subject of paedophilia, but is still happy to cite outdated studies if they can be used to support the sexual abuse of children.

While there is little scientific research in this field – and what exists usually depends upon biased psychiatric and prison samples… (6)

He uses this inadequate ‘research’ to undermine the fact that sexual abuse causes devastating harm to the child, and instead lays the blame for any harm with parents, the police, and the courts:

A further image concerns the impact of paedophilia on the child: in the short run, the child is traumatized; and in the long run, seriously damaged. Perhaps surprisingly, the evidence does not support this. In the short run, studies suggest that children’s problems often flow from the reactions of parents who respond to the event with such horror that it elevates the significance of the experience in the child’s eye. The significance can be compounded by police and court action. In the long run, the “victims” are generally shown to lead “normal” lives. In Gagnon’s sample of 333 “victims”, only 5 percent had damaged adult lives – but even “damage” could have had diverse origins. (7)

Plummer goes on to deny that paedophiles are usually interested in sex with children, that it is forced upon the child, and that it is exploitative. Note his use of ‘quotes’ from members of the public in a blatant attempt to demonstrate how uneducated and vulgar the opponents of paedophilia are.

Three further ‘myths’ focus upon the kinds of relationship between paedophile and child. It is usually seen as a coital relationship (interestingly, the press convert “paedophilia” (literally “love of children”) into “child-sex”, so people could remark: “They’re after fucking little kids, ain’t they”); as a forced relationship (“It’s an open door to rape”; “If you’ve got a little child 4 years old and you think one of these bastards is gonna rape the child, and it’s gonna be legal…”); and as an exploitative one. (8)

Despite his admission about the shortcomings of research on paedophilia, Plummer cites an obscure 1964 study by Mohr to challenge the idea that paedophiles use force and to lay blame on the child for inviting the abuse:

Indeed, in some cases the child can be seen as “inviting” the relationship, and – according to Mohr – “most children could have avoided the experience if they wanted to”. The Kinsey study also noted: “In our total of 18,000 interviews, no man or woman reported being victimised by a child.” (9) See also Kinsey’s Paedophiles

Plummer also frequently cites Mohr in ‘Constructing a Sociological Baseline’ to peddle the lie that victims of child abuse are ‘willing partners’:

A third stereotype suggests that the sex act is forced on the child and is uncontrolled. It is not. Again Mohr (1968)…observes that paedophilia occurs in part with the cooperation of the child either out of sexual curiosity or out of emotional need. It is comparatively rare that the sex act is forced upon the child. (10)

Plummer refers to “many case histories” which he claims prove that “children have been greatly assisted in their development” by being sexually abused by an adult (11), and denies that the abused child is exploited by the adult:

It is difficult, then, within a paedophile relationship to be very clear about the balance of power. Certainly if one just studies existing relationships, the power balance can be very ambiguous – for maybe as Tom O’Carroll suggests “Power in a consensual relationship resides with the party that needs the relationship less”, and very often that is the child. Sometimes, then, it is possible for the child to “exploit” the adult – financially and emotionally. (12)

Please note that Tom O’Carroll was Chairman of the Paedophile Information Exchange and in 2006 was convicted for distributing a collection of 50,000 images of child abuse. He was arrested after undercover police infiltrated a group known as the International Paedophile Child Emancipation Group and its subsidiary, Gentlemen with an Interesting Name.“According to police O’Carroll saw the groups as a base for an “international secret society” of “academic” child abusers…Children, mainly boys and some as young as six, had been filmed and photographed being raped and tortured.” BBC News

o'carroll

In University contracts there is usually a clause about ‘not bringing the University into any disrepute’.

The University also has a duty of care to the students.

It is time that the University of Essex’s Vice Chancellor and Governors addressed these issues with Dr Plummer who should surely, like the German Green Party, be asked to apologise for the pro-paedophile views he expressed so forcefully in the above writings.

The essays quoted above are dated and it’s possible that Dr Plummer may have altered his views since then, as there is much more academic material available now, as well as many first hand accounts from survivors which explain the hugely damaging long term effects of child sexual abuse.

Questions for the Vice Chancellor of University of Essex

– Do you understand that Dr Plummer’s views as expressed in the above texts could be said to bring the University into disrepute?

– If thse same views have been presented to students at your University through Dr Plummer’s teaching and writing, do you consider that this has demonstrated a breach of the University’s duty of care towards its students?

– Will you facilitate Dr Plummer in making a formal apology to victims and survivors of child sexual crime for the views he expressed in his writings as cited above?

– Will you provide a statement that Dr Plummer’s teaching, writing and research does not in any way currently promote pro-paedophile perspectives?

– I will publish the Vice Chancellor’s response on this website.

Questions for Dr Ken Plummer

– Do you still hold the same views on paedophilia that are expressed in your essays Paedophilia: Constructing a Sociological Baseline and Images of Paedophilia?

– If you do still hold these views, does your teaching reflect these views?

– If your views have changed, have you written anything which clarifies your position? I’ll happily publish it on this blog.

– If you do still hold these views, what do you say to child victims and survivors who may have been abused by those students influenced by your teachings? I’ll happily publish an apology on this website to the victims, survivors and students.

References

(1) p.244, Paedophilia: Constructing a Sociological Baseline by Kenneth Plummer, from Adult Sexual Interest in Children, edited by Mark Cook and Kevin Howells, University Press, 1981

(2) p.226, Paedophilia: Constructing a Sociological Baseline by Kenneth Plummer, from Adult Sexual Interest in Children, edited by Mark Cook and Kevin Howells, University Press, 1981

(3) p.226, Paedophilia: Constructing a Sociological Baseline by Kenneth Plummer, from Adult Sexual Interest in Children, edited by Mark Cook and Kevin Howells, University Press, 1981

(4) p.539, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(5) p.538, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(6) p.537, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(7) p.539, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(8) p.539, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(9) p.539, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(10) p.225, Paedophilia: Constructing a Sociological Baseline by Kenneth Plummer, from Adult Sexual Interest in Children, edited by Mark Cook and Kevin Howells, University Press, 1981

(11) p.539, Images of Paedophilia by Ken Plummer, from Love and Attraction: An International Conference, edited by Mark Cook and Glenn Wilson, Pergamon Press, 1979

(12) p.243, Paedophilia: Constructing a Sociological Baseline by Kenneth Plummer, from Adult Sexual Interest in Children, edited by Mark Cook and Kevin Howells, University Press, 1981

link

 Amiable Warriors

Image result

Amiable Warriors: Endorsements for Volume One

From Ken Plummer, Emeritus Professor of Sociology, University of Essex

Amiable Warriors is a magnificent achievement. Peter Scott-Presland has given us a wonderful gift that future generations can cherish. In this richly documented, meticulously crafted and beautifully written study we are shown the earliest days of struggles to bring about a more human world. I look forward to more volumes to come. …

From Peter Tatchell, human rights campaigner

If you want to understand how we won LGBTI law reform in the UK, read this history of the pioneering Campaign for Homosexual Equality – and remember with pride the CHE campaigners who trailblazed the equal rights we now enjoy.

link

Ken Plummer

1966-1970: coming out as gay, starting a PhD on gay life in London at the LSE, starting teaching at a soon-to-be Poly (Middlesex), and becoming a sociologist and a member of the National Deviancy Conference. I was not directly involved in the student politics of 1968, but was involved in gay reformism (at the Albany Trust) and then in 1970 with the LSE based Gay Liberation Front.

https://kenplummer.com/resources-2/presentations/1968-subterranean-worlds/

Post #1103 mentions 1968 Albany Trust Ken Plummer! of Essex

“Paedophiles are told they are the seducers and rapists of children; they know their experiences are often loving and tender ones. They are told that children are pure and innocent, devoid of sexuality; they know both from their own experiences of childhood and from the children they meet that this is not the case.”

As recently as 2012, Prof Plummer published on his personal blog a chapter he wrote in another book, Male Intergenerational Intimacy, in 1991. “As homosexuality has become slightly less open to sustained moral panic, the new pariah of ‘child molester’ has become the latest folk devil,” he wrote. “Many adult paedophiles say that boys actively seek out sex partners … ‘childhood’ itself is not a biological given but an historically produced social object.”

Prof Plummer confirmed to The Sunday Telegraph that he had been a member of PIE in order to “facilitate” his research.

http://www.telegraph.co.uk/comment/10948796/Paedophilia-is-natural-and-normal-for-males.html


 

Image result for peter tatchell child quote unwanted

tatchell-and-father-seed

Peter Tatchell with Father Seed

https://twitter.com/bindelj/status/1060945932479533056

https://twitter.com/bindelj/status/1060945932479533056

Library set up tribute to paedophile campaigner Ian Dunn

Bosses at the National Library of Scotland have removed an exhibit which paid tribute to a late gay rights campaigner after it was revealed he was a co-founder of a notorious child abuse network.
A small display in a reading room at the academic centre in Edinburgh hailed Ian Dunn as a champion of LGBT rights – but failed to mention he was also involved in establishing the Paedophile Information Exchange (PIE).
Dunn, who died in 1998, has been widely named as an influential member of a national campaign that called for the legalisation of sex between adults and children. PIE was disbanded in 1984 after a series of newspaper exposures, with many of its leading activists subsequently jailed.

Staff at the library hurriedly removed the tribute to Dunn yesterday after being alerted to his past by The Times newspaper. A spokeswoman said the exhibit had been installed by a staff member in good faith in late 2018, with no complaints being registered. A single tweet sent to the library in November by a member of the public, which expressed concern about its appropriateness, was missed.

Scottish Conservative MSP Annie Wells said: “No-one wants to see regular interference from politicians when it comes to archives and artefacts. “But displaying these items which are so blatantly tainted by someone with links to a group promoting paedophilia is a misjudgement. “It will be disturbing and upsetting to anyone who’s been a victim of paedophilia, and I hope this decision is revisited.”
Dunn worked as a local authority town planner in Edinburgh and helped run the Lavender Menace bookshop in Forth Street in the 1980s. His links to PIE have been well-documented. Last year, the BBC faced criticism for uploading a 1976 documentary on gay rights in Scotland to its website as Dunn was listed as one of the programme’s presenters.

Newspapers were reporting Dunn’s links to paedophilia as far back as 1984. A Sunday Mail report from the time alleged he “allows his flat to be used as the main contact address for Britain and the whole of Europe for paedophiles”.

A library spokeswoman said: “Material from Dunn’s archive was unfortunately selected for a small display relating to gay rights in one of our reading rooms. “Small displays such as these are not routinely subject to the same level of curatorial scrutiny as our larger displays or exhibitions. We have since been extremely concerned to learn of Dunn’s wider history and immediately removed the display and any associated promotional activity.”

 https://www.scotsman.com/news/national-library-of-scotland-criticised-over-tribute-to-paedophile-campaigner-1-4854452


 

link

Peter Tatchell was a leading member of the Gay Liberation Front (GLF) but never knew or met any GLF members that where paedophiles like John David Stamford ?

More on Tatchell at bottom of post.

Is this the current CHE membership leaflet with photo of Nettie Pollard & Peter Tatchell from 2011?

“Pollard gave a constant stream of support to paedophiles and promoted their views.”

Photo below: Nettie Pollard (EC Member) with Peter Tatchell at the 2011 Annual Conference:

Nettie Pollard was member number 70 of the Paedophile Information Exchange.

link

tatchell-and-nettie-pollard

Nettie Pollard was NCCL’s Gay & Lesbian Officer, and chaired the NCCL’s gay rights committee, which included Paedophile Information Exchange leader Tom O’Carroll. She was responsible for inviting PIE to affiliate with NCCL in 1975.

Nettie Pollard was member number 70 of the Paedophile Information Exchange.

paedophile-information-exchangePollard played a leading role in the Campaign for Homosexual Equality, who voted to support PIE at their 1975 conference, and defended PIE’s “right to speak and organise freely” at their 1983 conference.

In 1993 she wrote an essay called ‘The Small Matter of Children’, which begins by talking of “children’s rights” but then gives the game away by quoting speeches given to American paedophile group NAMBLA, and a book called Betrayal of Youth, which was edited by PIE member Warren Middleton aka John Parratt. It also peddles the lie that child rape can be ‘consensual’, talks of ‘mutual sexual pleasure’ and…

PIE’s first journal Understanding Paedophilia, the predecessor of Magpie.

Nettie Pollard: NCCL official and PIE member

spotlight

Nettie Pollard was NCCL’s Gay & Lesbian Officer, and chaired the NCCL’s gay rights committee, which included Paedophile Information Exchange leader Tom O’Carroll. She was responsible for inviting PIE to affiliate with NCCL in 1975.

Nettie Pollard was member number 70 of the Paedophile Information Exchange.

paedophile-information-exchangePollard played a leading role in the Campaign for Homosexual Equality, who voted to support PIE at their 1975 conference, and defended PIE’s “right to speak and organise freely” at their 1983 conference.

In 1993 she wrote an essay called ‘The Small Matter of Children’, which begins by talking of “children’s rights” but then gives the game away by quoting speeches given to American paedophile group NAMBLA, and a book called Betrayal of Youth, which was edited by PIE member Warren Middleton aka John Parratt. It also peddles the lie that child rape can be ‘consensual’, talks of ‘mutual sexual pleasure’ and…

View original post 304 more words


Margaret Hodge: Anti-paedophile campaigner?

spotlight

An Islington Gazette cutting from November 1983 shows that former Islington Council leader Margaret Hodge signed a petition to ban the Paedophile Information Exchange (PIE), an organisation that wanted to lower the age of consent to 4 years old.

IG041183Mrs Hodge’s anti-paedophile stance must have been the cause of constant arguments, since her husband, Henry Hodge, and her close friends Harriet Harman and Jack Dromey, were all senior officials of the National Council for Civil Liberties (NCCL), which was affiliated to the Paedophile Information Exchange.

Although Margaret Hodge was well aware of PIE’s activities, she says she was unaware that paedophiles wanted to work with children. During her time as leader (1982-1992), every one of Islington’s children’s homes was infiltrated by paedophiles.

She recently tried to explain her total failure to protect children in care from paedophile rings, prostitution, and trafficking by saying “All that happened when we didn’t really…

View original post 97 more words


NCCL Documentary Evidence 2 – Sexual Offences – Evidence to the Criminal Law Revision Committee 1976

Below is the text of all sections of Sexual Offences: Evidence to the Criminal Law Revision Committee. NCCL Report no. 13 (February 1976, revised edition March 1976) which are relevant to issues concerning PIE, to whom they had become affiliated by this time. Some of this has been quoted in various newspaper articles, but the complete text should make clear the extent to which NCCL’s recommendations were being influenced by PIE-style thinking (though some of it is perfectly reasonable). I will provide proper commentary, together with other NCCL-related information, at a later date.

Differences between the February and March 1976 versions of the report, both of which I have looked at, are tiny and cosmetic.

Introduction to the second edition

The publication of NCCL’s evidence on the law relating to sexual offences has caused considerable controversy. Unfortunately, the publicity given to the proposals to lower the ages of consent did not generally make clear the distinction which we made between an area of private morality, where the individual may make his or her own choice, and the area where the criminal law should intervene. Some commentators preferred to assert the innocence of ‘childhood’, ignoring the fact that a number of people below the age of 16 do choose to have sexual intercourse. Others defended the existing law on heterosexual activity on the ground that the law is a defence of the girl who wishes to say ‘no’. There is no evidence to suggest that the existing law does protect girls who wish to avoid intercourse: NCCL’s case is that such protection, if it does exist, should not be given at the expense of making criminal sexual activity between partners who consent.

Timely illustration of how objectionable the use of the criminal law is in this area was given this month when Justice Melford Stevenson criticised the police for charging an 18-year-old man with unlawful sexual intercourse with his 15-year-old girlfriend – whose consent, according to the judge, was not in doubt. The law is, of course, very rarely enforced, and it is not clear whether those who uphold its existence wish to see such prosecutions brought more frequently.

There has been considerable criticism of NCCL’s proposals on the ages of consent some based on a misunderstanding of our reasoning. But the proposals have also attracted support from those who share our conviction that the criminal law should not interfere with private, consenting sexual activity, and from a number of young people, and those working with them, who welcome the recognition that they are capable of making their own choice. This report has already stimulated public discussion about major issues of law and morality, and we welcome continuing debate on the proposals which we have made.

March 1976

Introduction

One of the most empty opinions frequently given about our society is that it is a ‘permissive society’. The term is rarely defined. It is true that certain barriers to sexual activity have been lowered, but the high threshold of guilt that affects many people often distorts relationships and behaviour and makes quite legitimate sexual freedoms beyond the reach of many people. The law still operates harshly to discourage certain sexual activities, even where no harm to others is identifiable. It would be equally true to say, as Anthony Grey of the Sexual Law Reform Society recently did, that ours is a repressive society. It is quite usual for advocates of any sexual freedom to be regarded as if they were calling for sexual licence. The test of any freedom – and there is no reason to exclude sexuality from this rule – is its effect on the legitimate freedoms of others.

Although in the past it was accepted that ecclesiastical laws and, subsequently, civil laws could properly enforce a moral code, in more recent times the feeling has been growing that Acts of Parliament should not, and cannot, control the moral side of our lives. It was put forcibly in a perspicacious sentence of the Wolfenden Report (1957) : ‘Unless a deliberate attempt is to be made by society, acting through the agency of the law, to equate the sphere of crime with that of sin, there must remain a realm of private morality and immorality which is, in brief and crude terms, not the law’s business.

The NCCL believes that the main function of the law on sexual behaviour should be protection; the only reason for making a sexual activity illegal is because it may result in other people being harmed. This rules out all laws concerned solely with morality. It also rules out paternalistic laws which attempt to stop an individual from harming himself; it is quite difficult in reality, to harm oneself by having too much sex.

There are, in NCCL’s opinion, two areas where a protective law may properly restrict sexual behaviour:

i) Where one or more parties to a sexual act have not consented;
ii) Where sexual behaviour results in demonstrable suffering or offence to other people.

Age of Consent

True consent has not been obtained unless all the participants have freely entered into the activity. The law must prevent individuals from forcing their attentions upon others by using violence, threats, fraud, blackmail or other improper pressures, such as taking unfair advantage of those under one’s authority or those who are handicapped in some way. Most people would agree that the law must intervene in such circumstances. The problem of consent becomes controversial when one has to decide at what age a child is responsible for his/her actions and is therefore capable of giving consent.

Many people hold strong opinions about the age of consent, but there is very little real evidence that can be used to support any one particular age. It is possible to use very similar arguments to support the age of 12, 13, 14, or 15. The choice of any particular age is quite arbitrary; this may seem inevitable to lawmakers, but one should not forget that this appears ridiculous to young people who are told sexual intercourse is illegal one day and legal the following day.

Some doctors support the present age of consent in the belief that the cervix is more liable to damage by sexual intercourse at 14 than at 16 but this is disputed by other medical experts and the evidence either way is far from convincing. The main arguments in favour of a high age of consent are psychological and emotional. It is said that adolescents may be physically capable of exercising their sexuality, but they are not mentally prepared for this experience. People who put forward this argument are really thinking about emotional commitments more than physical acts, but there is no law that can, or should, control romantic attachments.

It is also said that adolescents cannot have a very realistic idea of the possible consequences of their sexual activities and that giving expression to their desires could lead to a pregnancy with unfortunate consequences for the offspring, as well as for the adolescents, their parents and the community. Against this it can be argued that there are now fairly efficient ways of avoiding an unwanted pregnancy, if adolescents can be persuaded to make use of them. But many of these young people, who need contraceptives and advice about sexual matters, may be reluctant to ask for help when they know that they are breaking the law by engaging in sexual activities below the age of consent. Counsellors, doctors and others who wish to help adolescents are also put in an awkward position because in theory, at least, they are aiding and abetting an offence. Furthermore, the law making heterosexual sexual intercourse illegal under 16 is often broken and rarely enforced. (This argument, about prevention of pregnancy, does not of course apply to sexual activity between persons of the same sex.)

The law also takes no account of the fact that the age of puberty is much lower now than when it was decided to make 16 the age of consent. There is no real biological justification for any particular age. Less than a hundred years ago, the age of consent was 13. It was changed in 1885 following a scandal concerning child prostitution. Most girls have reached puberty by the age of 12 and most boys intend to have early sexual experience, whatever the law may be. Contemporary psychological research has shown that children have sexual feelings and desires from a very early age. As the age of puberty covers a wide range, any age of consent will be too high for some and too low for others. In any case, it is not sensible to choose one age when suddenly boys and girls are permitted to engage in heterosexual activities without fear of legal sanction. The ability of teenagers to make suitable judgements and control their impulses depends upon upbringing and education, not upon the law of the land.

The severity of the present laws affects relationships that cross the age of consent even when they are, in the ordinary sense, mutual. In the public mind, the legal term ‘assault’ that is applied in these cases probably suggests brief, violent encounters. In fact, the law, as well as prohibiting such undesirable sexual acts, may bring to a crushing end caring and mutual relationships of long standing, and some where the partners are close in age. Although in these cases, the ‘harm’ that the law is meant to discourage evades scientific discovery. The harm that flows from the law’s operation is all too evident.

Although it is both logical, and consistent with modern knowledge about child development, to suggest that the age of consent should be abolished, we fear that, given the present state of public attitudes on this topic, it will not be politically possible to abolish the age of consent. Accordingly, we propose a series of ages of consent, which would have the effect of reducing the harmful effects of the present laws.

i) A person aged 14 or over should be legally capable of giving consent.
ii) A person aged under 10 should be presumed legally incapable of giving consent.
iii) Where both partners are aged 10 or over, but under 14, a consenting sexual act should not be an offence.
iv) Where one partner is aged 10 or over, but under 14, the law should presume that consent was not present, unless it is demonstrated that it was genuinely given and the child understood the nature of the act.
v) As the age of consent is arbitrary, we propose an overlap of two years on either side of 14, so that, where the participants are aged 12 or over, but under 16, a consenting sexual act will not be an offence.
vi) The exception provided in S 6 of the Sexual Offences Act 1956 should be retained, with the amendment that a person be not guilty of unlawful sexual acts with a child under 14 if he is under the age of 21 (not 24, as at present), has not previously been charged with alike offence, and reasonably believes the other person to be aged 14 or over.

We are particularly concerned that the present review of the law should not introduce new restrictions where none exist at present. The ages of consent would therefore continue to apply only to girls participating in heterosexual acts, and to boys participating in homosexual acts.

[….]

Homosexuality

In the second paragraph of this memorandum, the blunt words of the Wolfenden Committee were quoted to support the proposition that people’s private morality is not the business of the law. That statement was made in that part of the Wolfenden Report which was specifically concerned with homosexuality. There is no logical or sensible reason why homosexuality should be treated differently by the law from heterosexuality. But the law discriminates against homosexuals – and mainly male homosexuals – in the following ways:

i) Homosexual acts between consenting adults in private, which became lawful in England and Wales after the Sexual Offences Act 1967, are still illegal in Scotland and Northern Ireland.
ii) Homosexual acts are still illegal in the Armed Forces and aboard UK Merchant ships.
iii) The age of consent for female heterosexuals is 16, but for male homosexuals is 21.
iv) The penalty for indecent assault on a male is a maximum of ten years, but the maximum for indecent assault on a female is two years.
v) It is illegal for a man aged over 21, to have sexual relationships with a man under 21, even in the reasonable belief that the younger man was over 21 and when the two men were close in age.
vi) The definition of privacy is more restrictive for homosexual acts.
vii) It remains an offence for a third party to procure a homosexual act, even though such an act is now quite legal. (This especially includes the publication of contact advertisements).
viii) It is an offence for a man persistently to solicit another man for an immoral purpose, but not for a man persistently to solicit a woman.
ix) Local bye-laws are used against homosexuals in a way that they are never used against heterosexuals.

These anomalies cannot be justified. Most of them were compromises made to facilitate the passing of the 1967 Act. It might have seemed to be good tactics at the time, but there is no logical reason for discrimination between these two forms of sexual behaviour.

At the very least, the same laws on sexual behaviour should apply throughout the United Kingdom. There should be no special prohibitions applying to the Armed Forces or the Merchant Navy. The definition of privacy should mean that a sexual act should not take place where it might be observed by others who might object. The age of consent should be the same for homosexuals and heterosexuals. The law on soliciting should be implemented without reference to the sex of the people concerned. No enactment of bye-law should prohibit conduct between persons of the same sex if it does not also prohibit similar conduct between people of the opposite sex. Penalties for sexual offences should be set at the same level for equivalent offences, whether they apply to male homosexual, or heterosexual offences.

Homosexual and Heterosexual Offences

It is not necessary to discriminate between homosexual and heterosexual behaviour in any of the laws regulating prostitution, brothel keeping, pornography, advertising for sexual partners, or in the application of any of the vague all-purpose common laws like conspiracy to corrupt public morals or breach of the peace.

We propose that the offences of buggery (S 12 of the Sexual Offences Act 1956) and assault with intent to commit buggery (S 16) be abolished. As the law [end p. 10] stands, a man and woman who have anal intercourse are both liable to a maximum term of life imprisonment, but the Sexual Offence Act 1967 allows a man over 21 to be lawfully penetrated and to penetrate another man over 21.

Importuning

Section 32 of the Sexual Offences Act 1956 re-enacts an older law which was originally intended to catch prostitutes’ touts or bullies, but has been used almost exclusively against male homosexuals. Indeed a recent judgment in the Divisional Court (Cooke v Edmondson, 1966) held that S 32 cannot be used against a man who solicits a woman. The law which prohibits homosexual conduct has been reformed, but this law on importuning is still the cause of much injustice.

Although the use of the word ‘persistently’ in the original wording of the Act suggests that the intention as to protect members of the public from interference or annoyance, the interpretation by the courts means that in practice the world of a plain-clothes policeman is usually accepted by the magistrate. In such a situation, it is not necessary to stress the possibility of exaggeration or perjury.

So fearful is the homosexual of the social repercussions that he can often be persuaded to plead guilty to lesser charges under a local bye-law on the promise from police of no publicity. A policeman is neither authorised to give such a promise, nor is he able to prevent publication of the proceedings in the press. It is not sufficient to argue that the penalties are comparatively light, for the ignominy that follows a conviction for importuning for homosexual purposes can still have a shattering effect on a man’s relationship with his family and friends, and on his circumstances at work.

As the law stands, it is not even necessary to show that someone has been annoyed or offended. The courts convict on police evidence alone, sometimes after doubtful means of entrapment have been used, such as an agent provocateur who incites a person to commit an offence. Someone who shows that s/he is available for sex by being in a certain place or by giving another person an enquiring look cannot be said to be acting in an offensive manner.

Soliciting only becomes annoying if it is directed towards the same person persistently and pressingly. The police should be required to produce the evidence of the person who has been persistently importuned. Consequently the law on soliciting should be amended to require that a person cannot be convicted of this offence unless it is proved that at least one member of the public (i.e. not a policeman) was offended by his or her conduct. It should also be a defence to show that the member of the public encouraged the soliciting.

As homosexual relations between consenting adults are no longer illegal, the existence of the offence of importuning or soliciting for an immoral purpose means that a person may be charged, convicted and punished for attempting acts which are not in themselves unlawful. All soliciting, from begging to high pressure salesmanship, can reach a stage when it becomes offensive, but it is doubtful if the public really requires extra protection when the soliciting is for sexual purposes.

Incest

For hundreds of years the crime of incest has given rise to such intense feelings of revulsion that public discussion on the subject has often been uninformed and irrational. The incest taboo is world wide and has a close connection with religious cults and magic. Recent researches (Maisch, 1973) cast some doubt on these historical and anthropological beliefs. The present day case against incest is firstly, that genetic damage may result in the offspring and secondly, that an incestuous union is disruptive to the cohesion of the family.

The first objection is strongly held, but recent studies on human reproduction do not give much support to this theory, and it is in direct contradiction to the practices of successful animal breeders. In any case, the advent of reliable contraceptives and safer abortion weakens this argument. As for the second objection, the evidence (Gebhard, 1965) suggests that families in which incest occurs between parent and child are often disturbed before it starts. To this extent, incest is not the cause but is one symptom of a disrupted family.

Although some of those charged with this crime are mentally or emotionally inadequate, this is not always the case, especially when the incestuous union is between brother and sister. In our view, no benefit accrues to anyone by making incest a crime when committed between mutually consenting persons over the age of consent. When force of threats are used, or when one of the partners is under the age of consent, the law on assault should come into operation.

We would therefore propose that the crime of incest be abolished. It may be argued, with some justification, that in cases of parent-child incest, undue pressure to consent could be placed on the child who is economically and emotionally dependent on the older party. This is just the sort of situation where bringing in the law could do immense harm to the child, the father and the rest of the family. A young person is far more likely to confide in a teacher, social worker or member of the family if this would not result in bringing down the full force of the law, with the possible outcome of the break up of the family with the father being sent to prison, the child having to appear in court and perhaps being put into care. There are many cases where the victim does not appear to suffer from any obvious psychological disturbance until after the case has come to court. It is often the publicity in the local press and the reaction of neighbours that is most damaging to the whole family.

Paedophilia

The strong emotions that surround the subject of paedophilia make it particularly difficult for justice to be done in such cases. Feelings of revulsion are often shown by parents, police, witnesses, magistrates and judges, and even by the lawyer briefed to defend the accused. In such circumstances, a wish for retribution can easily take precedence over a concern for the child’s welfare. Where the child was a willing partner in the sexual activity the strength of prejudice surrounding the case and the visible psychological effect on the defendant (who may have been a friend of the child) will be highly disturbing. Where the act involved force or was otherwise without consent, the need is to assist the child overcome the trauma, which may only be reinforced by legal proceedings.

Although clearly in the case of a genuine assault on a child, action has to be taken to protect other children from the offender, there is a growing feeling that the present legal system causes unnecessary suffering for the child victim of a sexual assault. In their report for the Institute for the Study and Treatment of Delinquency, Gibbens and Prince make the point that isolated events are unlikely to have any profound effect on a child who would probably soon forget about their experience if it were not for the significance given to it by parental concern and legal proceedings. They point out that several children appear to be undisturbed at the time they are required to give evidence in court, but later have a breakdown and become increasingly unsettled. It is important to realise that in some cases the child will have felt coerced into giving evidence damaging to someone s/he was fond of, and will at the same time have had his/her feelings of sexual guilt raised to a high pitch.

The lay person is often unaware that an ‘indecent assault’ in law can be committed without violence or physical harm being done to the child. A man can be convicted of an indecent assault without there being any physical contact with the child’s genitals; thus, putting a hand on a child’s thighs can be an indecent assault. Virkkunen (1975) studied a group of 64 paedophiles and reported : ‘Aggressive behaviour was not as a rule a characteristic of these offenders: on the other hand they seemed to be in a pronounced manner gentle, fond of children and benevolent.’

Parents, police and lawyers find it hard to believe that the child may actively seek the sexual relationship. Bender and Blau (1937) report : ‘This study seems to indicate that these children undoubtedly do not deserve completely the cloak of innocence with which they have been endowed by moralists, social reformers and legislators . . . frequently we considered the possibility that the child might have been the actual seducer, rather than the one innocently seduced.’ Other researchers (Gibbens, Virkkunen) agree that the children often take the initiative; some of them have sexual experiences with several adults.

Childhood sexual experiences, willingly engaged in, with an adult result in no identifiable damage. The Criminal Law revision Committee should be prepared to accept the evidence form follow-up research on child ‘victims’ which show that there is little subsequent effect after a child has been ‘molested’. Several researchers (Gagnon, 1965; Gibbens and Prince, 1963; Tolsma, 1957; Doshay, 1943) have shown that it is possible to exaggerate the damage done to the child. Bender and Grugett (1952) write: ‘Modern psychiatric follow-up studies of a sizeable series of individuals who as children had known these types of sexual experiences have not disclosed any directly adverse effect of the early incidents upon later social adjustments’. A large number of people (one researcher estimated it to be about one third of all children) have one or more pre-pubertal sexual experiences with an adult. So at least some of the readers of this report should ask themselves whether their early sexual activities with an adult have resulted in any unfortunate after-effects.

As many male paedophiles are attracted to boys, there is a fear that the boy who has sexual relations with an adult man will grow up to be a homosexual, but again there is no evidence for this. Rainer (1960) writes : ‘Homosexual seduction in itself was not found to determine homosexual behaviour, nor deter heterosexual behaviour’. Coon (1957) writes : ‘To assume categorically that these relationships are going to be traumatic for the boy is prejudgment of a type which certainly has no place in dynamic psychiatry’. The Speijer Report, recently produced by the Dutch Council of Health for the Ministers of Justice and of Social Affairs, concluded that homosexual experiences might benefit boys who later would live heterosexual lives, in the same way that young male homosexuals could only benefit form sexual experiments with both girls and women.

There is little doubt that a law court can be an alarming place for a child. During a trial on indictment the number of people present in court may be thirty or more, not including ordinary members of the public. A child is apt to be overwhelmed by the formality of the court. Although many of them will have seen court scenes on television, recognition of a familiar scene will be offset by the fear that their words may be twisted by a clever lawyer. The circumlocutions of lawyers can be confusing for a child, even when the lawyer is not directly challenging the child’s evidence. If the child has been a willing partner in the offence, s/he will know that retribution can be avoided by claiming to be an innocent victim – which is what parents and others will want and expect to hear. Furthermore, the child will be required to repeat the story to parents, police (sometimes more than once) and then in court, with the risk that the child’s memory may become faulty and that details may be elaborated.

It is important that courts dealing with paedophilia should arrange to have the child’s evidence given in court at second hand, unless this is unfair to the defendant. If the statement from the child is not disputed, it can be treated as evidence. Where the defence wants to cross-examine the child, a magistrate can see the child with one representative form either side, but following less formal procedures than in a courtroom.

This suggested change in the law is merely a palliative. The real need is a change in the attitude which assumes that all case of paedophilia result in lasting damage. The present legal penalties are too high and reinforce the misinformation and prejudice. The duty of the court should be to inquire into all the relevant circumstances with the intention, not of meting out severe punishment, but of determining the best solution in the interests of both child and paedophile.

[Texts referred to in the above]

Lauretta Bender and Abraham Blau, ‘The reaction of Children to Sexual Relations with Adults’, American Journal of Orthopsychiatry, 7, 500-518, 1937.
Lauretta Bender and Alvin Eldridge Grugett, ‘A Follow-up report on Children who had Atypical Sexual Experience’, American Journal of Orthopsychiatry, 22, 825-37, 1952.
Earl A. Coon, ‘Homosexuality in the News’, Arch. Crim. Psychodynam., 2. 843-65, 1957.
L.J. Doshay, The Boy Sex Offender and his Later Career. Grune and Stratton, 1943
John Gagnon, ‘Female Child Victims of Sex Offences’, Social Problems, 13, 176-92, 1965.
T.C.N. Gibbens and Joyce Prince, Child Victims of Sex offences, ISTD, 1963.
J.D. Rainer, A. Mesnikoff, L.C. Kolb and A. Carr, ‘Homosexuality and Heterosexuality in Identical Twins’, Psychosomatic Medicine, 22, 251-9, 1960.
F.J. Tolsma, De Betekenis van der Verleiding in Homofeile Ontwikkelingen, Amsterdam Psychiatrical Juridical Society, 1957.
Matti Virkkunen, ‘Victim-precipitated Paedophilia Offences’, British Journal of Criminology, 15, April 1975.


PIE – Documentary Evidence 7 – Steven Adrian Smith’s History of the Movement

Various people looking into the Paedophile Information Exchange have mentioned the volume Warren Middleton (ed), The Betrayal of Youth: Radical Perspectives on Childhood Sexuality, Intergenerational Sex, and the Social Oppression of Children and Young People (London: CL Publications, 1986). This book contained a wide range of articles mostly from a pro-paedophilia point of view either by PIE members or sympathisers; the fact that Peter Tatchell contributed a chapter has been the subject of various controversy (to which I will return in a later post). The following constitute the contents of the volume (see here for a selection of pages including more details on contributors):

Part One: Five Controversial Areas
Clive Coliman, ‘Incest’
Richard Green, ‘Child Pornography and Erotica’
Warren Middleton, ‘Child Prostitution’
Liz Holton and Kathy Challis, ‘Gender Differences’
Eric Presland, ‘Power and Consent’

Part Two: Miscellaneous Chapters
Tuppy Owens and Tom O’Carroll, ‘Love and Let Love’
Michael Ingram, ‘Children and Sex: A Child Counsellor’s View’
Beatrice Faust, ‘The Pedophiles’
Peter Tatchell, ‘Questioning Ages of Majority and Ages of Consent’
Roger Moody, ‘Ends and Means: How to Make Pedophilia Acceptable…?’
John Lindsay, ‘Socialism, Class, and Children’s Rights’

Part Three: Protection or Oppression?
Warren Middleton, ‘Childhood Sexuality and Pedophilia: Some Questions Answered’

Part Four: How Youth See the Issues
Jeff Vernon, ‘The Oppression of the Young: An Inside Perspective’

Appendices
Appendix 1: Steven A. Smith, ‘PIE, from 1980 Until its Demise in 1985’
Appendix 2: Timothy d’Arch Smith, ‘The Uranians’

The first of these two appendices is informative as an insider’s history of PIE. As with all writings by PIE members themselves, this should be read sceptically, aware of how much might have been omitted or distorted in the interests of the author or other members. My earlier post on PIE and the Home Office clarifies how Smith (also known as Steven Freeman) essentially ran the organisation from the Home Office itself. He fled the country for the Netherlands soon after writing this article, as detailed below, and was eventually jailed in 1991, and then more recently was given an indeterminate sentence in 2011 after being convicted of producing drawings of children being raped (‘Ex-paedophile group leader Freeman jailed over child rape drawings’, BBC News, July 15th, 2011). Nonetheless, there is clearly lots of important information to dissect in this chapter which I reproduce complete, without comment, below.

Appendix 1
Steven A. Smith, ‘PIE: From 1980 until its Demise in 1985’, pp. 215-245

The name of PIE has cropped up several times in this collection. Since the group had, in its time, been so thoroughly misunderstood and misrepresented, it was deemed only fair to allow Steve Smith, its last chairperson, an opportunity to redress the balance. Accordingly, he now takes up the story from where Tom O’Carroll left off. –ed.

Questions of Priority

It seemed to me, when I succeeded O’Carroll as chairperson in 1979, that the most sensible order of business for PIE was firstly to regulate its internal affairs (MAGPIE [1] was appearing very erratically – partly my own fault – and members were receiving nothing else of value from the group); secondly to begin an energetic recruitment drive to replenish our depleted executive committee; thirdly to formulate collectively a coherent body of policies on key issues; and fourthly to tackle our campaigning objectives as a group, rather than as one or two individuals speaking on behalf of the group. More than simply addressing an occasional CHE branch, student gaysoc or academic conference, what I wanted to see was PIE producing a manifesto on video for the widest possible circulation (as GYM had done), or trying for ‘community access’ slots on TV and local radio, or producing posters and broadsheets aimed at the public rather than potential members, or even working in concert with the NUSS (the now-defunct National Union of School Students) to redress the steady flow of anti-paedophile propaganda which the police were imparting to schools all over the UK.

PIE had always felt a sense of kinship (not often reciprocated) with the gay movement, and a firm commitment towards autonomous youth liberation (children’s rights), but I wanted to see develop a far closer interaction – on practical as well as philosophical levels – between PIE and the various paedophile groups in Europe and the States. I felt we should lend considerable effort to the formation of an international alliance along similar lines to the International Gay Association (this was before we discovered how bureaucratic the IGA was in practice). Lastly, with the abandonment of PIE’s Contact Page under the menace of further prosecutions, the EC felt very keenly that members still needed something from PIE in the way of social support; something beyond the ad hoc counselling which many committee members undertook on a one-to-one basis. If British law prevented paedophiles from writing directly to one another through a simple small ad service, then some alternative had to be found which would abrogate the profound isolation which had driven them to the desperate resort of joining PIE in the first place. We began to look afresh at the establishment of local groups, which PIE had attempted in earlier years without much success.

In the event, PIE failed to draw onto its committee the kind of radicalised, hard-working people that were needed, and not one of the above objectives was realised. Year by year, PIE had sunk deeper into a state of collective torpor, grimly determined to survive, if only in catatonic immobility. So, we failed to attract into PIE useful paedophiles who were commited [sic] both to political action and to the development of a mutual support framework – this was due in part to PIE’s consummately negative image in all quarters (the radical leader was quite as easily duped by the press stories about us as anyone else, judging from the strange impressions of PIE that had reached our ears), but due also to obstruction and non co-operation wherever we sought wider publicity for the group’s address. Many gay and alternative journals must share the blame for PIE’s then continued parlous, debilitated condition. I’m convinced there are still many thousands of paedophiles in the UK alone who are ignorant of PIE having ever existed, and I know for certain there are many others who saw the various ‘exposés’ and shock reports about us, but were thwarted in their efforts to find us.


Perspectives on Pearl Harbour

A former treasurer, on resigning from the EC, put it to me (though not quite in these terms) that PIE’s reputation across the board had become so desperately negative that the groups’ mere existence could only harm the paedophile cause, whatever we tried to do about it. We were a pariah among alternative movements, evil incarnate to society at large, and by continuing to exist so doggedly in the face of all opprobrium, PIE was doing for British paedophiles what AIDS was doing for the gay community. A harsh judgement, I feel. If AIDS had not existed the Moral Majority would’ve had to invent it. If PIE had not existed, it would have been necessary for the NEWS OF THE WORLD to invent us. And in one sense it’s true to say that the gutter press did invent PIE – or at least, the image of PIE which had been in general coinage since 1977; that of a secretive international ‘cult’, probably with underworld connections, certainly with influence in ‘high quarters’; a porn-producing syndicate of callous men intent upon nothing but their own sexual gratification. But if PIE’s early strategy had been different, how different would its public image have been?

Several times the idea of folding PIE and replacing it with a new paedophile grouping was mooted on committee, but we’d never have successfully jettisoned PIE’s reputation by the simple expedient of a name-change, and even a substantially different alignment would not for long have escaped the vitriolic attention PIE had enjoyed. This rose by any other name would have smelled no sweeter. There was nothing endemic in PIE itself which another broad-based group could have avoided and thus somehow bridged the ‘credibility gap’. NAMBLA in the US, for example, has placed its emphasis exclusively on gay paederasty (men attracted to teenage boys and youths), thus neatly sidestepping the two most controversial planks of PIE’s platform – heterosexual and pre-teen paedophile relationships. Notwithstanding this, NAMBLA has been attacked, boycotted and obstructed every bit as much as PIE had been by the media, women’s groups, sections of the gay scene, and has come in for just the same intimidation and harassment from the authorities. So much for tactical compromise. PIE’s trajectory into the public eye in 1977 can be compared to the Japanese attack on Pearl Harbour, after which Admiral Yamamoto observed: “I fear that all we have done is to waken a sleeping giant and fill him with a terrible resolve”. Doubtless, many paedophiles wish we’d let this particular giant sleep on, but neither they nor children can be liberated from his tyranny without at least waking him in the process.

The conflicting demands of our campaigning and befriending objectives from the start presented a fundamental dichotomy in PIE. What for years we viewed as one of PIE’s greatest strengths may in truth have been its greatest weakness, or at least its greatest liability; our acceptance into the group and onto its Executive Committee of paedophiles, whatever their attitudes, abilities or political persuasion (with the exception of the far Right, of course). By straining to be all things to all paedophiles I doubt that we fully satisfied any, and we certainly alienated a few. There is a very powerful argument which runs thus: that the accommodation of a passive, inert membership consumes so much of the energies of a small group’s activist core that the raison d’être of the group is lost in a sea of ‘club-shit’. In other words, committee devoted so much of its time and attention to the routine of organisation and providing reading material and other services for consumption by the Moloch that vital campaigning work was neglected. After six years hard labour on the PIE committee I can only say that this was absolutely true.

Probably the only way ahead for paedophilia in the UK will be the emergence of two distinct groupings – though working in concert – attending to these differing needs. I for one did not wish to see the majority of paedophiles abandoned while the few activists diverted their attentions elsewhere, as some would have had us do, but equally I recognised that our political momentum had been retarded by a plague of part-time paedophiles – those who wanted to know what was going on without getting involved any deeper; who wanted to see changes made but not to help bring them about. PIE’s committee did not comprise many true activists anyway – it never did – so it alone did not have the capacity to diverge, and the very few paedophile activists who could be identified outside the group showed no interest in helping the metamorphosis come about.

Perhaps PIE’s mistake was in tackling non-paedophile prejudice in the first place? Perhaps instead we should have operated under the most stringent security precautions as a kind of Masonic network through which paedophiles might have contacted one another in safety? I’ve heard this view from outsiders. I don’t think that locking oneself in the closet would have been a terribly progressive move; by its nature such a network would have benefited only a tiny minority of those ‘in the know’, and the outside world would have been vindicated in its suspicions about us if we had behaved so furtively and were so indifferent to public opinion and the political imperative of children’s liberation.

The most bizarre misconception about PIE was held by a guy who later joined the committee for a short while – Lee Edwards. He’d visualised PIE being as affluent and neatly-organised as the Mormon Church, with smoked glass offices in the City of London and a full-time secretariat. He was, let’s say, a shade disillusioned by the reality. PIE did actually have an office in Westminster only a smirk away from the desk of the Home Secretary, but more of that later. The group’s silence in recent years had done nothing to dispel the illusions of people – friend and foe – about us, but then Pie itself had been undergoing an identity crisis of sorts, uncertain about which direction it should be taking. But one thing is quite certain – if we were none of the things people expected us to be, we were certainly none of the things the press had claimed us to be in their haste to deceive the British public.


Loaves and Fishes

I found PIE in 1978 entirely by accident through a classified ad in TIME OUT magazine. Many others came to us through a regular listing in GAY NEWS. However, both sources of new blood had been closed off long before the trial. [3] Occasionally, we would discover a listing in some unexpected place, inevitably giving an old address, but in general PIE was unable to get a listing in any gay or alternative paper in the UK. After the trial we attempted to retrieve this situation by a general approach to dozens of such papers here or abroad, asking for either free listings or concessionary advertising rates. A special appeal was made to the membership for donations to fund this advertising drive. MANCUNIAN GAY was the only paper in the UK willing to help us. Abroad, our ad was accepted without qualm by THE BODY POLITIC (Toronto) and GAY COMMUNITY NEWS (Boston) – both excellent gay papers whose unequivocally supportive stance on paedophilia put the faint-hearted GAY NEWS to shame – also by REVOLT (Sweden), CSC NUSLETER (California) and several others. But where we needed members most of all, where members were potentially of most value to the group, here in the UK, the drive got us nowhere. TIME OUT kept our hopes up for several months with repeated promises of a listing, but finally backed out with the feeble excuse that, as PIE wasn’t strictly a gay group, it was inappropriate to include us in a gay listings column. The only option left to us – a rather desperate one – was to litter PIE’s address around the streets by means of a sticker campaign, and this is what we did.

The sticker featured the silhouette of a standing child embracing a seated adult encircled by our name and address. We decided on this low-key format, foregoing bold and provocative slogans, as the object was simply to attract new members, not to outrage every parent that saw them. Even so, we were politely requested by one (prospective) London MP to desist planting them in his constituency (they had been discovered rather close to schools, you know!). Well, the campaign brought us just a handful of new people – too few members had been planting the stickers on a regular basis for fear of being caught red-handed and beaten up; those that were planted were being far too eagerly torn down; and worst of all one committee member made the terrible gaffe of not renewing the postal address on the sticker, so that later mail was never redirected to us at all. Perhaps the act of planting stickers, like writing political graffiti, is little more than a satisfying gesture of defiance for the individual, but I think we made a mistake in not concentrating our efforts on a far smaller area – probably London itself – and perhaps, if there had been a next time, we should have gone for those bold, provocative slogans.

There were a number of projects in various stages of completion during this period – none of which had any significance to non-paedophiles. The PIE Press Service was revived, making available once more all PIE’s early material (UNDERSTANDING PAEDOPHILIA and CHILDHOOD RIGHTS, for example) together with items like Tom’s book PAEDOPHILA: THE RADICAL CASE, [4] which PIE subsidised to its members; the early US boylove magazine BETTER LIFE; and the celebrated BODY POLITIC article ‘Men Loving Boys Loving Men’ [5] (which has been subjected to not one, but two trials of its own). We owe thanks to Julian Meldrum of the Hall Carpenter Archives for supplying us with much early PIE material. So many important documents were lost whenever Scotland Yard descended on the homes of committee members that arrangements were made with the Brongersma and Bernard Foundations in Holland to deposit copies with them for safe keeping.

A reading list of paedophile fiction was added to the press service, complied by Lewis Grey, David Joy and Leo Adamson, and later a non-fiction list condensed by Tom O’Carroll from the copious bibliography of his book. Work was also begun on a film guide and on a survival guide for paedophiles in the UK.

A growing number of our members were captives in US prisons. Coping with the special needs of these people prompted us to set up a prisoner support scheme which, under Peter Bremner and later Tony Zalewski, found correspondents for these prisoners and sought sponsors to cover the expenses of their membership, mailing them recommended books and items from the press service. It hardly needs saying that our attempts to operate the scheme with inmates of British prisons were scotched by this country’s Draconian censorship restrictions. Mail from US prisoners often carried an apologetic stamp on the envelope which read: “Prisoners’ mail uncensored. Not responsible for contents.” I look forward to the day when British prisons need to be so apologetic – I had a long and fractious correspondence with the governor of Wormwood Scrubs over the confiscation of several letters of mine and other items sent to Tom O’Carroll. As with all things in the US, prison regulations vary wildly from state to state, so while some members were receiving regular visits from the boys for whose ‘protection’ they had been imprisoned, others were not even permitted to receive MAGPIE. NAMBLA was far better placed than we were to defend the interests of these people, and is now doing so. PIE was powerless to help prisoners in the UK without some referral arrangement with the social services, and the Home Office lifting restrictions on visits and correspondence.

Given the monstrous treatment of many paedophiles in prison, and the squalid, dehumanising conditions that prevail throughout the prison system, it is a marvel to me that people can emerge from this ordeal without a deep and burning animosity towards the society that abused them so. Imprisonment is the grossest indecency.

If there was one venture that I expected to be an unqualified success and firmly supported by the membership, it was the re-establishment of social meetings through local group organisers. This was the sort of freedom which other oppressed groups – blacks, gay men and women, and many more – took entirely for granted. Any attempt by PIE to arrange social venues (this applied equally to workshops, AGM’s, marches and demonstrations of any kind) carried with it the implicit danger of press harassment, police observation, and physical attack from fanatics of every species. Accordingly, such precautions had to be taken to insulate these meetings from the hostile gaze that the people who had most need of them – frightened, solitary people with zero political awareness – were the last to be invited to them. Where possible, committee members attempted to meet new people in order to establish their bona fides, but there was always a substantial part of the membership who could not be directly vouched for, and we knew there was an agent of the NEWS OF THE WORLD among them.

Having an EC member in Birmingham, the first step was to organise meetings in this area for members in the midlands. Several meetings took place, but then the host was arrested and sent to remand prison on an unconnected charge, and interest petered out. With my help, an Australian member attempted to generate support for a PIE branch in his country (we had more members in Australia than in Scotland and Wales together), but the majority of those approached preferred to keep the breadth of the globe between them and the kind of flak which PIE attracted. This was not too surprising when one learnt that an earlier bid to establish an independent Australian paedophile group – SYBOL – crashed when a conservative gay group threatened to hand the organisers’ names and addresses to the police. Plans for a Canadian branch of PIE went awry also, but happily NAMBLA was able to establish a chapter there soon after.

Our greatest concentration of members had always been in London and the home counties. All but a handful of PIE’s workers through the years had lived there. From August ’82 we booked a private room one night a week in a series of West end pubs, inviting along all members who were known to us. The average attendance was very disappointing: always the same few faces. Presumably, everyone feared that a press plant would be present, as had in fact happened once before in 1979: A known freelance operating for the NOTW, had turned up half drunk at one pub meeting and begun asking those present to procure boys for him. “I know there are kids around who’ll go with you for money,” he said, “but where are they? Why don’t we do something instead of just sitting here?” No such investigative journalist graced any of the more recent meetings. TIME OUT reporter, John Gill, came along once or twice, but he was there at our invitation, preparing a feature on the anxieties and expectations of paedophiles living in London (a feature subsequently suppressed by the magazine’s editors). Other guests present at those meetings included many GYM members and one or two representatives from CHE – one of them a woman who was entirely supportive. Discussions with these people were on the whole constructive and stimulating, and made the meetings worthwhile for us on the EC, but the objective of a social forum for members outside the committee was never realised.


Babel Wasn’t Built in a Day

In August 1980 PIE circulated an open letter among every known paedophile group in Europe, Scandinavia and North America, and also to prominent individuals such as Dr. Edward Brongersma, Dr. Frits Bernard, Drs. Theo Sandfort, and Valida Davila of CSC (Childhood Sensuality Circle). The letter outlined an ambitious, some would say grandiose, proposal for a new transnational paedophile federation through which member groups would collaborate on material projects and share resources at the same time as working towards a common philosophical platform. As I wrote in MAGPIE 15, “Much more than a simple mutual aid society, such a federation would be the consolidation of a coherent international paedophile and children’s liberation movement out of the present chaos of tiny national groups working largely oblivious of one another”. This initiative was very much a personal commitment of my own – my committee colleagues were not all so inspired by this euro-vision. I had learned through PIE that there were groups in Denmark, Germany, Sweden, Switzerland, Portugal, Belgium, yet we knew virtually nothing about these people and their organisations, what they were doing in their own countries, or how their political analyses differed from that of PIE. Any contact we had established had been of a token kind, genuine in spirit but superficial in practice, so it was safe to assume that these groups were in the same state of ignorance about us. It seemed important to me that a full and penetrating dialogue be established at least with the strongest of them.

Inevitably, there were language obstacles. We mustered a few members to translate from French, German and Dutch for us, but although our files were brimming with magazines from these groups we could hardly ask people to translate whole magazines, and in any case one could not always rely on forming an accurate view of a group’s thinking merely by reading its general literature. (There had been no language barrier for Tom O’Carroll when he represented PIE at an Oslo conference ‘Amnesty for Love and affection’ hosted by the Norwegian group, NAFP, in 1979. There had even been discussions there on forming a new, broad-based international group called ‘Amnesty for Child Sexuality’, but nothing had come of this.)

The Open letter included a proposal for an early ‘summit’ conference of interested groups to discuss the general concept of an IGA-type alliance, and areas of practical collaboration between us. The most enthusiastic responses we received came from people and groups who had least to gain from the proposed alliance: “I am in complete agreement with your plans,” wrote Valida Davila; “Some people are ruined by oppression and persecution, and others are fired to fight back. I see your committee has chosen the latter road.” “We think the idea of an international association for paedophiles excellent,” wrote REVOLT of Sweden; “If there is anything we can do to support, never hesitate to ask.” Pasteur J. Doucé of the Centre du Christ Libérateur, Paris, wrote: “If I can be of any help in the formation of an international paedophile fellowship please let me know.” An anarchist commune for young people in Nuremberg, the Indianner, said that although they had deep reservations about the German group, DSAP, they still wished to “join a basic form” with us.

The groups themselves were not prepared to take a lead. They wanted to see PIE set up the conference itself. What better demonstration of the poor grasp our friends had on the political realities for PIE? We were possibly the only group among them which was unable to hold a general meeting for its own members without grave risk of injury to those attending, and prosecution of the organisers. After the events of 1977 for PIE, did anyone seriously expect an international paedophile conference to be permitted in the UK? NAMBLA chose to “wait and see what leadership develops on these concepts”. The paedophile wing of the Dutch civil rights umbrella organisation, NVSH, felt that their priorities should be domestic, and that international co-ordination should be left to the auspices of the IGA itself. NAFP in Norway “sympathised” but wanted “more concrete ideas”. [6]

The first months of the following year saw the emergence in France of a new paedophile organisation – the Groupe de recherché pour une Enfance Différente – and four of us from PIE sped along to its inaugural congress in November. Also present on that occasion were David Thorstad representing NAMBLA, Frits Bernard representing DSAP, and a member of the Belgian Paedophile Studygroup [sic]. The atmosphere at that opening day was something I had not experienced before even at PIE’s 1978 AGM – an intensity, an electric urgency of expression that welled as much from the floor as from the platform. The strength of the GRED committee was plain to see, as one after another they all addressed the meeting with equal vigour and self-assurance, and everyone it that packed hall (including, to our delight, a handful of women paedophiles) was involved, not quietly receiving the transmitted wisdoms of the committee. With the promise of an imminent reduction in France’s homosexual ‘age of consent’ from eighteen to fifteen, the liberation of children was for these people far from a remote utopian objective.

I came away from that conference profoundly frustrated, both with the inadequacy of PIE and my own inadequate French. I went to listen, but came away having understood little that I’d heard. I went to contribute my views, but came away without having said a word. I went to take part, but was obliged merely to observe. It’s not entirely unreasonable, of course, that a French group meeting in France should conduct its meeting in French, but I had rather hoped that, at least in the workshop on international collaboration, some concession would be made to a humble Anglophone like myself. Unfortunately, GRED’s English was only a little better than my French. One might think such a lesson in futility would have made me reconsider the practicality of collaboration on the level suggested by the Open Letter but, on the contrary, I felt all the more keenly how much we had to gain from a close dialogue and mutual co-operation with people such as GRED. If we left them with a rather poor understanding of PIE and what we had to deal with over here, that was entirely our own fault, of course, but even among the extrovert committee of GRED, and in its journal, PETIT GREDIN, there was a hint of the same parochialism displayed by the NVSH paedophiles and others, confining their analysis of the problems and solutions within national boundaries. Perhaps PIE was unique in this respect – that more than half our membership lived abroad, scattered among twenty or so countries, and it was plain to us that the ignorance and intolerance of paedophilia knew no frontiers, as with the inhibitory myths of childhood. While the police and the agents of ‘moral’ conformity were concerting their efforts internationally against us, would we not even collaborate in our own defence, if for no better motive?

Another item under preparation for the PIE Press Service at that time was a comprehensive directory of paedophile/children’s liberation groups – the first such guide ever to be published in the English language, filling in a little detail to that cold, unwelcoming expanse of acronyms: SAP, DAP, DSAP, PAC, AKP and so on. Questionnaires were distributed hot on the heels of the Open Letter, and the information that came back immediately helped to dissipate our own ignorance a little. We discovered, inevitably, that some of the groups had already collapsed. In Germany, for example, the Deutsche Studie und Arbeitsgemeinschaft Pädofilie had disintegrated over an ideological clash between anarchists, conservative reformists, and revolutionary socialists – notably about the nature and extent of freedom it wished to seek for young people. Blackmail threats had come into play here too, as with SYBOL in Australia, but this time one paedophile against another, to the utter damnation of those that made them. NAFP in Norway also, sadly, dissolved. And for each group that vanished another would suddenly appear elsewhere on the map – Stiekum in Belgium, for instance.

At the GRED conference it was agreed that the groups represented there would all follow NAMBLA’s example in joining the IGA itself and through it lobbying the gay movement directly for firmer support. The extent of our links with the gay political scene was an essential aspect of PIE’s strategy (insofar as PIE had such a thing) which I want to consider separately but, in the absence of a constructive dialogue with gays (or anyone else) in our own country about the radical means to accomplish our short and long term objectives, other paedophile groups abroad remained the only people from whom alternative strategies could be learned, our own analysis refined, different perspectives examined. Practical alteration to the law and its institutions is an objective necessarily specific to one’s own country, but awakening a whole culture to the living realities of sexuality and of youth is the promulgation of an idea, a new system of living, and is not confined to the arbitrary frontiers of states.


Prodigal Son? _ Or A Cuckoo in the Nest?

1983 was the first time in PIE’s nine-year history that a handful of members carried a PIE banner at the London Gay Pride march. The banner read simply: ‘Adults Loving Children loving Adults’ – a bisexual extension of the famous BODY POLITIC caption. This bold initiative was largely due to the efforts of one EC member, Leo Adamson, who, in a very short time of involvement in PIE, had propelled the group a deal closer to the gay movement than it had been for a considerable while. As a member of GYM (Gay Youth movement), Leo was able to speak for PIE at their annual conference ‘Gym’ll Fix It’, and he also took an active role in the group’s lobby of Parliament. In July ’83 he represented PIE at the IGA conference in Vienna. One could say that PIE had waited a long time for individuals with Leo’s stamina and conviction to come along and fulfil this vital liaison role.

Eric Presland, writing in CAPITAL GAY, [7] rejoiced in the appearance of PIE’s banner at the Gay Pride march, and bade us a hearty ‘Welcome back!’ While there was no doubting the sincerity of Presland’s support for PIE, nor his personal commitment to the liberation of children, there was an assumption behind his remarks that PIE had somehow drifted away from the gay movement in recent years, had now seen the error of its ways and returned – like the prodigal son – to its spiritual home. But it was not PIE that moved away from the gay movement in the UK, it was the gay movement that moved hastily away from us once the muck began to fly; and not because it viewed PIE as too reformist, sexist or reactionary – these tags were slapped on us much later – not because our proposals were insufficiently radical; they were too radical by half for the majority of gays. If we had concentrated, as NAMBLA had done in the US, simply upon sexual relationships between men and teenage boys, gays might have been rather more sanguine about solidarity with us. We were not prepared to barter away the interests of so many paedophiles and of pre-teenage children to realise that support.

If anything, the political leaning of the EC had become further to the Left than ever before, though unfortunately there was no output from PIE to attest to this. Committee may have been radical in its sympathies, but was singularly reticent to express this thinking through MAGPIE or CONTACT. [8] Repeatedly it was put to them that committee should buckle down and talk through some coherent policy positions on key questions – I prepared a discussion paper on pornography to set this process going – but there was no enthusiasm at all for the hard graft of policymaking. Little wonder then that Pie was seen as complacent and insular when it could not produce a single political position or line of analysis to promote wider debate. Those people who troubled to look for evidence of PIE’s philosophy or political credentials were left to glean what they might from the tone and content of MAGPIE, or from documents published years ago by a very different EC – the ‘Questions & Answers’ booklet [9] and our ‘Evidence to the Home Office Criminal Law Revision Committee’. [10] I don’t think there was anyone active in PIE at this time who was happy with the proposals contained in the ‘Evidence’ paper; many would have liked to see them publicly rescinded. All in all, if gays regarded PIE with some suspicion as being an unknown political quantity we had no-one but ourselves to blame for that.

“I don’t think the time is yet read,” wrote an editor of REVOLT in answer to our Open Letter, “for a great association that would support both gays and paedophiles. There are still too many prejudices in the various camps, and paedophile liberation has some very specific aspects which certainly would be overlooked (or neglected) in a general gay association.” I entirely agree with that view. Whereas those paedophile groups that had sprung initially from the gay movement (PIE, NAMBLA, GRED) had tended to survive without the umbilical intact, those which tried to submerge back into the gay movement, becoming just one of several special interest groups within it, (NAFP for example) expired in the process. It is manifestly obvious that the struggles and obstacles faced by paedophiles in the UK today, and indeed the major arguments marshalled against us, bear a striking resemblance to those which gays themselves were confronted with a scant few decades ago. Many of the tasks that face us are the same – combatting the monolithic heterosexuality of ‘educational’ propaganda, for one – and there is great scope here for joint action, but our demands of society are far from being identical, and nor are they at the same stage of accomplishment.

To pluck a metaphor from the mouths of our critics, in any relationship between paedophiles and gays, it is gays who are demonstrably the stronger partner, far greater in size and power, their social status much higher. In contrast, paedophiles are weak, vulnerable, and – as a political force – lacking in experience, our status just about the lowest there is. Can true equality ever be realised in such a relationship? Will gays not simply abuse their power advantage to silence or control paedophiles? Does the gay movement really care about the needs and aspirations of its younger protégé?

Well, you may be sure that PIE did not endorse that kind of negativistic approach. The assumption that the strong will tend inevitably to exploit the weak is true of fascists, not of sexual groupings. I believe that the gay movement in the UK neglected PIE’s struggle to establish a discrete paedophile consciousness, as it has largely neglected the predicament of gay people younger than sixteen or seventeen. From its position of comparitive [sic] strength it had much to offer us by way of philosophical analysis as well as options for positive action. Instead, we found ourselves forced consistently onto the defensive, perpetually having to justify our very sexuality, to avouch our responsibility as caring people. We were nothing beyond a coffee-table controversy to most gays, and our demands for acceptance and support were given barely more credence here than that which society gives to demands for gay equality. I’m afraid the movement itself has much to answer for the continuing misery and frustration gay children in this country are compelled to endure.

It was a measure neither of PIE’s ineptitude, nor of the political vacuousness of British paedophiles, that so few radical activists materialised among us. It was rather too facile to apply to us the logic of gay and feminist activism, as though the realities were no different for a paedophile coming out in a militant way. Every risk that a gay or lesbian accepts in entering a career of sexual politics, on whatever level, is multiplied many times for a paedophile doing likewise. It is a simple equation of greater risks equalling fewer volunteers. Beyond this rather elementary observation, it is in the nature of paedophilia that the greater number of us will channel their whole energies into working with and for children (however misguidedly), whether this be as youth workers, teachers, nurses or, yes, as scoutleaders. Individuals who would have been of immense value to a group such as PIE either never contemplated joining because their attention was squarely focussed on working with the young, or shied away from deeper commitment for fear the publicity would disable them from continuing such work. True, many of these people themselves inadvertently abet the social conditioning of youth, but they are sincere in the belief that their work is beneficial and constructive. The essential point is that a paedophile’s natural first loyalty is to children – not to other paedophiles.

Unlike gays and feminists, who seek the company of people like themselves for social and sexual reasons, and then develop a political consciousness within that society, drawing strength from their community for ‘coming out’ and embarking on political work, paedophiles do not tend to gravitate so readily into one another’s company, (those that would have no means of doing so, of course) and the breeding medium for radicalisation is so much less fertile for this often-overlooked reason. In the company of a thirteen year old boy one can learn a good deal about the realities of powerlessness and dependence and the frustration of being thirteen in this society – all the more so from a girl – but this is a long way from assimilating a commitment to political struggle. The younger the children a paedophile seeks for company, the more this argument applies.

Thanks in large part to PIE, some paedophiles did befriend one another, but all too often in such meetings the differences of perspective were more apparent than the congruences. There was a commonality of interest without a commonality of awareness. Therefore among paedophiles this consciousness has to be cultivated in an altogether more deliberate and artificial way. Those paedophiles who regard themselves (sometimes mistakenly) as the most revolutionary are generally those that move largely in gay circles. Undoubtedly, coming out as a paedophile via the gay movement increases one’s exposure to radical though – though anyone acquainted with CHE might laugh at this – but it may also leave one with a smug and false sense of security.

While my own sexual tastes extend to eighteen or nineteen year old guys, I confess I never had much inclination to join a gay group or frequent any gay clubs. I think my perspective might have been rather less parochial if I had, but this is to illustrate that there are many paedophiles like myself who wish to work in close harmony with gay society, not to join it. To those who say, “So why didn’t PIE make more effort towards a rapprochement with radical gay groups?” I reply, “Why didn’t the stronger, more numerous, and better-equipped gay groups approach PIE with advice, criticism, active support, even when we were reeling in the wake of an Old Bailey trial?” Why should we have had to make all the running? Let me cite one or two instances of the positive vibrations PIE was receiving from the mighty ‘λ’.

At the 2nd annual conference of the IGA (Barcelona, 1980), the only group to abstain from a general motion calling on member organisations to support paedophile groups more vigorously was Britain’s CHE, who insisted on their exception being noted for the record. At GYM’s 1982 lobby of Parliament (which only twelve of some four hundred MPs felt obliged to attend), it was a vice-president of CHE, Martin Stevens, MP (Conservative, needless to say), who favoured the retention of the homosexual age of consent at twenty-one (for males), whilst others present were quite willing to negotiate an initial reduction to eighteen. Stevens’ rationale – if we may dignify it by that term – was that if homosexual behaviour was legally sanctioned among teenagers, “teenagers might in later years regret their youthful flings”. Similarly, at the IGA’s 1983 Vienna conference, it was Michael Brown of Britain’s Conservative Group for Homosexual Equality who supplied the most stentorian opposition to every paedophile motion put before the conference. In this case, where one of the motions called upon PIE to urge all other paedophile groups to affiliate as we had done, Brown was joined by Denmark’s F48, Norway’s DNF48, and Lavender Left of New York, who had apparently determined by explicit resolution to vote against all paedophile-supportive motions. The excellent ‘Gay Youth Charter’ composed by GYM in 1982 was rejected by CHE’s own conference until a reference to paedophilia had been expunged from it. A comparison between GYM’s ‘Gay Youth Charter’ and CHE’s ‘Charter for Gay Rights’, published in the same year, is extraordinary – the one is detailed, uncompromising, bold and lucid; the other bland, timid and cursory.

CHE’s dilemma was summarised by their own Law Reform Committee thus: “CHE has hitherto directed its campaign towards achieving equality under the law relating to heterosexual and homosexual behaviour. The reasons for this, while in large part tactical, are nonetheless important. The argument for equality is much easier to explain to a prejudiced audience and can be forcefully advocated on grounds of simple justice.” It goes on to ask, “Would adopting a position in favour of the abolition of all ages of consent laws risk appearing, in the eyes of the general public, to be so extreme as to make (CHE’s) aims on other issues more difficult to achieve; or has it reached the position where no further significant advance can be made without working – in collaboration with other organisations – for reform of these and the other laws relating to sexual behaviour generally?” [11]

It was the same dilemma which confronted broader civil rights groups like the NCCL (National Council for Civil Liberties) when the rights at issue were those of PIE. Any association with our particular cause threatened to undermine their own political credibility cross the board. PIE was the hottest potato of all, and triggered off all kinds of atavistic terrors in more respectable reformist groups. We were therefore sacrificed on the altar of short-term tactical compromise.

Not to confine this criticism to gay and civil rights groups however the producer of London Weekend Television’s ‘Gay Life’ programme (screened once a week in the late night horror slot) promised me there would be a programme on paedophilia in the second series to which PIE might be allowed to contribute. Alas, there was not. Among the helplines which consistently declined to give PIE’s address to paedophile callers were Icebreakers, London Gay Switchboard, Brighton Gay Switchboard, and Friend. One of these told me their solicitors had advised them that by passing out our address it might be construed that they were acting as agents for the organisations.

The fact that PIE was not exclusively homosexual represented part of the reason for this moratorium. GAY NEWS and TIME OUT both quickly zeroed in on this objection, though as with the ubiquitous power argument, it often serve as a radical justification from the mouth for a decidedly unradical prejudice in the mind. I think it stood to the credit of the PIE EC (whose most active members had always been boylovers) that we did not cave in under such pressure. No heterosexual paedophiles ever stepped forward to defend their own ground, and this made it rather difficult for us to answer the challenges of the gays and feminists with total conviction. Between gays and our heterosexual members the strand of mutual acceptance was very thin indeed (between them and feminists it did not exist at all).

David Thorstad, while still spokesperson of NAMBLA, expressed his own position all too clearly: When Anita Bryant would say that gay men are child molesters, they would say ‘Oh no, we don’t do that; gay people are not molesters, it’s the heterosexual who are the molesters’. I’ve used that argument myself; I believe it’s true.”

Many heterosexual paedophiles are just as ready to swallow society’s stereotype model of gays, their masculinity squirming uncomfortably at the prospect of too close an association with the world of such caricatures. This kind of stupidity is an obstacle we can all do without.

No-one will be astonished to hear that the facet of gay politics in the UK for which PIE felt the closest affinity was gay youth, and that GYM came top of our list of groups to form an alliance with. The first meeting between members of our two committees only reinforced this feeling. As we sat about a table in a London pub, no more than a dozen of us, it was not a bunch of middle class, middle-aged liberal paedophiles confronted with a bunch of radical gay teenagers suspicious of our motives. In fact the majority of both committees were in their mid-twenties. The youngest PIE representative was twenty-one, the oldest GYM representative, twenty-six. Some suspicion was evident on GYM’s part, or rather a wry scepticism about PIE’s political soundness, but it was expressed with candour, not hostility. For our own part, the only major criticism of GYM was its arbitrary self-imposed age limit of twenty-six (a strange paradox in a group whose existence is a reaction against arbitrary age boundaries), in that this tasted a little of ageism in reverse – the idea being that, without an upper age limit, GYM would be taken over by older gays (older than the then committee guiding lights), or that gays would flock to it like moths to a flame in search of teenage boyfriends.

Strategically, so much more can be accomplished under the banner of gay youth than would ever be possible for an overtly paedophile organisation, but that apart, GYM has a freshness and directness which PIE lost long ago. Whereas we talked years back of producing a general information video, GYM have gone and made one. While PIE made ginger overtures to carefully-chosen MPs, GYM staged a general lobby of Parliament. While PIE agonised over whether or not we dared to call another AGM, GYM revels in mass meets.

It is time that gay society in this country woke up to the crucial role it has to play in the foundation of a stable, vigorous and independent paedophile movement which is committed to radical change. What emerges may not be PIE, nor will it be a clone of the gay movement itself, for paedophiles are more than simply gay and straight adults who like their partners particularly young. Ours is a whole different sexuality, our needs and priorities are very different. We are brothers with the gay world, not twins.

PIE in the Face of Fleet Street

Journalism is one of those unsavoury professions – advertising is another – in which an individual’s potential for success is inversely proportional to that person’s scruples. Note that I do not say there are no journalists of conscience or integrity in Fleet Street, only that such people had never been to the fore when the focus of attention was on PIE, or paedophile matters, or rights (in their totality) of people under sixteen, and that such exotic blooms must seem strange indeed in that arid, thorny habitat. Doubtless there remains one detective at Scotland Yard who really believes the police are the servants of the community, and not its warders; or doubtless Thatcher has one Cabinet Minister who genuinely believes in equality of opportunity. These are all, however, statistical freaks. If we find journalism itself to be venal and corrupt – as I believe it is – then this is a profound cause for alarm. As one American commentator observed succinctly, (but glibly), “The news media have become Orwell’s Big Brother of ‘1984’ – all pervasive, all influencing. The freedom of the press is eating away the freedom of the individual”.

Television long ago supplanted religion as the opiate of the working class, and most of the criticisms I make here of the press apply with equal force to the broader media, notably television. There is a disturbing trend towards tabloid-style presentation in TV news programmes, with the same crass, superficial coverage, the same rampant sexism and imperious moral tone, and the same calculated imbalance. Recent reports, for example, of a mother seeking legal compulsion on doctors to inform parents before prescribing contraceptives to girls under sixteen were invariably followed or preceded by progress reports from police investigating the sexual murder of a five year old girl. Such judicious editorial juxtapositions are common. (A contemporary report in a local Harrow paper on similar demands from the ‘Harrow Child and Family Protection group’ appeared on the same front page as an overtly sexist pin-up – of a fifteen year old girl.)

As to the quality of the coverage – in a Central TV news report on the swelling number of teenage runaways in the midlands (‘minors’ voting with their feet?), it was emphasised throughout that the principal fear was not of physical, but ‘moral’ peril; that girls would be “drawn into drink, drugs and prostitution”, and that boys would “fall into the hands of homosexuals”. (TV journalists, like their Fleet Street counterparts, do not care to use the word ‘paedophile’, you may notice.) As always, the people who had most to say on the matter, the people most directly affected, whose anxieties and exasperations had driven them to take off in the first place, were the only people not consulted. It might have been a report on lost dogs or stolen cars. So much for the objectivity and impartiality of British television news.

Every year since PIE had come into being, during the slow news time of parliamentary recess, the minions of the soft-porn tabloids had scurried out with their indignation and their power-winder cameras to rake together another shock story about the group. We were a silly-season staple for the NEWS OF THE WORLD, the SUNDAY PEOPLE and the DAILY STAR. The danger with papers of this vulgar, facile kind is that they are widely dismissed as being of no consequence to significant trends in popular opinion. The NOTW is generally regarded as a joke, but without the implicit malevolence and cruelty behind the joke being fully appreciated, or the extent to which the paper’s four million readers are being duped by the fantasies of its squalid-minded editor and staff. There is no room here to catalogue all the misshapen, libellous reports that have appeared concerning PIE over the last few years. An analysis of the coverage of the Old Bailey trial alone would require a full chapter, and in any case, such a virulent poison permeates this sea of press cuttings that the mere task of reading them all through is grossly offensive and unhealthy for one’s state of mind. Confronted with such wholesale, indiscriminate hatred a sense of proportion is difficult to maintain. There had been several major stories on PIE since Tom O’Carroll was convicted, each of which had repercussions far beyond the immediate distress inflicted on the committee members named, and illustrate well the harm which the gutter press can cause.

The first of these stories (NOTW, March 22nd., 1981) was occasioned by PIE having to open a new post Office box, the sponsor of our previous box, David Grove, having died. The Post Office leaked the home address of our new sponsor, Peter Bremner, to the NOTW so fast that the reporters were at his door before the box had even been used, and before the Executive Committee itself, let alone our members, knew where the P.O. Box was located.

Inside, the paper ran a feature on PIE, and the child pornography industry, being careful to blur any distinction between the two. The reporters were Charles Sandell and George Edwards. ‘The Dreadful Web of Child Corruption’ began as follows: “The evil men of Britain’s child sex organisation, the Paedophile Information Exchange, are just the tip of an iceberg. Behind them lies a web of pornography and degradation that spreads its tentacles worldwide – and even involves the Mafia.” After another couple of paragraphs which could leave no doubt in the reader’s mind that PIE was in fact a front for the manufacture and distribution of pornographic material, Sandell and Edwards went on: “The magazines… they produce do not stop at sexual abuse. Some show the systematic slow torture and even murder of children and young people.” Now if that was not a cut and dried case of libel, what is? Who could blame the public for its outrage against PIE when such nightmarish tales could be published about us with complete indemnity?

Someone else who spreads his tentacles worldwide is Rupert Murdoch, the Jehovah of yellow journalism, and the essence of this NOTW story quickly resurfaced as far away as Australia and in Sri Lanka where, in the SUNDAY OBSERVER (April 5th), PIE was described as “the sick porn merchants of the West”. Sri Lanka, like the Philippines, had long been celebrated among paedophiles and gays for its tolerance to homosexuality in general, and sudden government moves late in 1981 to curb sexual contact between local youth and Western tourists have been attributed in part to the scare campaign triggered by the NOTW. Perhaps this is overestimating the impact of that tawdry little paper, but the snowball effect of press hysteria was a very real phenomenon, as later stories demonstrated.

It was an open secret among anyone linked to the Executive Committee that for four years I was employed by a firm of electrical contractors, Complete Maintenance Ltd, to monitor a control panel of alarm systems at the Home Office, Westminster. The job entailed practically no work on my part, beyond attending the panel, and in fact I had a furnished office completely to myself seven days a week on a rotating shift basis. Much of PIE’s less sensitive file material was stored in locked cabinets there, where no police raid would ever have found them. Each year my security clearance was renewed by Scotland Yard without my connection with PIE being discovered. I’d known from the start that such a marvellous snook could never be cocked forever and sure enough the News of the World got hold of this information eventually. The paper contacted the Home Office immediately of course and gleefully drew this oversight to their attention. My security clearance was cancelled on the spot, my employers notified and I found myself not sacked but ‘rendered without employment’ – on the same day that reporter Alex Marunchak greeted me on my doorstep. ‘Child Sex boss in Whitehall Shock’ ran the headline.

And what do you suppose? – “Home Office security chiefs knew all about Steven Adrian Smith’s links with PIE”, claimed the report; “A Home Office spokesman said, ‘We’re aware of Smith’s background, and since the NEWS OF THE WORLD contacted us he has been told he’s no longer acceptable to us. He no longer works here. It would be true to say that he would still be here if you hadn’t been in touch.’” This silly bit of official face-saving apart, Marunchak went on to concoct a brief interview with myself. Instead of slamming the door in his face, which I seem to recall having done, I appear to have told him (with a swirl of my opera cloak), “Yes, I’m the chairman of PIE. So you’ve found out!” and so on. There was possible libel here too, for he alleged that at an EC meeting I had “bragged of (my) relationships with boys and urged members to organise a ‘dirty weekend’ with children at a south coast hotel.” This is imputing to me a specific criminality, but nonetheless – we were advised by a solicitor – whether I won a libel suit or not, and I stood every chance of doing so, that the sympathies of the jury would be wholly against me, and any damages derisory.

Some of us had fondly hoped that my inevitable discovery would at least throw such egg on the face of the government as to oust the Home Secretary (then, Mr. Whitelaw), but in the event, this story was curiously not picked up by any other paper (obviously, the ‘ruling class’ had to be protected), and our own attention was diverted by a plague of visits from DAILY STAR reporters the very next week. (Incidentally, the extent of security chiefs’ knowledge of my activities did not prompt them to investigate the content of my filing cabinets and a carload of PIE files was safely spirited from the building before it could occur to them to intervene.)

Once upon a time a reporter in the alternative press wrote (with just a hint of sarcasm) that it was about as difficult to ‘infiltrate’ PIE as to infiltrate Piccadilly Circus. He was absolutely right. One of the hazards of keeping our door wide open (as any counselling group must) is that all manner of creepy-crawlies are apt to find their way in along with more welcome visitors, and such a one was Charles Oxley, principal of two public schools, Christian fundamentalist, and wizened protégé of Mary Whitehouse. [12] Under the name of David Charlton he joined PIE with offers of practical help in EC work. He was good enough to type out for us Tom O’Carroll’s copious non-fiction booklist, and to photocopy at his own expense many other items for the PIE Press Service. As with anybody else who expressed a willingness to work, he was first met by an EC member to assess his character and reliability, then invited along to a couple of committee meetings. His sensational findings formed the basis of a four-page spread in the DAILY STAR (‘Child Sex Spy Tells All’ – August 21st, 1982) and many subsequent radio, press and police interviews. On the strength of just two meetings with the EC, Oxley had become the Establishment’s trusted authority on PIE. Who was taken in the more by his fantasies, PIE or the Establishment, is open to question. STAR reporters Paul Henderson and Barry Gardner played Woodward and Berstein [sic] to Oxley’s ‘Deep throat’.

Four committee members were named – David Joy, Peter Bremner, Lee Edwards and myself, and photos appeared of three of us (my mother was later to comment that the STAR photo was one of the best of me she’d seen!) It was no coincidence that the three committee members who were to be raided by the Obscene Publications Squad, almost exactly a year later, were David Joy, Peter Bremner and Lee Edwards. Not content with publishing our addresses, the DAILY STAR carried photos of our homes too, for greater ease of identification by neighbourhood vigilantes, mums’ armies, and neo-fascist groups.

The text itself was rather lame, even amusing in comparison to the previous year’s NOTW extravaganza, and only of interest for the crude, obvious manner in which colour was added. To convey the impression of PIE as a shifty, back-street organisation, our homes were variously described as “dingy”, “seedy”, and “an old mansion that comes straight from a horror movie”. Meetings were arranged, it said, “through a complicated exchange of letters and coded telephone calls” using “secret codes and passwords”. This was total fantasy and a familiar lie printed about the group – arrangements were far more mundane and prosaic than that, I’m afraid. Oxley knew that no pornography had been handed round at the meetings, but he was determined to create that impression at least: “Various paedophile books and magazine were mentioned and passed around” he hinted darkly. As I remember, Oxley took away one of these magazines himself for closer inspection, and never returned it – it was the latest issue of PAN (Paedo-Alert-News).

The news-gathering tactics of the DAILY STAR rate a mention here. We learned later that they had used menaces toward several children in Lee’s home street who would not answer their questions (Lee was staying with a family at the time, and the two daughters were tailed by the press for several days). When this proved fruitless, they set up a couple of young boys to accost Lee in the High Street and make conversation just long enough for him to be photographed form a parked car across the road. (Even when he called on me, Henderson had attempted to force his way into my house.) It was a standard routine for reporters on this kind of story to make a point of visiting all one’s neighbours and filling their heads with who-knows-what horrific yarns. There was a knife attack on Lee shortly after the story appeared, but as Lee is an ex-boxer he managed to send his assailant away with a bloody nose, never to return. Another standard hurdle with these reports was the local press follow-up, a boringly predictable after-shock when your local paper contrives to regurgitate the story for those of your neighbours who missed it the first time around. In this particular instance the STAR itself ran a follow-up story a few days later (‘Ban the PIE Men’) in which glory-hunting Tory back-bencher, Geoffrey Dickens, vowed he would table a Private Member’s Bill at the next session of Parliament which would proscribe PIE explicitly, and outlaw any other pro-paedophile organisations. [13] Dickens was the same stalwart who named diplomat Sir Peter Hayman, under House of Commons privilege, as the PIE member whose identity had been concealed throughout the trial (some six months after Hayman had been publicly identified in PRIVATE EYE magazine). Dickens did not win the Private member’s ballot, as chance would have it, and nothing more was heard of that pledge, but it seemed to us a serious threat at the time. Even a bungling oaf of Dickens’ calibre could hardly have failed with such an intimidatingly populist Bill, had he won the ballot.

By the winter of ’82, the papers were full of the Geoffrey Prime affair. Prime was exposed as a Russian supermole who worked at the government’s intelligence HQ at Cheltenham. Imprisoned for sex offences against young girls, as well as spying, it was alleged, unsubstantiated of course, that he either had links with Pie or was actually a member under an assumed name. As with the much earlier Sir Peter Hayman affair (he was the former British high Commissioner to Canada), and the later revelation that I myself and an EC colleague, Barry Cutler, were both employed on security at the Home Office, this latest scandal must have caused considerable embarrassment to the government. By now, PIE’s name must have been truly hated in the corridors of power. [14]

In June, 1983, the NOTW ran yet another of its regular silly stories, this time claiming that top TV stars and MPs were members of the Exchange. No names were mentioned, of course – except those of EC members. As a result of this and follow-up stories in such scandal sheets as the STAR and the SUN, committee members Mike Williams and Richard Travell lost their voluntary work as a scoutmaster and Sunday School teacher respectively. Travell was later denounced by his father, a church minister, and forced to move out of his home.

It would be possible to go on and on about the shock/horror stories concerning PIE, but this would serve little purpose since the point has been made. Suffice it to say that press harassment of the group was real, and it seemed that reporters were prepared to use any means, fair or foul, to ensure the organisation was destroyed. The time is coming when something will need to be done about the press in this country – and the sooner the better.

Final Words

If paedophiles have little faith in the press, they have certainly got even less for the criminal justice system in this country, for being a paedophile is an invitation for every sort of injustice there is. While baby batterers walk away with derisory sentences after being slapped on the wrist and told not to do it again, people whose only ‘crime’ is that they love children can expect to have the book thrown at them and endure years of attacks in squalid prisons from real criminals. One can inflict horrendous physical suffering on a child, but if one is unfortunate enough to be a paedophile who has consensual sex – oh well, that’s classed as worse than murder.

Similarly with ‘corporal punishment’ which is, in truth, nothing more than a euphemism for legal assault. This practice is widely supported in these isles, and it is no coincidence that the organisations and people who were most opposed to PIE were the very ones who endorsed it most. The message is clear: abuse is okay as long as it is socially approved.

Back in its earlier days, PIE itself initiated a campaign against this practice and received letters of support from such well-known people as Baroness Wootton, and Sir Alfred Ayer, the philosopher. But PIE, being a tiny organisation, could only do so much.

For PIE, the time has now run out; but the ideas behind it will continue to survive.

Editor’s note: Soon after the above article was written, its author along with two other PIE EC members were arrested on incitement charges in connection with issue No. 6 of the group’s internal bulletin, CONTACT. Before the trial, Steve Smith fled to Holland where he still resides. The two other defendants were subsequently found not guilty of the incitement charges, but guilty of a lesser charge. After renewed threats to proscribe PIE, the group finally succumbed to political pressure, and the organisation disbanded in early summer, 1985. Because of this, all articles in this book referring to PIE, including the above, have had the tense changed from present to past.

NOTES AND REFERENCES

1. A journal of PIE
2. Lee Edwards was later alleged (though unproven) to have given or sold confidential information about PIE and its members to the NEWS OF THE WORLD, which published the details, much of them erroneous, in a front page splash.
3. I refer, of course, to the notorious Conspiracy to Corrupt Public Morals trials of early 1981.
4. Tom O’Carroll (Peter Owen, London, 1980).
5. ‘Men Loving Boys Loving Men’, by Gerald Hannon (BODY POLITIC, March/April, 1979).
6. It was Kenneth Clarke in CIVILISATION who said that ‘nearly all the upward steps in the history of civilisation have been internationalist steps.”
7. CAPITAL GAY (July 15th, 1983).
8. CONTACT! Which was edited by myself, was the internal bulletin of PIE.
9. PAEDOPHILIA: SOME QUESTIONS AND ANSWERS (PIE, 1979).
10. EVIDENCE ON THE LAW RELATING TO, AND PENALTIES FOR, CERTAIN SEXUAL OFFENCES INVOLVING CHILDREN – FOR THE HOME OFFICE CRIMINAL LAW REVISION COMMITTEE, ed. by Keith R. Hose and Michael Burbidge (PIE, 1975).
11. THE LAW RELATING TO CONSENSUAL SEXUAL ACTS: A DISCUSSION PAPER (prepared by The CHE Law Reform Committee’, 1980).
12. Oxley was, at the time of writing, chairman of the right wing National Campaign for Law and Order, which incidentally supports hanging and corporal punishment, and deputy chairman of Mary Whitehouse’s Viewers’ and Listeners’ Association.
13. Even revelations that he was consorting with two other women, despite the fact that he was married, didn’t stop Dickens attacking PIE. Hypocrisy has no bounds, it seems. I often wonder what the dickens the man would do if it weren’t for paedophiles???
14. Well before the Hayman affair, another Establishment figure, Lord Bingham, had also been revealed as a PIE member.

[ADDENDUM: The ‘Lord Bingham’ in question here was Richard Maurice Clive Bigham, Viscount Mersey (1934-2006), who admitted PIE membership and contact with a 10-year old girl, who would remove her clothes when offered money and sweets by him; the girl’s mother went on trial in Manchester Crown Court in 1978 on charges of inciting one of her daughters to commit gross indecency with Bigham. See ‘Peer’s son in sex case ‘revolted”, Glasgow Herald, July 20th, 1978]

Image result for richard maurice clive bigham

Truthseeker ‏ @thewakeupcall09

Richard Bigham – Eldest son of viscount of Mersey admitted he was a member of PIE (Paedophile Information Exchange).

Halfway through Richard Maurice Clive Bigham’s, 12 month jail sentence suspended for two years. Richard Bigham became 4th Viscount Mersey in 1979, and joined the House of Lords.

Within 3 years of conviction PIE member Richard Bigham was speaking as Viscount Mersey in House of Lords. How was Richard Bigham allowed to make 273 speeches in House of Lords from 1981-1999 ?

Did ANY MP speak out about Richard Maurice Clive Bigham, the 4th Viscount Mersey, if not, WHY not ?


The after-effects of prosecution for sexual abuse of young boys …

(1) Sir Ian Horobin MPs (Con: Oldham East) ebullient bounceback from his 1962 conviction by publishing a poetry anthology with a foreword by John Betjeman in 1973 (nb. the curiously mournful comment ‘Even the elms are dead’), written during post-prison recuperation in Tangiers where boys could be preyed upon;  and

(2) Charles Hornby’s successful application for a gun licence just over six months after his release from prison for his part in the Playland Piccadilly Amusement Arcade Trial of 1975, granted by a Recorder who didn’t need to recuse themselves over a dinner party or two,

it appears the ill-effects of ‘loss of reputation’ can be very much countered by one’s well-placed friends rallying around so that life and even reputations may resume post-prosecution.

https://bitsofbooksblog.wordpress.com/tag/sir-ian-horobin-mp/

Horobin was sentenced to four years in prison and moved to Tangiers on his release, where boys were in more plentiful supply with less fear of criminal repercussions.

Strangely, in Matthew Parris‘s book: Great Parliamentary Scandals: Five Centuries of Calumny, Smear and Innuendo he makes the following statement:

It was never suggested that any of the young men sustained any physical injuries from their encounters with Horobin.  The liaisons were consensual, the term ‘assault’ being a peculiarity of legal language.  The head groundsman at the Settlement told the jury that Horobin claimed to have helped the lives of far more boys than he had ever ruined.

I’m assuming Parris and his co-author, Kevin MacGuire, didn’t bother to speak to many of Horobin’s victims in order to reach such a conclusion, nor do they understand that children DO NOT have the capacity to consent.

Upon his release, Horobin emigrated to Tangier in Morocco – Morocco seems to be a popular haunt for some – and in 1972 he published a book of poetry dedicated ‘with gratitude and affection to my partners in crime.’  Sir John Betjeman, whom he met at a Soho club upon his release, supplied the book’s introduction.  Horobin died in Tangier in 1976.

https://scepticpeg.wordpress.com/2018/11/12/london-the-philanthropic-wolves-in-sheeps-clothing/


VAN DER POST, ALAN McGLASHAN, IAN HOROBIN

Sir Laurens van der Post

Prince Charles‘s spiritual guru Sir Laurens van der Post “impregnated a 14 year old daughter of a family friend he’d been entrusted to look after on a sea voyage when he was 46.”

The guru who got away with it.

Dr Alan McGlashan.

Prince Charles’s spiritual guru Sir Laurens van der Post introduced Prince Charles to Dr Alan McGlashan.Prince Charles received therapy from Dr Alan McGlashan for 14 yearst, according to American author and historian Sally Bedell Smith.

Dr McGlashan was trained at the Tavistock Clinic.

During the Second World War Dr McGlashan served as a consulting psychiatrist on the War Office Selection Board.

OBITUARY : Dr Alan McGlashan.

Sir Ian Horobin
Prince Charles’s spiritual guru Sir Laurens van der Post was a friend of the Conservative member of Parliament Sir Ian Horobin.In July 1962 Sir Ian Horobin pleaded guilty to a number of indecent assaults on boys at the Fairbairn Boys’ Club in the East End of London.

52 years on: The Forgotten Fly in the Reshuffle | Bits of Books

Boys’ clubAt the age of 24, Horobin became Warden of Fairbairn Hall, Plaistow in East London.

“Here at 310 Barking Road, Horobin could be found patting boys on the rear as they took their shot.”

“310 Barking Road is not too far from the Mile End Road’s Regal Billiard Hall in Eric Road where by the mid-fifties a twenty year old Ronnie Kray was also admiring the view of boys taking their shots at the snooker tables.”


Jimmy Savile

Amateur boxer Billy Walker, while working as a doorman for Jimmy Savile at the Ilford Palais, aged 16, trained at Fairbairn Amateur Boxing Club on Barking Road”Fairbairn Boys Club … flourished in all sports including Boxing, Rugby, Cricket and Football.

“Famous sports personalities to emerge through the Club are Billy Walker, Terry Spinks, Graham Gooch, Alan Sealey and Alan Curbishley

“After boxing bouts the boys would occasionally find Horobin supervising proceedings in the communal bath area, perched on a shooting stick…”

Terence Stamp
“One old boy, the actor Terence Stamp, recalls how ‘there was all kinds of gossip about Sir Ian, the strongest being that he was a bit of a ginger beer.’

“Despite the rumours, Stamp’s autobiography describes how, aged fourteen, he was ‘chuffed’ to receive an invitation to Horobin’s flat one Saturday afternoon to show off some paintings he had entered in a competition.”

52 years on: The Forgotten Fly in the Reshuffle | Bits of Books

~~~

.
Prince Philip and some boys.

The Butler Did It – Paul Pender (2012) Murderous butler Roy Fontaine falls into the Somerset Maugham, Lord Mountbatten, Vic Oliver, Lord Boothby set during WWII

1961-1976: Between McAlpine and Polaris – ‘Singing Hymns to Tigers’ Jimmy Savile’s Jesuit pop priest Father George Giarchi goes back to university to study the destruction of democracy in his hometown. The establishment of US Naval Base Polaris in Dunoon and the influx of single men to a tiny town creates a growing trade in sex, a sharp increase in teenage pregnancies and the arrival of spies setting up hotels.

Sir Nicholas Fairbairn defends a spy by ridiculing his attempts to pass information in court…but were other spies more successful? The sex trade servicing the US Naval ratings gradually moves across Holy Loch to the nearest town, Glasgow, and becomes more organised servicing new arrivals too – McAlpine Construction’s North Sea Oil Rig workers

1962: 52 years on – The Forgotten Fly in the Reshuffle Sir Ian Horobin, former Conservative MP for Oldham East, is forced to turn down a knighthood from Harold Macmillan due to his arrest for abusing boys aged 11+ at Fairbairn Boys’ Club in the East End. Just as Horobin is due to appear in court, Harold Macmillan culls a third of the cabinet in the long night of the knives and plucks Peter Rawlinson MP (Con: Ewell & Epsom, Surrey), Horobin’s defence counsel, just before the trial commences to become Attorney-General and promotes Home Secretary Richard Butler to Deputy Prime Minister.

1962: Albany Trust’s interview panel and Antony Grey

Barbara Kahan, Peter Righton, Louis Minster and Malta

1967/68: Antony Grey serving on NCCL’s Legal Sub-Committee

1967 – 1972: Sexual Offences Act 1967 and Sir Norman Skelhorn’s consent to prosecute vs. police powers of prosecution

1968-1970: Peter Righton, Antony Grey, Ian Greer, Raymond Clarke & The 1970 York Conference

Spring 1969: Grey writes a review for Walter Breen’s ‘Greek Love’ and receive a firm offer to co-write a book from David Kerr MP
1970s

June 1970: Michael De La Noy writes about ‘Leslie’ former MoD employee indiscreet improper letter writer

October 1970: John D Stamford of Spartacus applied to Lord Beaumont for Director of Albany Trust, no salary required!

December 1970: Lord Beaumont ignores Grey’s Spartacus warning & urges De La Noy to use Stamford’s money

December 1970: Stamford asks De La Noy to appear as defence witness in Spartacus obscenity prosecution

May 1971: Peter Righton establishes ACCESS with Dr Robert Chartham / Ronald Seth as trustee – watched by MI5?

July 1971: Peter Righton at the House of Lords – Lord Beaumont calls an Emergency Meeting of the Albany Trust Antony Grey returns to the Albany Trust – dispute over lease on 32 Shaftesbury Avenue and costs ‘the offices were too large and expensive for the time of retrenchment ahead’ – Grey moves the Trust to Kilburn during 1971/72 and then to Highbury before settling at 31/33 Clapham Road spring 1975 – 1976

September 1971: Lord Beaumont’s letters and Peter Righton meets Jack Profumo at Toynbee Hall

Christmas 1971/January 1972: Bishop of Stepney and Jack Profumo give Peter Righton their patronage

1969-1973: The Dilly Boys by Mervyn Harris (London: Croom Helm Ltd) 1973 South African journalist Harris spends time at the London School of Economics and starts researching The Dilly Boys and their customers from 1969, publishing in 1973

PLAYLAND 1970-74: When protecting ‘millionaires titled and influential’ paedophiles became paramount

1972: How Lord Longford’s Porn Inquiry and P.I. sidekick Major Matthew Oliver brought down Soho’s Dirty Squad

Battle of the Courtiers? A grudge-match beyond death: Lord Lambton vs Lord Mountbatten

May 1973: Lambton’s limited fallout obscures London-Paris trafficking and trade in young boys and under 21s

November 1973: Ian Dunn, Paedophile Information Exchange co-founder, joins Albany Society Ltd Council of Management

April-June 1974: Martin Loney, NCCL General Secretary calls for a parliamentary inquiry into Special Branch blackmailing of IRA informants as a result of the murder of Kenneth Lennon – Henry Hodge, NCCL Chairman, and 11 members of the Executive Committee eject him causing grass-roots uproar and incurring Antony Grey and Eric Thompson’s wrath

1974: Father Trevor Huddleston (Bishop of Stepney): Famous Mr X and the Rule of Law

1974 – 1976 Civil Liberties, Paedophiles and Politics

16 July 1974: Lucille Butler’s Albany Trust fundraising and networking party

September – October 1974: Paedophile Information Exchange, Paedophile Action for Liberation and NCCL Gay Rights Committee all formed

22 October 1974: The day Parliament is recalled under Harold Wilson with a majority of 3, following the second General Election of the year, the Home Office Voluntary Services Unit writes to Antony Grey to tell him they will be funding the Trust to the tune of £10k p.a. over 3 years and in the evening Antony Grey, David Barnard and Rev Michael Butler Julian Gibbs’ Albany Trust fundraising and networking party

PIE’s call for lawyers, medics and social workers: PIE sets out to attract professional subscribers and supporters and reports its first woman member

1974: Grey lunches with Sir Keith Joseph & invites Mrs Charles Morrison, Vice-Chair of the Conservative Party to become Albany Trust Chairman – she declines, pleased to have introduced Grey to Joseph. Raymond Clarke is already a mutual link from Grey to Joseph.

1974-1975: Keith Hose becomes member of NCCL Gay Rights Committee before accepting the Chairmanship of PIE

December 1974 – April 1975: Antony Grey absent from the Trust with Appendicitis

10 February 1975: Four new trustees join Albany Trust: Rodney Bennett-England, Harold Haywood O.B.E. (ex-Director NAYC), Sue Barnett (Family Planning Association – Grapevine) and Tony Smythe (MIND) Albany Trust moves to 31/33 Clapham Road: warehouse and 9 offices

1975 – 1977: Albany Trust, Sir Harold Haywood and the Paedophile Information Exchange drafting team – Paedophilia: Some Questions & Answers – Who was ‘John’?

1976: Minutes of PIE/PAL/Albany Trust meetings – was ‘John’ ex-BBCR3 presenter John Holmstrom?

June 1975: Who was PIE’s man in New Zealand?

September 1975: Albany Trust receives funding from Grocers’ Co & Goldsmiths Co for £2k and £1k p.a. for 3 years to fund Field Officer role / Harold Haywood becomes Chairman of Trustees

PIE Member No. 2: Dr Michael Coulson, who was a Professor of Sanskrit at University of Edinburgh, Chairman of Scottish Minorities Group (responsible for campaigns and lobbying) and Ian Dunn’s first adult relationship, commits suicide on 16 October 1975 and in a PIE Newsletter obituary is revealed as PIE member No.2

1976: Who was the 3rd Scottish Minorities Group founder of PIE?

March 1976: Albany Trust holds Agony Aunts luncheon

July 1976: New trustees join: Sidney Bunt (ex-NAYC), Arlo Tatum (Peace News)

Oct/Nov 1976: Save the Children advertises in PIE Newsletter No.6?

Dec 1976: Lord Winstanley to Antony Grey: “Pursue Mrs Whitehouse to the end of the road, if not further!”

1975-1976: Harold Haywood, Lucilla Butler and Charles Napier – Nucleus and Albany Trust at Earl’s Court

October/November 1976: Grey invites Ian Dunn to be an Albany Trustee and travels to Edinburgh to meet Dr Alan Rodger (Thatcher’s future Lord Advocate

October 1976: Did NCCL’s trawl of List 99 radicalise PIE’s Tom O’Carroll?

December 1976: What went on in Rottingdean? Robin Bryans writes and speaks to Rev Michael Butler of the Albany Trust regarding Father Colin Gill’s abuse of boys – in April 1977 he is poisoned, in a coma, when Labour’s Attorney General Sam Silkin orders he is in contempt of court in order to restrict Bryans’ letters to Butler from being circulated further
1977

January 1977: With compliments from Ian Dunn and while you were out, Tony Smythe of MIND called

January 1977: Sir Harold Haywood invites Lord Winstanley, Cyril Smith’s Wesminster roommate and Liberal Peer joins the Albany Trust

March 1977: The weekend of discord: Arlo Tatum, Director of Peace News as Organising Secretary of Albany Trust and Roger Moody, Editor of Peace News and PIE member

April 1977: Penthouse Magazine’s funding to NCCL for PIE’s Nettie Pollard’s role as Gay Rights Worker falters
1978

April 1978: 1978: Tom O’Carroll writes to Antony Grey at Defence of Literature & Arts Society re ‘freedom of speech’

April-May-June 1978: 18 Lords on 18th May 1978: The Protection of Children Bill, NCCL and PIE

June/July 1978: PIE Raids, William Blake and Lord Margadale’s Estate at Fonthill, Wiltshire

August 1978: Righton’s paper for the International Association of Schools of Social Work Congress, Israel

September 1978: Patricia Hewitt issues memo to NCCL Gay Rights Committee stating paedophile cases are not civil liberties issues per se and must be dealt with by committees/departments other than solely GCR, much to Nettie Pollard’s concern
1979

George Parker Rossman a.k.a. Jonathan Drake

July 1979: Parker Rossman and Antony Grey meet in London and correspond
1980

1980: Savile, Malcolm Mclaren & the great child abuse swindle of 1980 and beyond

18 April 1980: Following first reports in the media on abuse at Kincora NCCL Gay Rights Committee guest attendee from Northern Ireland Gay Rights Association (NIGRA) reports Royal Ulster Constabulary are conducting a gay ‘purge’ in their investigations

1993/4: What Lord Longford’s autobiography has to say on MI6 boaster and convicted child abuser Frank Beck and his ‘honest eyes’

Bedfordshire nr Luton: Savile, Henlow and Shefford, East Bedfordshire

Belfast, Dublin: Savile, Dublin & Belfast: Time to re-evaluate his role in The Troubles?

Ilford Essex & East End: Come Dancing: BMU v. Mecca? Savile v. Ambrose? [1954 – 1956 Ilford Palais]

Calder Valley: Savile, St John the Baptist’s In the Wilderness, Cragg Vale & Hebden Bridge

Isle of Man: Dr Alexander Cannon & Mountbatten’s Most Secret Report: Stranger than Fiction?

Jersey: Savile in Jersey: Madge Hayes and St Helier Community Services Board

Savile’s espoused beliefs: A coherent whole or merely the actions of a compulsive collector of keys, symbols and shepherd’s crooks?

Savile: British Israelite, Loyal & Ancient Shepherd of the Empire, Messianic OddFellow?

Kincora, TARA, Robin Bryans & the British Israelites

The Relentless Gimmickry of Jimmy (Part 1)

Revealed: How Gordon Brown was duped into aiding the founder of vile paedophile group who infiltrated gay rights rally

  • Gordon Brown was duped into backing an event by PIE founder Ian Dunn
  • Former Foreign Secretary Robin Cook and Brown sponsored the congress
  • PIE was trying to piggy-back gay rights conference In Edinburgh in 1974
  • The vile group planned to use the event to push its disturbing agenda
  • Paedophiles were secretly invited to the conference from around the world
  • Delegates were invited to attend a planned paedophilia ‘workshop’ 
  • Former PM says he did not know PIE were at the congress 40 years ago
  • Links between Labour grandees and PIE were revealed earlier this year

Mr Brown and former Foreign Secretary Robin Cook were among several key figures on the intellectual Left who sponsored a conference…Paedophile Information Exchange (PIE) was seeking to piggy-back its way into a legitimate movement.

Both men believed they were simply supporting a gay rights congress and, on that basis, agreed to lend their names to it.

But The Mail on Sunday can reveal that it was organised by the founder of PIE, the sinister 1970s lobby group dedicated to legalising sex with children.

Publicly available documents show:

  • PIE planned to use the congress to push its own disturbing agenda.
  • Paedophiles from all over the world were secretly invited and assured the event would take ‘paedophilia in its stride’.
  • PIE was mentioned in a congress programme as a ‘new Scottish-based group of paedophiles’.
  • Delegates were invited to attend a planned ‘workshop’ on paedophilia.

PIE would later use similar tactics to infiltrate the National Council for Civil Liberties (NCCL) when it moved its powerbase to London a few years later.

Earlier this year, shocking links were exposed between PIE and Labour grandees Harriet Harman, Jack Dromey and Patricia Hewitt, who all held key roles in the NCCL.

Ms Harman belatedly expressed ‘regret’ that the group – which police suspect of abusing children on an ‘industrial scale’ – was allowed to forge links with the council. However, she refused to apologise.

The International Gay Rights Congress was held over four days in Edinburgh in December 1974 and organised by Ian Dunn, who had set up PIE a few months earlier.

At the time, Gordon Brown was rector of Edinburgh University, representing students to the senior management, and was already identified as a future Labour star.

In addition to Mr Brown and Mr Cook, Dunn also secured support for the congress from David Steel, the future leader of the Liberal Party.

All three knew Dunn as founder of the Scottish Minorities Group and a prominent spokesman for the gay community in Scotland. There is nothing whatsoever to suggest they knew about PIE’s existence at this time, or were aware it planned to use the congress as a launchpad.

They had been invited as ‘prominent Scotsmen’ and told only that the conference – the first of its kind – would examine ‘social and political situations affecting homosexuals’ across the world.

But had they seen a programme, which it is understood was sent to delegates ahead of the congress, they might have noticed a reference to PIE under the heading ‘Projected workshops & small discussion groups’.

One was called Sexual Minorities and lists ‘Pedophilics, transsexuals, cross-dressers, s/m aficionados, asexuals’. Next to this listing in the ‘individuals participating’ column it says: ‘Pie, a new Scottish-based group of pedophiles, will be represented.’

Last night, Mr Brown’s office said he was unaware of PIE’s presence at the congress. Asked if he attended the congress, she said: ‘Not according to any records that Mr Brown has.’

Dunn wrote to the future Prime Minister, then aged 23, in July 1974 and briefly outlined plans for the conference, saying he would be ‘honoured’ if he would be ‘associated with our effort’.

He added: ‘The limit of your “sponsorship” would be your willingness to allow your name to appear with your co-sponsors at the foot of our letterhead, hence the reason for our writing to a small number of people in the fields of politics and education. We await your reply with anticipation.’

Both Mr Brown and Mr Cook agreed and, along with other sponsors, co-signed a letter three months later recording their ‘support for the ideals of the congress as expressed by the organisers’.

They urged Edinburgh councillors to grant the delegates a civic reception ‘in the accustomed manner normally accorded to important national conferences held in Edinburgh’.

However, at least one Scottish politician declined to be an ‘honorary sponsor’. Sir Malcolm Rifkind, then a Conservative MP in Edinburgh, raised concerns in his reply to Dunn in August 1974.

Although he had no inkling at the time that PIE intended to use the congress to advance its agenda, he wrote: ‘I cannot help but believe that the type of congress which you envisage, with all the attendant publicity, will be likely to encourage the growth of homosexual activity among the very young… While I have no desire to prevent adult members of the community indulging in such sexual activity as meets their requirements, I feel the objectives of your congress go far beyond that…’

Last night, Sir Malcolm, who was Foreign Secretary under John Major, told The Mail on Sunday: ‘Mr Dunn’s attempt to encourage MPs and other people to associate with this congress were clearly mischievous if that congress had a wider purpose which he was not revealing.’

The event was lauded as the first post-war conference of homosexual emancipation movements from around the world. But its link to PIE has never been revealed until today.

Experts said the event was one of many examples of how PIE leaders managed to infiltrate groups who were not aware of their true aims and dupe innocent people.

Author and jounalist Christian Wolmar – who later helped end PIE’s use of a legal charity’s address – said: ‘Their whole strategy was to make themselves respectable through linking themselves with prominent organisations and people. These people would not have known what PIE were advocating.’

Details of PIE’s involvement emerge from documents held at the National Archives of Scotland.

Michael Hanson, who was on the congress organising committee, made plain PIE’s primary aim in the SMG’s newsletter published in September 1974. It was, he wrote, to ‘campaign for the legal and social acceptance of paedophilic love’, adding: ‘I hope most [SMG] members will accept that we wish to recognise the value of PIE…’

In a letter to a friend on September 10 that year, Hanson, who admitted being attracted to boys as young as 13 but denied being a paedophile, wrote: ‘The Congress is taking paedophilia and other sexual minorities in its stride and invitations have been sent out to paedophile groups in Switzerland, the Netherlands, West Germany and the USA.’

‘…There will be opportunities for individuals to set up workshops on anything not covered by the conference agenda, and it has already been decided to hold one on paedophilia… It will be good for paedophiles to understand general gay problems and for gays to be reminded about the minority in their midst.’

Hanson, who was PIE’s first chairman, added: ‘Paedophila/pederasty as such is not a subject which will be discussed by a full session of the Congress, but paedophiles will undoubtedly be interested in the sessions on Law and Rights of Young Homosexuals and, we hope, have a general interest in the other subjects under discussion.’


Ian Dunn arranged the PIE workshop with Michael Hanson, the vile paedophile group’s first chairman

At the time, homosexuality was still illegal in Scotland, though not in England and Wales, and much of the congress was taken up with discussion of changing the law. Other subjects included ‘homosexuals in politics, public education on homosexuality and the fight against persecution’.

In another letter, Hanson wrote about plans for a PIE newsletter that would have ‘the important role of… putting paedophiles in touch with each other’.

He also said the publication could include information about the ‘legal situation in various countries, books to read, the best part of certain towns for meeting boys’.

The group, he added, would need a leader but initially ruled himself out, saying that he did not have ‘practical experience and knowledge ready to answer many of the queries that would turn up. (eg where in London can I meet boys? What do I do when the parents find out?)’

While Hanson helped organise the congress, most of the credit for its success went to Dunn.

An egocentric individual, he worked as a town planner in Edinburgh and was a trade union official and Labour Party activist. At one stage he was a Labour council candidate and, before his death in 1998, had applied to become a candidate for the Scottish Parliament.

For most of his life he denied he was a paedophile, claiming he had become involved in PIE because he believed in supporting minorities. Yet he allowed his flat to be used as the mailbox for a journal called Minor Problems, which billed itself as ‘a radical review for free intergenerational and child sexuality’.

When this was exposed, Dunn threatened to sue, but quietly dropped the legal action after a tape emerged of his boasting about having sex with a 14-year-old boy.

At his funeral, one young man turned up and said bitterly: ‘I just came to make sure he was dead.’ Explaining his anger, he said that he had been raped by Dunn when he was 15.

Derek Ogg, now a prominent Scottish QC, was the chairman of the congress and a leading figure in the SMG. In June 1975, he wrote to members urging them ‘positively to recognise the value of PIE and PAL [Paedophile Action for Liberation]’.

He wrote: ‘The proposed policy to PIE and PAL states, “As paedophilia is not a homosexual condition but an all-sexual condition, SMG has no official connection with either of these organisations. We recognise them, however, as organisations seeking in difficult circumstances to further the knowledge and understanding of the paedophile sexual condition, and recognise their value as such.’

r Ogg went on to head Scotland’s National Sex Crimes Unit. Last night, he told The Mail on Sunday: ‘I have never, even as a naive teenage student, expressed support for the child sex agenda touted by PIE or any other group or individual.’

He also denied PIE was launched at the congress. ‘There was certainly no PIE workshop. I do not even know if such a workshop for minorities, whether advertised or not, actually took place. I did not attend any paedophile workshop.’

Of his comments on SMG’s policy towards paedophilia, he said: ‘This may (in the knowledge of what PIE became in following years) seem a naive statement now, I leave that to your readers.

‘It achieved what I wanted, no affiliation of the group to ours and protection of young homosexuals within SMG itself.

‘It also reconciled with my “private morality”, and that of many others, that child sex was plain wrong.’

Lord Steel said: ‘I think at the time I was one of the three party sponsors of the campaign in Scotland to decriminalise homosexuality, which could be why I would be listed as a sponsor of the congress, but I had no other knowledge of the event.’

Mr Brown’s office said he had no relationship with Ian Dunn or Michael Hanson and that he was unaware of their sympathetic views towards paedophiles.

https://www.dailymail.co.uk/news/article-2836107/How-Gordon-Brown-duped-aiding-founder-vile-paedophile-group-Paedophile-Information-Exchange-infiltrated-gay-rights-rally-hoodwinking-future-PM.html#ixzz4QbUilVlD



PIE – Documentary Evidence 6 – Chairperson’s Report 1975/76

The following is the complete text of the PIE Chairperson’s Report from 1975/76, authored by Keith Hose, the first chair of PIE after the organisation had moved from Scotland to London. It contains important information relating to NCCL, the Campaign for Homosexual Equality (CHE), and the National Association for Mental Health, MIND. Some of the writing referred to in The Guardian can be read here. See also this and this.

PIE CHAIRPERSON’S REPORT 1975/76.

PIE c/o/ Release, 1 Elgin Avenue, London W9

BL Cup 351/61

The year that has passed since our inaugural meeting in 1975 has been an extremely important one for PIE and Paedophiles. We have seen our membership shoot up from 43 to 171, a successful London group which meets regularly has been formed, the contact page is now sent out once a month, and the Newsletter which is already greatly improved is to be turned into a magazine. On the campaigning side PIE will go down in the pages of history as contributing to changing social attitudes to sexuality. We have spoken in support of paedophilia to many groups, numerous letters have been written to newspapers and various other bodies, and articles have appeared in several journals. Hundreds of letters from paedophiles all over Britain, and abroad, have been answered.

Among our major achievements are the following:
The passing of a motion at the Campaign for Homosexual Equality’s conference in Sheffield, August 1975, in which the delegates held that paedophilia was an important subject. The result of which was the first positive publicity ever achieved on the paedophile issue in a British national daily newspaper in which the guilt free paedophiles viewpoint was expressed. Positive articles appeared in the Guardian, the Times Educational Supplement, Time Out and Gay News. This achievement, although slightly marred by an attack by John Torode a few days later, was magnified by the resulting discussion of the issues in both CHE and which appeared in the national press as a consequence of the motion.

Another conference causing quite a stir was the ‘Sexual Minorities Workshop’ held by MIND, the National Association of Mental Health, in September last year. At that I spoke about my own personal experiences as a paedophile. Not as an adult, but as a child growing ujp with an awareness of sexual feelings and of the social taboos. This awareness gradually formed from my earliest memories of them at 7 and 8 to the extreme guilt and isolation I felt when I became conscious of the unacceptability of first my homosexuality and then my paedophilia at 16 and 23. The candid nature of my speech shocked some conference delegates and touched others, and the lively and electric workshop group that followed effected many there. MIND-OUT the magazine of the institute ran a precis of my speech and published PIE’s address. However, not everyone likes to be told the truth, and News of the World reporters visited the offices of Tony Smythe the director of MIND after the conference to ask, in what I was told was rather an impertinent manner, why he was giving support to paedophiles. A female social worker who attended the conference also complained to Tony Smythe, and it was when criticising evidence supplied to the Criminal Law Revision Committee, in an article in the TIMES that Ronald Butt quoted part of the speech I gave at MIND.

The evidence that we supplied to the Home Office Criminal Law revision Committee in November 1975, proposing the abolition of ‘ages of consent’, and the removal of consensual sexual activity at all ages from the criminal law, was our most ambitious achievement so far, and I have been told by researchers and people involved in other pressure groups that it is the best evidence on the ‘age of consent’ issue they have seen to date. However, despite sending out a well prepared press release together with the report, to a comprehensive list of newspapers, radio and television companies and press agencies, the media coverage was sparse. Peace News, Gay News, Time Out and a little later Ronald butt in the Times carried mentions of the report, and I had unreported interviews with the Scotsman and the Daily Mirror, but there seemed to be a deliberate editorial silence. In fact the more I see printed about paedophilia and the more newspapers who refuse to publish letters of reply and journalists refuse to publish letters of reply and journalists refuse even to speak to me on the telephone, the more I feel that except for a few newspaper and magazines there is a policy to write only the negative arguments about adults who are sexually interested in children.

But despite the low level of press coverage of our PIE report it has affected many people who have read it. At a meeting of the Gay Rights sub-committee of the NCCL that I attended, changes were proposed to the draft NCCL evidence, including an incorporation of a few of the ideas and a couple of research quotes from our evidence. Copies of our evidence were sent to the executive of NCCL before their decision on their policy in this area was reached, and some of the proposals of the gay rights sub-committee were adopted. The section on paedophilia in the report would undoubtedly not have been as positive had it not been for our lobbying. Our report therefore had some effect on the NCCL evidence, which because of the sensational press coverage, has done more to raise the issue of the ‘age of consent’ than any other document. As a source of positive ideas and arguments towards paedophilia our report will continue to influence researchers, pressure groups and paedophiles who read it for a long time.

Presently we are near to the completion of the first stage in two other areas of work. We are compiling evidence on the ‘treatment’ of paedophiles with anti-libidinal drugs, that is chemical castration. We are particularly interested in those who are or were sex-offenders and who were treated with drugs such as Androcur, Benperidol, Oestrogen, etc. However, any information on this particular ‘treatment’ or any other maltreatment (including aversion therapy, physical violence etc) of paedophiles in or out of prison, is useful. We have started a campaign against this chemical castration, and we attempted to pass a motion calling on the NCCL AGM to condemn the practise [sic] on sex-offenders, but a move to refer the motion to the Executive Committee of NCCL was passed marginally. It is important therefore that we collect enough evidence to force this committee to use their organisation to campaign against chemical castration in the coming year. I spoke for the motion openly as a paedophile and this and another paedophile proposal certainly went a long way to educating NCCL members attending the meeting about paedophilia.

Data obtained from the PIE survey has been collated, and a report written, which will be published shortly. This contains some interesting results. PIE is no longer an exclusively male homosexual paedophile organisation. More and more male heterosexual and male bisexual paedophiles are joining. Another interesting fact is that the majority of our membership also relate sexually to adults as well as children. We must realise that we are a pan-sexual organisation and may have to work on all sexual liberation issues, while concentrating on paedophilia and children’s sexuality. In our survey, to help explain our results, it has been postulated that the definition of sexuality plays an important part in who is defined or who defines themselves as paedophile. An act which is objectively or subjectively defined by one person as sexual may not be by another person. This definition varies from culture to culture, sex to sex and from person to person. Females are treated differently from males and many acts which are regarded as being sexual in men are not regarded to be so in women. For instance, two men embracing is considered more a sexual relationship than two women embracing which is considered to be more of an emotional relationship. This could effect the definition of a woman as a paedophile, and explain why PIE has such few women members. Paedophilia is used to describe a sexual relationship with a child. Men are seen more in terms of sex than women and therefore would be more likely to define themselves as such. But this should not be used as an excuse nor the sole reason why we have such few women, and considering the nature of women’s oppression as woman, we should accept that a group in which the vast majority of members are men is not likely to attract women. PIE should as soon as we have enough women to do it, try to set up a separate group for women. We should allow them to use separate advertising and campaigning if necessary to attract more women paedophiles to join the fight with us.

As with a group for some areas of the UK, a group for those male paedophiles interested in little girls is already a viable proposition. A group can be formed on, a letter writing basis if someone co-ordinates this. How about volunteer co-ordinators for this, or any regional groups contacting the PIE executive committee as soon as possible?

Despite all this progress and activity, any achievements have been made under difficult circumstances. The press and police harrassment [sic] of PAL, the Playland Trial and the ‘Johnny Go Home’ programme have all contributed to make sure paedophiles remain oppressed. The ‘expose’ of PAL caused panick [sic] among some of the then serving E.C. members of PIE. Michael Hanson had planned to resign many months before the Sunday People article because of a move to live in Greece. Other E.C. members however, caught fright and it was left to me and co-opted E.C. member Warren Middleton to keep PIE alive. We did this believing that the only way for PIE to survive was to seek out as much publicity for the organisation as possible and that if we got bad publicity we would not run into a corner but stand and fight. We felt that the only way to get more paedophiles joining PIE, particularly more male heterosexual paedophiles and female paedophiles in general was to seek out and try to get all kinds of publications to print our organisations name and address and to make paedophilia a real public issue. But PIE has not come out of all this without receiving all kinds of attacks. John Torode in the Guardian wrote three articles condemning us and our ‘Sheffield motion to CHE’. The hysteria in this article showed that even some of those who are regarded as serious and liberal journalists cannot even discuss paedophilia rationally. Ronald Butt, not the most egalitarian of people, wrote an attack on our aims and my speech to the MIND conference and this was printed as the Times newspapers somewhat pathetic contribution to the discussion on sexual law reform. The NCCL evidence was received with a kind of paranoia by editors and journalists. The Daily Telegraph was still twitching with snide editorials about it weeks after it had been released. Some members may see these attacks as nothing but harmful and I would agree they are biased against us, but even some of the worst attacks have quoted some of what we say, and some of the quotes are even in context. The Ronald Butt article is an example in question, although he attacks Lord Beaumont savagely he obviously believes that we will be condemned by our own words. What I say is let them continue – we will win in the end!

More serious a handicap for PIE was the loss of our British Monomark address. This was as a result of the News of the World (they seem fond of us) harrasment [sic] of the staff of this mailing service. The directors reused to handle our mail from then on, despite our obvious victim role in the whole affair. As a consequence we had no address for a period of 2 or 3 weeks. Through very hard work a new address was found. Many commercial firms refused to handle our mail after they heard about British Monomark and some were too expensive, and because we felt the same thing might happen again, we tried alternative and left wing organisations. We knew that it was more likely that they would accept we had a right not to be molested and help us. RELEASE did, and we are truly grateful to them. They have assured us that visiting News of the World reporters would not get a comfortable ride. Since we used to pay for the BM address, I move that we give release the same amount each year in donations. At the moment we pay them nothing. The loss of our address meant that many letters sent to us have had to be destroyed and that many people despite being informed of our new address may refer people to our old address by mistake. It is a mammoth task contacting again all those organisations informed of our existence and let me apologise publicly to any we may have overlooked.

We have had an extremely rough ride due to outside attacks but this has not been the only cause of hardship. With inflation and the rise in membership we have been running at a very substantial loss. Approaching a 50% loss! If it had not been for donations generously given in the past, particularly by Warren Middleton and past Newsletter editors, there would be no PIE. Despite this we have improved the Newsletter size and content, we have now started to run the contact page once a month, meetings in London are meeting more regularly and a series of campaigns and special projects are under way. We do this not because we are mad, but because we believe we are still only doing the minimum to achieve our aims. We want to see many more improvements to the services to our members, but to do this we have been forced to raise the membership to four pounds for U.K. and Ireland (Two pounds for non-earners) and seven pounds in other countries. Yet to achieve all that is necessary we need more money still. We have a number of ideas for making money for PIE, and need others, and help, to bring our ideas into practise [sic]. If you think you can help lease make contact with the E.C.

Keith Hose
8th May 1976

Back cover says ‘This report was adopted at the Annual General Meeting 8th May 1976.’


PIE – documentary evidence 4 – UP, ‘Childhood Rights’, and Paedophilia – some questions and answers

[NOTE OF WARNING: In absolutely no sense whatsoever does the printing of the below material constitute any type of endorsement; in fact the very reverse]

Below is a range of material from PIE’s first journal Understanding Paedophilia, the predecessor of Magpie. I have copied the most significant material from those issues I was able to access.

Vol. 1 No. 2, June/July 1976

Cover pic: tearful Mark Lester, from film Run Wild, Run Free (1969)

p. 2. ‘Notices’
Ed: Warren Middleton (p)
Research Director: Humphfrey Barton (p)
Regular Correspondents; Steve Barker (p), USA, Graeme Parrish (p), New Zealand, Bernard Beafort (p), France, Richard Docker (p), Australia, J E Rekustad, NAFP/Norway.
Regular Contributors: Keith R Hose, John Bradshaw (p), Humphfrey Barton, Dr Frits Bernard, Dr Edward Brongersma, Warren Middleton, Tom O’Carroll.
[‘(p)’ indicates a pseudonym]

Dr Edward Brongersma, ‘Love In Education: The Unapproachable Risk’, pp. 2-4

Cyril Halley (p), ‘Lewis Carroll Revisited’, pp. 4-5
[…]
Lewis Carroll spent his life sublimating what he regarded as ‘abnormal desires’. Yet his love for children was hardly surpassed in his own, or any other age, and his contributions to world literature certainly need no further appraisal. He died at Guilford on January the 14th, 1898, and his gravestone carries the name Charles Lutwidge Dodgson made immortal… HERE LIES THE REMAINS OF LEWIS CARROLL, AND CHILDREN THE WORLD OVER CAN REMEMBER THEIR LOVING FRIEND.’ (p. 5)

Review of William Kraemer (ed), The Forbidden Love: The Normal & Abnormal Love of Children, reviewed by Humphrey Barton (p) (a lecturer in sociology at a British university), p. 5.

Alan Stanley, ‘Angels of the Lyre’, p. 6. Reviewed by Warren Middleton.

‘It’s the Magnificent Six’, p. 7
New EC:
Keith Hose – re-elected to serve as National Chairperson for the coming year
Warren Middleton – re-elected as National Vice Chairperson/PIE Magazine Editor
Tom O’Carroll – elected as PIE General Secretary/responsible for the formation of local groups/PIE members’ contact service/Publicity
David C Grove – elected as Director of PIE’s forthcoming children’s rights campaign/responsible for distribution of mail
Charles Napier – elected as Treasurer/responsible for recruitment of new members.
Peter Righton – elected as Organiser of prison-hospital visits/general correspondence/PIE befriending.
Want applicants for Legal adviser and Director of Research.

‘PIE has asked U.P. to convey their thanks to all who attended the AGM, especially Miss Nettie Pollard of the NCCL, and PIE member No. 149 who came direct from France for the event.’ (p. 7)

‘Concern over List 99’, p. 7
NCCL concerned about an envelope which has gone missing, containing a ‘secret’ government file, a DoE blacklist of 1000 people said to be unfit for the teaching profession.
Nettie Pollard has appealed for anyone who thinks they may be included on the list to come forward.

‘Judge Slams Sex Law’, p. 7
Justice Neil McKinnon, QC attacked age of consent law as ‘An attempt to protect fully mature young women against their own natural inclinations’. After 22 year old Jonathan Groves and his brother David were in court having admitted having intercourse with two 15-year old schoolgirls. Jonathan received conditional discharge, and David a suspended 9 months jail sentence.

‘P.C. ‘Whacko’ Quits’, p. 8
Ex P.C. Anthony Betteridge, 36, fired after admitting to five charges of assault, indecent assault and gross indecency with young boys.

‘PIE’s New Campaign’, p. 8
An inquiry into physical/chemical castration of sex offenders.

Vol. 1 No. 3, Aug/Sept 1976

Cover ‘The Modern Ganymede: Bjorn Andresen’, photo from Death in Venice

Douglas Sarff (‘NewsWest’ Editor), ‘Sex Begins At A Very Early Age: The Work and Theories of the Guyon Society’, pp. 2-4
Reprinted from an American gay journal

Tom O’Carroll, ‘News Report: The PIE Survey’, pp. 4-5
A questionnaire, basic things
In 2 years PIE has attracted over 200 members. 96 took part in the survey. Two were women.
Of men, 68% attracted to boys only, 13% to girls only, 19% to both.
One in five of male paedophiles were married. Much higher for heteros (75%) than homos (7%)
Majority (59%) also attracted to adults. (p. 4)

‘Your Letters’, pp. 5-6
One from ‘Charles Gerriovenski’, saying similar things to in later issue
Also from a former headmaster, ‘Michael Gooch’, who received a 12 month suspended sentence for ‘offences’ involving young boys.

Reviews of Desmond Stewart, The Vampire of Mons; John F Trimble, Paedophilia; Dr. George P Rossman, Paederasty: Sexual experience between Men and Boys. Reviewed by John Bradshaw (p), David Grove, Humphrey Barton (p) respectively., p. 6.

Grove bio, p. 6. Born in 1904, spent most of childhood in China, then studied history at Wadham College, Oxford. Lived in various parts of the world, including being Assistant Deputy Officer (Deputy Magistrate) in Nigeria. Enlisted in Welsh Guards, then into teaching career in 1939. Now retired.

‘Looking Around’, p. 7.
Review of Visconti Death in Venice.
[….]
‘Visconti had long toyed with the idea of bringing Mann’s masterpiece to the screen, but when reality supplanted the dream, eh was almost defeated by the casting of Tadzio, a part demanding a boy of rare beauty and exceptional charm.
His searches for this ‘perfect’ boy took the director all over Europe. But the gods appeared to favour him, finally rewarding his efforts in Scandinavia. Bjorn Andresen, his beautiful Swedish prodigy, seemed tailor-made for the casting, and with characteristic flair the delighted Visconti proclaimed him “the most beautiful boy in the world.”’
[….]

‘Dr Humphrey Barton gave a highly successful paper on paedophilia at the Manchester Gaysoc/British Sociological Association’s conference in early September.
The conference was well attended by other notables including Glenys Parry and Ken Plummer.
Nice one Humphrey!’ (p. 7)

‘The PIE-Do-File’
Author Yul Duersted has been withheld permission to publicise Pie in any of his future works. (p. 7)

PIE formally established two years ago in October by three members of Scottish Minorities Group under chairmanship of Michael Hanson. (p. 7) [This was a mistake – it was three, not two, years previously]

‘Exit Jenkins, Enter Rees’, p. 7
Asking if Merlyn Rees likely to be sympathetic. Not sure.

Vol. 1 No. 4 (1977)

Picture of Jodie Foster in Taxi Driver on front.
Editor: Warren Middleton
Research Director: Dr. Humphrey Barton (p)
Regular Contributors: Keith R. Hose, John Bradshaw (p) , Dr. Frits Bernard. Dr. Edward Brongersam, Tom O’Carroll, David C Grove, Dr. Humphrey Barton, Warren Middleton
Regular Correspondents; Steve Barker (p), USA, Graeme Lovejoy (p), New Zealand, Bernard Beaufort (p), France, Richard Docker (p), Australia, J E Rekustad, NAFF – Norway

Address given as 1, Elgin Avenue, London W9.
Printed by the Wellington Bureau, 23, Craven Street, Charing Cross WC2.

Special thanks with news item ‘fighting for justice’ on p. 10 of this issue – thanks Miss Nettie Pollard and the Executive Committee of the NCCL; Mr Mike Rowland, Mr John Gallagher and the EC of the Labour Campaign for Gay Rights; Jo Richardson, Labour MP for Barking; Mr Michael Burbidge of Icebreakers; Mr Antony Grey, ex Director of the Albany Trust; the staff of the People’s News Service; Mr Johannes Werres, editor GAY NEWS GERMANY/BOY LOVE NEWS; Mr Michael Mason, news editor GAY NEWS; Dr. Arabella Melville and Colin Johnson, editors of LIBERTINE; the PEACE NEWS collective; Mr Andy Leighton and staff of IT; and last but by no means least, to Mr Keith Hose, Mr Tom O’Carroll and the remainder of PIE’s EC. (all p. 2)

https://ianpace.wordpress.com/category/nccl-2/page/2/

Harriet Harman and Jo Richardson 1989

 

 

6-7-78

Nettie & (Mike) Rowland:

Protection of Children Bill: Lords Amendment to be debated Friday 14th July. Spoke  to Jo (Richardson) last night. She does not want to be the only one to put down amendments. She will try to find others who will also amend. I’ve notified her of date.

HH  (Harriet Harmen)

The ‘right’ to sleep with children was one ‘civil liberty’ that NCCL supported

The Seventies was an era of sudden sexual emancipation. To some on the Left, sex with children was just another boundary to be swept away

Harriet Harman with her husband Jack Dromey after her victory in the Peckham by-election in 1982

Harriet Harman with her husband Jack Dromey
In 1975, NCCL had granted PIE official “affiliate” status. It put O’Carroll on one of its working groups, it made him a platform speaker at an NCCL conference in spring 1977, and it strongly defended paedophiles against “hysterical and inaccurate” newspaper attacks.

…The book, a manifesto for the legalisation of sex with children, is called Paedophilia: The Radical Case. O’Carroll was a teacher, and the “raven-haired little charmer” was one of his pupils, an 11-year-old schoolboy called Chris. Uncle Herman was in his fifties, and the girl he had sex with was 12.

But most unusually of all, O’Carroll’s foreword, with its passionate plea not to “deny children their sexual life, including the possibility of sexual contact with adults”, expresses his “heartfelt thanks” to those who helped him write his rallying-call, “especially… Ms Nettie Pollard of the National Council for Civil Liberties (NCCL) [who] read the whole text in draft and made many helpful suggestions”.

O’Carroll had been a “sexually predatory” paedophile, “determined to find a boy, or boys, for what I assured myself would be mutually pleasurable and affectionate sex… All I had to do was pop out to the nearest canal bank, or swimming baths, or park.” After this didn’t work, he “rained letters” on Chris, then turned up on the child’s doorstep “emboldened by drink, and aggressive with it”. O’Carroll was any parent’s darkest nightmare.

at the time this book was published, in 1980, O’Carroll and the Paedophile Information Exchange (PIE) – a body founded to openly lobby for child sex – were part of NCCL, now Liberty, Britain’s foremost mainstream civil rights organisation.

For most of the Seventies and early Eighties, the “right” to sleep with children was one of the “civil liberties” that NCCL supported and the policy differences with PIE were ones only of degree. PIE favoured lowering the age of sexual consent broadly to four.

nettie-pollard

Pensioner backed Paedophile Information Exchange and may hold key to links with left wing groups

Nettie Pollard was a key figure in the London left – a Sunday People investigation reveals her to be a chief apologist for some of PIE’s most chilling demands

Even those who have lived beside her for years have little idea about her life – none of her neighbours has ever been invited inside the home she has lived in alone for almost 30 years.

But 69-year-old Nettie Pollard may hold the key to how the Paedophile Information Exchange infiltrated left wing groups in the 1970s.

She was a key figure in the London left, working for the National Council for Civil Liberties for two decades.

But a Sunday People investigation reveals Pollard to be chief apologist for some of PIE’s most chilling demands.

Our investigation found that throughout her career Pollard gave a constant stream of support to paedophiles and promoted their views. She also:

  • Supported PIE’s call to scrap the age of consent.
  • Argued against the introduction of a bill to protect children.
  • Sat on committees with known ­paedophiles and PIE members.
  • Wrote a twisted essay defending sex between adults and children.

It emerged MP Harriet Harman, ­husband Jack Dromey and former Health Secretary Patricia Hewitt had been involved with the NCCL when PIE was affiliated to it.

Mrs Harman has subsequently moved to distance herself from Pollard and paedophiles, with a spokesman stating they “did not influence any of the work she did there”.

Image result for harriet harman pie

However one source involved with the London left in the 70s claims – ­embarrassingly for Mrs Harman – that she and Pollard did work together on occasions within the NCCL .

The source said: “Nettie was a big presence in the movement back in the 1970s and couldn’t be ignored by anyone wanting to get on in the NCCL.”

Our investigation first places Pollard in 1975 working as the Gay and Lesbian Officer for the NCCL.

And that brought her into close ­contact with the infamous PIE – the child sex group which campaigned to have the age of consent lowered or scrapped.

As well as her role at the NCCL, Pollard was and remains a significant member of the Campaign for Homosexual Equality – a group that defended PIE’s rights at their 1983 conference.

But even after PIE was disbanded in 1984, Pollard made no secret of her ­sympathy for the organisation’s aims.

In 1993 she contributed a ­defence of the ­sexualisation of youngsters to a book called Bad Girls and Dirty Pictures.

Entitled The Small Matter of Children, Pollard’s essay draws on work by known paedophiles such as former PIE vice-chair Warren Middleton to build its case.

Pollard argues child sex should be legal if the act is “consensual”.

It also uses language like “willing partners” to describe sex between adults and children.

But by far the most disturbing section is Pollard’s attempt to justify the sexualisation of children.

She writes: “Far from being ‘innocent’ and becoming sexual at puberty, as was once the common belief, it is now indisputable that everyone is sexual, even before birth.”

The research cited was also used in PIE’s bid to reduce the age of consent to just four.

Pollard continued to work for the NCCL until her mysterious ­departure from the group in 1997.

She was made redundant but reports from Feminists Against Censorship implies murkier reasons ­behind her exit.

A ­newsletter from the time reads: “Within the last several months, two of NCCL’s employees have remarked that the organisation’s longest-serving staff member, Nettie Pollard, was the last civil libertarian left on the payroll.”

Challenging the cost-cutting explanation given it added: “Since she is one of the few indispensable staff members, and the most ­expensive to make redundant, we suspect economy is not the reason.”

Pollard, whose Facebook page currently shows her support for causes including an anti-drones campaign and attacks on the “Big Brother” state, also showcases her taste in music with a link to indie rock band The Donutsh – described by one of their following as sounding “like Johnny Cash biting off Johnny Rotten’s head”.

She refused to answer the door to us when we visited her home.

Tom O’Carroll was invited to address an NCCL conference, and sat on an NCCL gay rights sub-committee alongside Nettie Pollard. When O’Carroll was finally arrested in 1981 — and later convicted — for conspiring to corrupt public morals, the NCCL expressed its outrage at the ‘deplorable nature of the conspiracy charge used by the prosecution’, to quote the words of Patricia Hewitt at the time.

In the group’s official publication, The NCCL Guide To Your Rights, an address was provided for the Paedophile Information Exchange at Elgin Avenue in West London. This was, in fact, the base of Release, an ultra-liberal drugs charity that received funding from the Home Office.

http://www.dailymail.co.uk/news/article-2570675/The-Lefts-web-shame-Its-not-just-Harman-Dromey-Hewitt-As-reveal-members-Britains-ruling-liberal-elite-held-senior-posts-NCCL-closely-linked-paedophiles.html

Cassandra Cogno‏ @CassandraCogno

On the right hands in the pockets of her coat is PIE member no 30 Nettie Pollard – protesting the hypocrisy of Thorpe esp re the Dilly Boys?

Tides Of History‏ @labour_history

1979: Thorpe cleared of murder charges. Former Liberal Party leader Jeremy Thorpe is cleared of the attempted murder of Norman Scott. He hails his acquittal as “a complete vindication”. The case is due to be re-opened.

 Image result for harriet harman and nettie pollard
Harriet Harman and Peter Tatchell

Feb 2014: Convicted paedophile, PIE member, Tom O’Carroll told The Guardian he remained a member of the NCCL’s gay rights committee for several years after Harman claimed his organisation was marginalised. NCCL archives in London have also shown how O’Carroll, a former chairman of PIE, asked Nettie Pollard, a staff member at the organisation, about the possibility of amendments to the 1978 child protection bill.

link

Nettie Pollard & Peter Tatchell

 
Peter Tatchell – Sexually-Explicit Images Bill 1992
 

List of sponsors of Graham Bright MP’s 1983 Bill

NCROPA ArchiveNCROPA Papers – 1983

link

Micheal Colvin.

MYSTERIOUS MICHAEL COLVIN

Romsey Conservative


Michael Colvin
link
Destroyed: The fire claimed the lives of the then Romsey Conservative MP Michael Colvin and his wife, Nichola, in 2000

Cause of fire that killed MP still a mystery

Jul 2000

THE cause of the country house fire in which the Tory MP Michael Colvin and his wife Nichola died may never be fully known, an inquest was told yesterday.

A discarded match or an overturned candle were the most likely reasons why Tangley House, near Winchester, Hampshire, was destroyed in February but despite months of work by investigators there could be no certainty, Grahame Short, the coroner for Mid Hampshire, was told. He recorded an open verdict after hearing that the couple were believed to have been overcome by smoke in their beds before the fire burnt the entire interior of the house.

The couple’s children, Jamie Cayzer-Colvin, Arabella Gaggero and Amanda Ponsonby, joined other family members at the inquest in Winchester.

Harry Marriott purchased the rubble and burnt timbers.

After Marriott moved in with his family, the then Bishop of Basingstoke, now Bishop of Dover, The Rt Rev Trevor Willmott, aided by another priest, Rev Ray Whettingsteel, ‘blessed’ the new house.

Derek Laud was one of the last people to speak with Micheal Colvin.


Implicated: Lord Justice Fulford, pictured in his full legal regalia, was named last year as an adviser to the Queen

Image result for justice fulford and queen

High Court judge and the child sex ring: Adviser to Queen was founder of paedophile support group to keep offenders out of jail

  • Lord Justice Fulford was named last year as an adviser to the Queen
  • He was a key backer of the notorious Paedophile Information Exchange
  • Police suspect the group of abusing children on an ‘industrial scale’
  • He is revealed as a founder member of campaign to defend PIE
  • At the time it was calling for the age of consent to be lowered to just four

One of Britain’s most senior judges actively campaigned to support a vile paedophile group that tried to legalise sex with children, The Mail on Sunday can reveal.

Lord Justice Fulford, named last year as an adviser to the Queen, was a key backer of the notorious Paedophile Information Exchange (PIE) which police suspect of abusing children on an ‘industrial scale’.

An investigation by the Mail on Sunday has discovered that Fulford was a founder member of a campaign to defend PIE while it was openly calling for the age of consent to be lowered to just four.

It can also be revealed that the Appeal Court judge and Privy Counsellor:

  • Planned demonstrations outside courts where defendants – described by prosecutors as ‘sick’ and a ‘force for evil’ – were on trial.
  • Wrote an article claiming PIE, now under investigation in the wake of the Jimmy Savile scandal, was merely a way for paedophiles to ‘make friends and offer each other mutual support’.
  • Sought help with the campaign from future Labour Minister Patricia Hewitt, then in charge of a controversial civil rights group.
  • Attended meetings to discuss tactics with PIE chairman Tom O’Carroll, who has since been jailed for possessing thousands of pictures of naked children.
  • Was praised by the paedophile group for coming to its defence.

Fulford was a founder member of an organisation called Conspiracy Against Public Morals set up to defend PIE leaders facing criminal charges.

t later published a sickening pamphlet claiming that children would be freed from the oppression of the state and their parents if they were allowed to have sex with adults.

The 60-page document, unearthed by The Mail on Sunday, is adorned with disturbing child-like pictures and sexual cartoons.

At the time the organisation went under a slightly different name but had the same postal address as Fulford’s group had.

When asked last night about his involvement in the group, Fulford said: ‘I have no memory of having been involved with its foundation or the detail of the work of this campaign.’

His Abominable Article

His Meeting With Pie Leader

He added that any contribution he made would have been in  general terms against a law  banning ‘conspiracy to corrupt public morals’ which he believed ‘could be used against a wide variety of people in potentially inappropriate ways’.

‘I have always been deeply opposed to paedophilia and I never supported the views of the PIE,’ he added.

Fulford is the most senior public figure to be implicated in the work of PIE.

Today’s revelations follow controversy over the roles of Labour grandees Patricia Hewitt, Harriet Harman and her husband Jack Dromey, who were all involved in the National Council for Civil Liberties (NCCL) when it counted paedophile activists among its members.

Last night Fulford said: ‘On reflection the NCCL gay rights committee should never have allowed members of PIE to attend any of its meetings.

‘I am very sorry for what happened. I have never espoused or in any way supported the objectives of PIE – the abuse of children – which I consider wholly wrong’.

The Paedophiles Celebrate

The Vile Pamphlet

Nonetheless, the revelations are likely to raise questions about what vetting he underwent during his career.

However Fulford insisted ‘There was nothing to report to the Lord Chancellor’s department… at the time of my various appointments.’

The revelations also prompted fresh calls for a full investigation of the links between the Establishment and paedophile groups, following long-running allegations of cover-ups.

Scotland Yard is already looking into PIE as part of Operation Fernbridge, its probe into allegations of a child sex ring involving senior politicians at a south London guest house.

Judge Ruled On Sex Cases

High Court judge and the child sex ring: Adviser to Queen was founder of paedophile support group to keep offenders out of jail

  • Lord Justice Fulford was named last year as an adviser to the Queen
  • He was a key backer of the notorious Paedophile Information Exchange
  • Police suspect the group of abusing children on an ‘industrial scale’
  • He is revealed as a founder member of campaign to defend PIE
  • At the time it was calling for the age of consent to be lowered to just four

One of Britain’s most senior judges actively campaigned to support a vile paedophile group that tried to legalise sex with children, The Mail on Sunday can reveal.

Lord Justice Fulford, named last year as an adviser to the Queen, was a key backer of the notorious Paedophile Information Exchange (PIE) which police suspect of abusing children on an ‘industrial scale’.

An investigation by the Mail on Sunday has discovered that Fulford was a founder member of a campaign to defend PIE while it was openly calling for the age of consent to be lowered to just four.

Implicated: Lord Justice Fulford, pictured in his full legal regalia, was named last year as an adviser to the Queen

Implicated: Lord Justice Fulford, pictured in his full legal regalia, was named last year as an adviser to the Queen

It can also be revealed that the Appeal Court judge and Privy Counsellor:

  • Planned demonstrations outside courts where defendants – described by prosecutors as ‘sick’ and a ‘force for evil’ – were on trial.
  • Wrote an article claiming PIE, now under investigation in the wake of the Jimmy Savile scandal, was merely a way for paedophiles to ‘make friends and offer each other mutual support’.
  • Sought help with the campaign from future Labour Minister Patricia Hewitt, then in charge of a controversial civil rights group.
  • Attended meetings to discuss tactics with PIE chairman Tom O’Carroll, who has since been jailed for possessing thousands of pictures of naked children.
  • Was praised by the paedophile group for coming to its defence.

Fulford was a founder member of an organisation called Conspiracy Against Public Morals set up to defend PIE leaders facing criminal charges.

It later published a sickening pamphlet claiming that children would be freed from the oppression of the state and their parents if they were allowed to have sex with adults.

The 60-page document, unearthed by The Mail on Sunday, is adorned with disturbing child-like pictures and sexual cartoons.

At the time the organisation went under a slightly different name but had the same postal address as Fulford’s group had.

When asked last night about his involvement in the group, Fulford said: ‘I have no memory of having been involved with its foundation or the detail of the work of this campaign.’

His Abominable Article

His Meeting With Pie Leader

‘I have always been deeply opposed to paedophilia and I never supported the views of the PIE,’ he added.

Fulford is the most senior public figure to be implicated in the work of PIE.

Today’s revelations follow controversy over the roles of Labour grandees Patricia Hewitt, Harriet Harman and her husband Jack Dromey, who were all involved in the National Council for Civil Liberties (NCCL) when it counted paedophile activists among its members.

Last night Fulford said: ‘On reflection the NCCL gay rights committee should never have allowed members of PIE to attend any of its meetings.

‘I am very sorry for what happened. I have never espoused or in any way supported the objectives of PIE – the abuse of children – which I consider wholly wrong’.

The Paedophiles Celebrate

The Vile Pamphlet

Nonetheless, the revelations are likely to raise questions about what vetting he underwent during his career.

However Fulford insisted ‘There was nothing to report to the Lord Chancellor’s department… at the time of my various appointments.’

The revelations also prompted fresh calls for a full investigation of the links between the Establishment and paedophile groups, following long-running allegations of cover-ups.

Scotland Yard is already looking into PIE as part of Operation Fernbridge, its probe into allegations of a child sex ring involving senior politicians at a south London guest house.

Judge Ruled On Sex Cases

As The Mail on Sunday revealed last year, the Home Office is also carrying out urgent checks into a whistle-blower’s claims that taxpayers’ money was handed to PIE.

Labour MP Tom Watson said: ‘Today’s revelations reinforce the argument that there should be a full investigation into the role of PIE.

‘It’s incredible that someone of such distinguished legal authority could misunderstand the need to protect children.’

Tory MP Sir Paul Beresford added: ‘I find it staggering. It wasn’t a clever or appropriate campaign. They were a paedophile group and at the end of the chain were little children’.’

Peter Saunders of the National Association for People Abused in Childhood, said it was ‘more than alarming’ that anyone in the judiciary could be linked to PIE.

Fulford, now 61, is the most senior public figure to be exposed as an apologist for paedophiles among Left-wing political groups of the 1970s and 1980s.

He has enjoyed a stellar rise through the legal profession, becoming a QC in 1994 and a part-time judge the following year.

In 2002 he became the first openly gay High Court judge, being nominated for a knighthood by Tony Blair, and in 2003 took up a prestigious role at the International Criminal Court in The Hague.

Last year he was nominated as an Appeal Court judge by David Cameron and appointed to the Privy Council, the elite group of senior politicians, judges and clergy who advise the Queen on constitutional matters.

Back in the late 1970s he was a newly qualified Left-wing barrister when he joined the NCCL, now known as Liberty, which had links to known paedophile groups and attempted to lower the age of consent to 14 and water down child pornography laws

Fulford’s involvement with the radical movement to legalise child sex goes even further than that of the Labour Ministers, documents uncovered by The Mail on Sunday show.

He personally set up a group to support the ‘executive committee’ of PIE in the summer of 1979, after they had their homes raided by police.

Images of child abuse and group literature were seized and five leaders, including chairman O’Carroll, were charged with the rare offence of ‘conspiracy to corrupt public morals’.

Fulford and his colleagues called the organisation the Conspiracy Against Public Morals (CAPM), and it went on to distribute leaflets calling for the PIE ‘show trial’ to be dropped, and held protests outside courtrooms.

In October 1979 Fulford wrote a full-page article in gay rights magazine Broadsheet, in which he was described as ‘the founder’ of the PIE support group.

He claimed that classified adverts placed by PIE members, which led to the trial,  were ‘simply to enable paedophiles to make friends and offer each other mutual support’ rather than to contact children or exchange banned images.

A leaflet distributed by CAPM and available through PIE’s mailing list went further, claiming: ‘This is a trumped-up charge designed to silence a group merely because it is unpopular with the guardians of public morality.’

And the prosecution was condemned as ‘an attack on PIE’s right to freedom of speech and freedom of association’.

A longer briefing note put together by the CAPM called the paedophiles a ‘minority group ripe for bashing’ because they were open about their aims.

In 1980, a Marxist collective used the almost identical name, Campaign Against Public Morals, and the same Central London PO Box address as Fulford’s group to publish a 60-page diatribe that called for the age of consent to be scrapped ‘for the liberation of children’.

Patricia Hewitt

Harriet Harman

The revelations follow controversy over the roles of Labour grandees Patricia Hewitt, left, and Harriet Harman, who were all involved in the National Council for Civil Liberties when it counted paedophile activists among its members

Fulford successfully proposed a motion at the August 1979 conference of an established gay rights group, the Campaign for Homosexual Equality, that it should affiliate itself to his new group and also call for the PIE leaders to be cleared.

His actions were praised in the paedophiles’ in-house journal, Magpie, which declared: ‘No longer alone – new group to support PIE’ and said they ‘owed much to a speech by barrister Adrian Fulford, which Gay News declared to be the best made at the conference.’

The following month the CAPM held its third meeting at which Fulford and O’Carroll himself were present, as well as several members of the NCCL gay rights committee.

Minutes of the gathering show that they discussed picketing the magistrates court where the PIE defendants appeared and state ‘Adrian’ would ‘ask Patricia Hewitt about the possibilities of using NCCL’s number to take messages’.

Probe: Labour MP Tom Watson said there should be a full investigation into the role of PIE

Records show PIE leader O’Carroll – who was jailed for two years in 1981 – was a member of the gay rights committee at the same time as Fulford.

The paedophile group was often discussed at the gay rights committee’s meetings, and O’Carroll was given its support as he came under increasing public pressure.

Last night, Fulford admitted he attended meetings of the NCCL gay rights committee when O’Carroll was there, but added that his presence ‘left me feeling extremely uncomfortable’.

He added: ‘In the main, I provided some legal advice in the context of general civil liberties objections to the wide-ranging charge of conspiracy to corrupt public morals.’ And he stated that he has never wanted the age of consent to be lower than it is now.

PIE folded in 1984 after the arrest of several more leading figures, including one – Steven Adrian  Smith – who had worked at the Home Office.

Miss Hewitt, Miss Harman and Mr Dromey have now expressed regret for the paedophile activists involvement with the NCCL, while insisting they never condoned child sex and that PIE did not influence their policies.

However archive material shows the NCCL’s Nettie Pollard actually invited PIE to become an affiliate group in 1975, offering them the chance to propose motions and take votes at its conferences.

Last night, Fulford said: ‘On reflection, the NCCL gay rights committee should never have allowed members of PIE to attend any of its meetings and a clear separation should have been created with the two organisations.’


Harriet Harman, PIE , etc …..

Is Peter Tatchell A Paedophile Or Simply Misunderstood?

Peter Tatchell was born in Melbourne Australia on 25th January 1952, he moved to London in 1971 to avoid conscription. In 1978 Tatchell joined the Labour Party and moved to Bermondsey, South East London. Tatchell ran as the Bermondsey Labour Party candidate in the 1983 General Election. Despite Bermondsey being a Labour stronghold he lost to Liberal candidate Simon Hughes. In February 2000 he left the Labour Party for unknown reasons. In 2004 he joined the Green Party and was chosen to be their candidate for Oxford East in the 2010 General Election, however for some reason he withdrew his candidacy in 2009.
Comrade Tatchell
Peter Tatchell (the UK’s most prominent homosexual activist and a favourite of the BBC) has done more than demand the abolition of the age of consent, he has broken the law on the age of consent in Britain at least once.

Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophilie apologist.
They have also refused to state how much they have paid him for appearances.

As a gay 18-year-old Australian anti-Vietnam war draft-dodger, he came to the UK in 1971 and lived with a 16-year-old boy in London. The homosexual age of consent in England at the time was 21. Later he campaigned for lowering it to 16, and now he wants it lowered again to 14. What will he want after that?

When the age of consent for homosexuals was lowered to 16 an Outrage (Tatchell’s organization) banner said “16 is just a start” – it didn’t state what the end goal was.

Mr Tatchell criticises the age of consent laws. Here is a quotation from his own website:

“Nevertheless, like any minimum age, it is arbitrary and fails to acknowledge that different people mature sexually at different ages. A few are ready for sex at 12; others not until they’re 20. Having a single, inflexible age of consent doesn’t take into account these differences. It dogmatically imposes a limit, regardless of individual circumstances“.

Peter Tatchell wrote the chapter “Questioning Ages of Majority and Ages of Consent” for a book openly advocating paedophilia and finding ways “to make paedophilia acceptable“.

This book, published in 1986 and called The Betrayal of Youth (B.O.Y.), was edited by Warren Middleton, then vice-chairperson of the Paedophile Information Exchange, Britain’s number one paedophile advocacy group.

[Truthseeker1@thewakeupcall09

It was high level PIE members that contributed to The Betrayal of Youth

So Peter Tatchell is the only none PIE member in The Betrayal of youth ?]


Arlo Tatum,[1] the executive secretary of the Central Committee for Conscientious Objectors, sued Melvin Laird, the Secretary of Defense. Tatum sued after Washington Monthly published an article revealing that US military intelligence units were gathering https://twitter.com/cassandracognointelligence on civilians and civil organizations in the US.[2]

8

Arlo Tatum moves to UK & joins Albany Trust after suing US army for alleged unlawful “surveillance of lawful citizen political activity.”

Tatum had composed and sung songs for Aldermaston peace marches during the 50s and had also become the Director of Peace News. [Arlo Tatum obituary, The Guardian 7 May 2014]

And Jack Straw’s autobiog reveals his MI5 file started from the Aldermaston marches

During 1975, while Paedophile Information Exchange member Roger Moody was working for Peace News he was promoting the organisation in its pages.

https://bitsofbooksblog.wordpress.com/2015/02/23/march-1977-albany-trust-arlo-tatum-peace-news-and-paedophiles/

2 female authors/contributors to PIE’s Warren Middleton’s B.O.Y were also involved with Peace News like Roger Moody

(Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from  Peace News.)

Peace/anti-nuclear campaigners heavily targeted by state surveillance since pre1970s to current day:

So how with all the surveillance were the paedophiles for peace lobbyists missed?

Or were they a useful control/eye on non-paedophile peace campaigners?

Were paedophiles used as informants on anti-nuclear protestors?

Perusing Peace News from 1975+ I was glad to find ONE letter to Editor saying what I was thinking….

paraphrased: “What’s with Peace News new preoccupation with paedophile rights? What’s it got to do with anti-nuclear/peace activism?”

Writer of letter was an extremely disappointed long-term subscriber who just couldn’t fathom what had changed for Peace News


Government lawyers…in a vain attempt to keep a lid on Peter Wright’s revelations, seem to be turning a blind eye toward Peace News – the paper published passages from Spycatcher.

The Guardian London, Greater London, England Wednesday,  September 2, 1987 – 36

https://twitter.com/thewakeupcall09/status/815908454078550016

https://twitter.com/thewakeupcall09/status/815908454078550016


@calamiTcat76

P.I.E member no 194 – JOHN HEIN – Scotia Pride, ScotsGay, Ian Campbell Dunn, LGBT Youth, Magic Circle, Child Abuse & Money Laundering

 

https://www.scribd.com/document/381957888/P-I-E-member-no-194-JOHN-HEIN-Scotia-Pride-ScotsGay-Ian-Campbell-Dunn-LGBT-Youth-Magic-Circle-Child-Abuse-Money-Laundering

PIE’s Warren Middleton’s B.O.Y

Stephen Green, anti-paedophile campaigner wrote: “The book was part of a campaign to abolish all ages of consent, destroy the responsibilities of parents for their children, deny any ill-effects on children of interference by paedophiles, and withal to make it easier for paedophiles to gain sexual access to children.“

In The Betrayal of Youth Tatchell wrote that the age of sexual consent is “Reinforcing a set of increasingly quaint, minority moral values left over from the Victorian era“.

Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.
Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.

He was not on his own in this belief.Many of his fellow socio-communists and homosexual activists thought the same:

Campaign for Homosexual Equality chairman Michael Jarrett was identifying paedophiles as an oppressed group, and the CHE list of “demands” included the complete abolition of minimum ages for sexual activity. The Labour Gay Rights Manifesto of 1985 said ‘A socialist society would supersede the family household. … Gay people and children should have the right to live together. … It follows from what we have already said that we favour the abolition of the age of consent.’

27092011583[1]

Feminists like Beatrice Faust contributed to The Betrayal of Youth, as well as other homosexual activists besides Tatchell, including Jeffrey Weeks and Eric Presland, who “related his first paedophile experience with an Asian boy of thirteen, and boasted of interfering with a little boy of six“.

The book is considered so toxic that Amazon doesn’t sell it and you cannot search its content in Google Books.

Tatchell is well aware of how much all this is bad publicity for him and keeps rationalizing and adjusting his positions, but only the ideologically blind or pathologically naive cannot see through his self-excuses.

He has prepared a standard self-defence which can be found on his own website and has been repeated verbatim on many outlets. It used to also be on the site of his friend militant atheist, Richard Dawkins, but it’s not there any more. Maybe even Dawkins draws a line at what is morally allowed, even though his motto is “There’s probably no God – now stop worrying and enjoy your life”.

In this article that supposedly should serve to exculpate him, Tatchell has nothing better than this: “The critics also cite Warren Middleton’s 1980s book, Betrayal of Youth, to which I contributed a chapter. I had no idea that he was involved in child sex abuse matters when I was asked to write.”

Considering that Warren Middleton was co-founder and vice-chairperson of the Paedophile Information Exchange (PIE), a prominent group promoting paedophilia, it was impossible for Tatchell not to have known his propensities. In addition, both Tatchell and Middleton were part of the Gay Liberation Front/Angry Brigade, a neo-Marxist revolutionary group of radical students at the London School of Economics, thus making Tatchell’s protestations of ignorance verge on the ridiculous.

Peter Righton of the Paedophile Information Exchange.
Peter Righton of the Paedophile Information Exchange – a Child welfare expert who wanted the age of consent lowering to four.

Were you aware that Tatchell contributed a chapter to this book?

THE BETRAYAL OF YOUTH

The contents and contributors of The Betrayal of Youth:

Chapter 1: ‘Incest’ by Clive Coliman: Described as “An ardent supporter of the children’s rights movement.”

Chapter 2: ‘Child Pornography and Erotica’ by Richard Green: Illustrator for the Paedophile Information Exchange magazine under the pseudonym “Dominik”

Chapter 3: ‘Child Prostitution’ by Warren Middleton of P.I.E.

Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from the anti-Christian Peace News.

Chapter 5: ‘Power and Consent’ by Eric Presland: Homosexual activist. Contributed also to the American paedophile book “The Age Taboo.”

Chapter 6: ‘Love and Let Love’ by Tuppy Owens, Editor of the Sex Maniac’s Diary, and Tom O’Carroll: ex-Chairman of P.I.E. who was convicted in 1981 of conspiracy to corrupt public morals by sending out a paedophile contact list.

Chapter 7: ‘Children and Sex’ by Fr Michael Ingram: Catholic priest, defender of paedophilia.

Chapter 8: ‘The Paedophiles’ by Beatrice Faust: militant feminist & civil libertarian.

Chapter 9: ‘Questioning Ages of Majority and Ages of Consent’ by Peter Tatchell.

Chapter 10: ‘Ends and Means: How to Make Paedophilia Acceptable?’ by Roger Moody of Peace News: “One of the most outspoken advocates of children’s rights in Britain .” Well-documented as a ubiquitous paedophile intellectual.

Chapter 11: ‘Socialism, Class, and Children’s Rights’ by John Lindsay: “ardent supporter of children’s rights.” Member of the Socialist Workers’ Party. Homosexual activist, hates the institution of the family.

Chapter 12: ‘Childhood Sexuality and Paedophilia: Some Questions Answered’ by Warren Middleton of P.I.E.

Chapter 13: ‘The Oppression of the Young: An Inside Perspective’ by Jeff Vernon: Involved in Gay Youth Movement and Campaign for Homosexual Equality.

Appendix 1: “P.I.E., from 1980 Until its Demise in 1985” by Steven A. Smith: ex-chairman of P.I.E. Fled to Holland in 1984, became “active in the Dutch crusade for children’s rights,” was deported back to the UK in 1991 and sentenced to 18 months for sending indecent articles through the post.

Appendix 2: “The Uranians” by Timothy d’Arch Smith: Bookseller. Author of “Love in Earnest.”

Peter Tatchell’s self-defence begins with:

“Unlike many Catholic clergy, I have never abused anyone. Unlike the Pope, I have never failed to report abusers or covered up their crimes.”

These are blatant falsities. It wasn’t many Catholic clergy, it was an extremely small minority. And, as shown in Lies About The Catholic Church Child Sex Abuse Scandal, there is no reason, except bigotry and prejudice, to single out Catholic clergy who in fact have committed fewer of these crimes than any other pedagogic institution, religious or secular.

Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religous values.
Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religious values.

Saying what he does about the Pope is a criminal act, it is slander. The Pope has never covered up for anyone.Tatchell and his friends in the mainstream media (especially the BBC) think that if you repeat a lie enough times your audience will start to believe that it’s true.

But blaming the Church whenever you’re in trouble is a good way to distract the public from your own deviations from the norm. It’s worked so far so why shouldn’t it work now? Maybe because people have started calling your bluff, Pete.

Peter Tatchell has a seething hatred of Christian morals and values.
Peter Tatchell has a seething hatred of Christian morals and values.

The above should tell you how trustworthy and credible Tatchell is, but there’s more.

Look at his defence of the book Dares To Speak:

“Dares to Speak was an academic book published in 1997, authored by professors, anthropologists, psychologists, sociologists, a Dutch senator and a former editor of a Catholic newspaper. It discussed the age of sexual consent and whether all sex between young people and adults is necessarily unwanted and harmful, based on what it said was objective research with young people.

The book does not endorse or excuse sexual relationships with young people that involve coercion, manipulation or damage. The authors queried, among other things, the balance between giving young people sexual rights and protecting them against abuse. These are entirely legitimate issues to discuss.”

Leaving aside the irony (probably lost on humorless Tatchell) about his using a “former editor of a Catholic newspaper” as a guarantor of the morality of a book while he constantly treats the Catholic Church like a den of abusers. The book Dares to Speak, that Tatchell praises so much as an academic achievement, was edited by Joseph Geraci, who was also the editor of Paidika: The Journal of Paedophilia. The book is a collection of articles from the journal.

Before it was quietly removed, this was Wikipedia’s entry for the publication:

Paidika: The Journal of Paedophilia (1987–1995) was a journal published by the Stichting Paidika Foundation whose purpose was to promote the normalization of pedophilia. Its editor was Joseph Geraci and the editorial board included articles by writers Frits Bernard, Edward Brongersma, Vern L. Bullough, and D. H. (Donald) Mader, some of whom campaigned as pro-pedophile activists.

After the normalization of homosexuality, we’ll have the normalization of paedophilia.


 

 

Graham Ovenden was a Guest Editorial of Paidika Journal of Paedophilia in 1994

PAIDIKA NUMBER 10 WINTER 1994: Guest Editorial: Fall from Grace, by Graham Ovenden

Paidika: The Journal of Paedophilia
Full-Text Files (PDF, GIF and plain-text searchable HTML)
Documents Not Likely to be Widely Available in Libraries
archived here by
Gerald Jones, Ph.D.
University of Southern California, 1964-2007:
Student, Lecturer, Adjunct Assistant Professor of Statistics, Staff (Retired)

15092011573[1]

http://zoompad.blogspot.co.uk/2013/06/paidika-number-10-winter-1994-guest.html


15092011573[1]
Here is Tatchell’s letter to the Guardian dated 26th June 1997 (a few weeks after Labour’s General Election win) which he denied writing when I asked him about it. However I can find no record of a complaint to the Guardian, the Press Complaints Commission or any lawsuit for libel:
Ros Coward (Why Dares to Speak says nothing useful, June 23) thinks it is “shocking” that Gay Men’s Press has published a book, Dares To Speak, which challenges the assumption that all sex involving children and adults is abusive. I think it is courageous. The distinguished psychologists and anthropologists cited in this book deserve to be heard. Offering a rational, informed perspective on sexual relations between younger and older people, they document examples of societies where consenting inter-generational sex is considered normal, beneficial and enjoyable by old and young alike.
Prof Gilbert Herdt points to the Sambia tribe of Papua New Guinea, where all young boys have sex with older warriors as part of their initiation into manhood. Far from being harmed, Prof Herdt says the boys grow up to be happy, well-adjusted husbands and fathers. The positive nature of some child-adult sexual relationships is not confined to non-Western cultures. Several of my friends – gay and straight, male and female – had sex with adults from the ages of nine to 13. None feel they were abused. All say it was their conscious choice and gave them great joy. While it may be impossible to condone paedophilia, it is time society acknowledged the truth that not all sex involving children is unwanted,abusive and harmful.
Peter Tatchell.
Picture 9
Peter Tatchell has repeatedly denied writing the letter above. However below is his reply in the Guardian (1st July 1997) to criticism of his original letter. In his second letter (below) he never denies writing the first letter (above) or claims he was edited in any way.
Peter Tachell’s second letter to the Guardian on 1st July 1997.
Peter Tachell’s second letter to the Guardian on 1st July 1997.

Peter Tatchell has often claimed he lives a monk-like existence living on a mere £9,000 income per annum. When I challenged him on this he changed his claim to £29,000 plus expenses. However he has refused to disclose his payments for his numerous main stream media appearances or disclose how much his yearly expenses are.
Peter Tatchell in his Council flat.
Peter Tatchell in his Bermondsey Council flat.

Peter Tatchell has declined to be interviewed for this article, however I will leave him the option of the right of reply in the comments section.

__________________

Known PaedophileSelection IICSA

Why was a FOI request turned down for reasons of national security?

Was Fraser working for the RUC or the British intelligence services and did they protect him?

Fraser must be a part of the IICSA as Fraser played a part in selecting and allocating children to be sent to the Kincora Boys Home.

 

 

Paedophile psychiatrist Morris Fraser and the Northern Ireland abuse inquiry

Includes detailed timeline and much more

http://www.academia.edu/34499583/Paedophile_psychiatrist_Morris_Fraser_and_the_Northern_Ireland_abuse_inquiry_-_Morris_Fraser_report_PART_II

Child Abuser Morris Fraser, Factual Errors by NI Child Abuse Inquiry

This post contains 3 items from Niall Meehan, Faculty Head, Journalism & Media, Griffith College, Dublin. They show the Northern Ireland Inquiry into “historical abuse” was factually incorrect about Morris Fraser and show Niall Meehan’s attempts to correct the record. It appears the authorities are slow to do this.

1. The first, the text of which is reproduced in this post and on this pdf [1] is a letter from Niall Meehan, pointing out serious deficiencies and errors of fact in the Northern Ireland Abuse (NIA) inquiry when it considered Morris Fraser in his work at Lissue Hospital and also police failures to inform NI Hospitals Authority and RUC of their investigation of Morris Fraser.

2. 2017 Sept Niall Meehan Report published previously in Spinwatch ‘Northern Ireland abuse inquiry (HIAI) failed to investigate paedophile doctor, Morris Fraser, who managed Lissue children’s psychiatric hospital’ pdf [2]

3. Niall Meehan Report published previously in 2017 Nov Village Magazine  ‘Stormont should correct HIAI report to reflect police paedophile delinquency’  pdf  [3]  

The text of Niall Meehans letter is as follows:-

1. Letter /Email from

To: David Sterling. Executive Office, NIO, Belfast
Copy to: James Brokenshire MP, Secretary of State for Northern Ireland
From Dr Niall Meehan, Faculty Head, Journalism & Media, Griffith College, Dublin.
16 November 2017

The HIAI and Dr Morris Fraser (2 pages)

Dear David Sterling,

On 17 May 1972 at Bow Street Magistrates’ Court London, a child psychiatrist
employed by the NI Hospitals Authority, Dr Maurice Fraser, pleaded guilty to abusing
a 13-year-old Belfast boy in London in August 1971.

I attach two reports I authored on Dr Morris Fraser, in September and (just published)
November 2017.

They are entitled:
‘Stormont should correct HIAI report to reflect police paedophile delinquency’, Village
magazine, November 2017 pdf [3]
• ‘Northern Ireland abuse inquiry (HIAI) failed to investigate paedophile doctor, Morris Fraser, who managed Lissue children’s psychiatric hospital’, Spinwatch, September 2017 pdf [2]

(I draw your attention also to my first, March 2016, report on Dr Fraser:  2016 Mar 31 Niall Meehan, ‘Morris Fraser, child abuse, corruption and collusion in Britain and Northern Ireland’ [4] )

Both reports detail a serious deficiency in the findings, and also errors of fact, in the
Report of the Historical Institutional Abuse Inquiry (HIAI), as they concern Dr Fraser.
I wish to make two points on that subject, which are supported by evidence cited in the
attached reports. I draw your attention in particular to copies of archival documents
(cited here) in my September 2017 report on Dr Fraser.

1. Fraser’s work in Lissue Children’s Psychiatric Unit
The January 2017 HIAI Report, chapter 26, page 82, briefly considered and then
dismissed discussion of Fraser’s work, and of his official treatment. It found that,
… the way the medical authorities and the police dealt with Dr Fraser after his conviction
in London are not matters that fall within the Terms of Reference of this Inquiry and we
have not considered them.

The conclusion was based on a finding, that relied on the 45-year-old memory of Dr
Fraser’s 1971-73 superior, Dr William Nelson, that Fraser’s work in 1972-3, with
institutionalised children in Lissue hospital’s child psychiatric unit, was peripheral, at
best, to his main work with outpatient children in the RVH. Inquiry paragraph 87 in
chapter 26 asserted, ‘There is no evidence of Dr Fraser’s work at Lissue’.

The HIA Inquiry dealt only with the treatment of institutionalised children
As my latest reports point out, the Inquiry ignored (and made no reference to the
possession of) documentary evidence sent to the Inquiry by the General Medical
Council (GMC) in September 2016.

A document, one of two July 1973 letters from
Fraser’s immediate superior, the same Dr William Nelson, for GMC consideration,
demonstrated that Fraser’s main work was in Lissue Hospital’s inpatient child
psychiatric unit, for at least a year after his May 1972 child abuse conviction.

The letter, dated 6 July 1973, stated also that Dr Fraser was promoted to medical manager
of the children’s psychiatric unit within that time period. Finally, Dr Nelson’s letter noted that Fraser interacted with social care workers in allocating vulnerable children to various institutions.

This latter point is in line with an allegation from Kincora Boys’ Home victim Richard Kerr, that the Inquiry attempted to undermine (though Kerr refused to interact with the Inquiry). A second letter from Dr Nelson, dated 11 July 1973, stated a willingness to accept Dr Fraser back working in the child psychiatric unit.

Therefore, the Inquiry decision to ignore investigation of Morris Fraser’s behaviour
and official treatment was contradicted by evidence in its possession, which the Inquiry
decided, irrationally, to ignore. The ignored evidence suggested that Investigation of
Fraser, a paedophile who interacted with vulnerable institutionalised children, was
within the HIA Inquiry’s terms of reference.
That concludes the first point.

2. Police failure to inform NI Hospitals Authority and RUC frustration of
GMC investigation of Morris Fraser

The second issue I bring to your attention concerns how Fraser came to be working
with children, though he was a convicted child abuser. That is because the London
Metropolitan Police plus the Royal Ulster Constabulary (and/or the NI Police
Authority) refused, contrary to explicitly stated official regulations (cited in the
attached November 2017 Village article [3]), to inform the NI Hospitals Authority of Dr
Fraser’s unreported (by the media) May 1971 conviction.

Had the HIA Inquiry found, correctly, that Fraser’s behaviour and treatment was
within its terms of reference, it would have been bound to investigate why the RUC
(and/or the NI Police Authority) failed in its duty to inform a hospital authority that an
internationally known child psychiatrist it employed was also a child abuser. The
police authority admitted an obligation to inform, through duplicating Metropolitan
Police notification to the GMC.

The HIAI would have been obliged also to consider other GMC evidence in its
possession, indicating that the RUC, in particular, frustrated, and also thereby delayed,
the GMC’s investigation of Fraser. The HIAI would have been bound to consider RUC
culpability in the subsequent abuse of children, by a career paedophile whose object
was to scan an available child population in order to select those he might abuse.
The HIAI failed in its duty to investigate a proven paedophile who worked with
vulnerable institutionalised Northern Ireland children.

For that reason I ask you to refer back to the Inquiry those findings and errors of fact as
they concern Dr Morris Fraser, that are clearly contrary to evidence available to the
Inquiry. I ask you also to bring these observations to the attention of responsible
ministers.
When may I expect notification of your decision(s) in relation to this matter and
considered reply?

Yours sincerely,
Dr. Niall Meehan

                                                                      Morris Fraser




BBC presenter was linked to the Paedophile Information Exchange

This article was published in the Mirror the day after Tom Watson’s PMQ in October.

PIE, which is now outlawed, also had links with another BBC presenter who was investigated over child sex allegations in the late 80s. Like Savile, the unnamed star was accused of using a charity as a cover to abuse vulnerable children. The charity was set up by a PIE member in the 80s, offering yachting classes to vulnerable and underprivileged children.

The BBC presenter was ­investigated after police became aware of allegations he was abusing boys during sailing trips. No charges were ever brought against the star for reasons that remain unclear.A child protection source said yesterday: “The presenter was going out on a boat with vulnerable children and a leading former member of PIE.

“The charity was being used as a way of taking indecent pictures of the boys and there was also physical abuse occurring.” One man was later convicted of abusing boys during the yachting outings and jailed for four years in the early 90s. Detectives are expected to re-examine the case in the light of the flood of allegations regarding Savile.

Read more

This section of the story seems to have gone unnoticed, there’s not a single reference to it in the comments thread. I can add a bit more information to the article:

The charity was the Azimuth Trust.

The “leading former member of PIE” was Dr. Morris Fraser, who features in the BBC documentary on Peter Righton, ‘The Secret Life of a Paedophile‘. More on Morris Fraser here

The man who was convicted was Michael Johnson.

It  reports that the mystery BBC presenter was investigated at the time after police became aware of allegations he was abusing boys during sailing trips.

No charges were ever brought against the star – for reasons that remain unclear.

A child protection source is said to have told the Mirror: ‘The charity was used as a way of taking indecent pictures of the boys and there was also physical abuse occurring.’

One man was later convicted of abusing boys during the yachting outings and jailed for four years in the early 1990s, the paper reports.

Child doctor in porn ring probe (23.07.89)

 

https://spotlightonabuse.wordpress.com/2013/04/11/bbc-presenter-was-linked-to-the-paedophile-information-exchange/

BBC man in court on abuse charges

24 May 2013

A FORMER BBC reporter appeared in court yesterday accused of sexually abusing two boys under the age of 14, spanning a decade.

Clifford Luton, 88, who has been charged with three indecent assault charges between January 1971 and January 1981, arrived at Bournemouth Magistrates’ Court in a wheelchair.

The alleged sex attacks in Poole, Ealing and Essex involve two young victims who cannot be identified for legal reasons.

Luton from Ashley Road in Parkstone, Poole, is also charged with 30 offences of possessing an indecent image of a child, including photographs in the most serious grade five category, at his home in April last year.

Represented by Mark Price, he did not enter any pleas and was granted unconditional bail. Magistrates have already rejected jurisdiction and the case was committed to Bournemouth Crown Court on June 24.

Luton worked for the BBC in the 1960s and 1970s reporting on major issues including The Troubles in Northern Ireland, the Cod Wars with Iceland, the attempted kidnapping of Princess Anne and the Lebanese Civil War.

In 1967 he chartered a plane to search for round-the-world sailor Francis Chichester who had gone missing in a storm around Cape Horn.

While working for the Daily Mail Luton interviewed famous historian David Irving in the 1950s.

During yesterday’s brief court appearance, Luton spoke only to confirm his name, address and date of birth, using a hearing aid to follow proceedings.

http://www.bournemouthecho.co.uk/news/10441600.BBC_man_in_court_on_abuse_charges/

3 October 2014

BBC reporter Clifford Luton child sex charges case halted

A former BBC News reporter may never be tried over alleged sexual offences after a judge upheld a decision to indefinitely halt the case.

Clifton Luton, of Ashley Road, Poole, had been accused of indecently assaulting two boys under the age of 14 and possessing indecent images.

But in December the case against Mr Luton was indefinitely halted because of his age and ill health.

On Friday a judge concluded the court had jurisdiction to make that decision.

‘Too ill’

Mr Luton had been accused of assaulting one of the boys on three occasions between 1971 and 1974 and one attack on the other alleged victim between 1980 and 1981.

But in December the Crown Prosecution Service (CPS) made an application to stay the proceedings, which indefinitely halts further legal process in a court case.

The application followed medical reports from the defence and prosecution which concluded the 90-year-old was too ill to face criminal proceedings.

However, in April the CPS had what Judge Peter Johnson described as “second thoughts” and questioned whether a judge at Bournemouth Crown Court had jurisdiction to grant the application.

Having considered the case law, Judge Johnson concluded the court had been correct to grant the application.

Mr Luton is understood to have worked as a BBC reporter for 15 years in the 1960s and 1970s.

http://www.bbc.com/news/uk-england-dorset-29483245

https://twitter.com/thewakeupcall09/status/846356654425870336

BBC: CLIFFORD LUTON: Ex-BBC Reporter

Clifford Luton was a BBC reporter for 15 years between the 1960s and 1970s.  Despite numerous court appearances charged with abusing children, the justice system never seemed to conclude a case against him and in one of the later trials, part of the case wasn’t heard in court.  I have my own theory as to why this might be, but there is no proof.

June 1957

Luton wrote a letter to the New Scientist.  His address is stated as The Vineyard, Richmond, Surrey.  LINK

September 1960

Luton was working as a reporter at the Daily Express. LINK

October 1963

Luton appears as a character witness in the intriguing trial of Laurence Terence Bell.  Bell appeared at the Old Bailey, accused of indecency with young guardsmen at Chelsea barracks.  He was eventually found not guilty having pled that he was framed by ‘the powers that be’ as he gave information to the press regarding Stephen Ward, John Profumo and Christine Keeler – in particular allegations of Ward’s attempts to acquire nuclear information.  It is a fascinating case and one I urge you to read up upon.  Luton knew Bell. The Guardian, Newspapers.com

The Guardian 03 May 1988

Stephen Ward at the centre of the Profumo affair was killed on orders from MI5, according to an unnamed MI6 operative. The MI6 contact told them Ward was a threat. He is quoted as saying there were sex photographs, which could damage the Macmillan government and the royal family. …on the night he died, Ward wrote to the Home Secretary, Henry Brooke, but the letter was suppressed.

November 1974

Luton writes a letter to The Times.  His address is stated as 12 Elm Grove Road, London, W5.

November 1978

Luton appeared at Tottenham Magistrate’s Court charged with abusing a girl and three boys.  Unknown outcome. The Times

The Times: 9 November 1978

REMAND ON BAIL FOR BBC REPORTER

Clifford Luton, a BBC television reporter, was remanded on bail until January 19 at Tottenham Magistrate’s Court, London, yesterday, charged with indecently assaulting a girl and three boys.

Mr Luton, aged 54, of Ashley Road, Poole, Dorset, was accused of indecently assaulting a girl aged 15 between December 28 last year and January 10 this year, a boy aged 14 between July 22 and 29 this year, a boy aged 12 between August 5 and 12, and another boy of 12 between September 2 and 4.

There is no further information about this case as The Times was not printed December 1978 and November 1979 due to a labour dispute.  However, mention is made to it on a forum whereby it is suggested the abuse happened in Northern Ireland.   I am unable to confirm if this is true or false. (See further reading)

July 1989

Luton was named in a Sunday Mirror expose as having being one of those men being questioned by police investigating a paedophile ring.  The three men named were Dr Roderick Morris Fraser, Luton and Nicholas Reynolds.  The article (on the Spotlight blog) states:

Luton, 64, a former SAS captain, organises boat trips for children from his Dorset home. 

Former BBC reporter Luton also refuses to comment about the police investigation.  He runs the North Sea Cruise Association from his home in Ashley Road, Parkstone, near Poole, Dorset.

The Association founded by Luton 25 years ago, advertises boat trips for youngsters.

As a high-flying journalist, he reported on war zones including Beiruit, Northern Ireland and the Congo.  He also covered Francis Chichester’s historic voyage around Cape Horn.  

A skilled yachtsman himself, he owns a 28 foot boat, the Sarah Jane.

This group was one of those set up pre-Azimuth Trust.

Azimuth Trust

Azimuth Trust was founded by Dr Roderick Morrison Fraser, Michael Johnson and John Lambeth.  Johnson and Fraser were connected to other paedophiles such as Charles Napier (brother of John Whittingdale), Peter Righton and Terence Waters among others.  Cathy Fox has done a great indepth blog post about it all, and there is also the blog post I put together regarding the Righton investigation – Operation Clarence.

There is also a very interesting video about Azimuth and it’s members on YouTube.  Interestingly, the only person to be convicted was Johnson and in 1994 the police were criticised over their handling of the case.

January 2011

Luton launched a complaint via the PCC against The Daily Telegraph and Sunday Times over their obituaries for reporter Murray Sayle. LINK

June 2013

Luton appeared at Bournemouth Crown Court accused of indecent exposure and possession of indecent images.  There was also a further charge but the details were not heard in court..  The case was adjourned until September 2013 and Luton was released on bail. LINK

bLuton

September 2013

Luton appears at Bournemouth Crown Court accused of indecent exposure and possession of indecent images.  There was also a further charge but the details were not heard in court. LINK

December 2013

A judge halts the trial of Luton indefinitely due to his health. LINK

October 2014

A judge halts the trial of Luton indefinitely due to his age and health. LINK

Nothing more is known about Luton.  He simply disappears.  In typical Janner style, he became too old and mentally unwell to face justice.


Cassandra Cogno‏ @CassandraCogno

Police criticised on Henry Clarke child sex abuse

Any links to Dr Morris Fraser re impunity?

Child sex abuser Henry Clarke tracked down to Canada

BBC News NI has tracked down a serial child sex abuser who admitted his crimes to police but has never been brought to justice.

Henry Clarke, 75, confessed to abusing three different boys at care homes in Northern Ireland.

A retired church pastor, he has been living in Canada since he made the admissions in 1985.

NI’s Director of Public Prosecutions directed no prosecution and the RUC failed to act on a further confession.

Today, he lives in a small town hundreds of miles from the nearest city in northern Canada.

One of his victims, Billy Brown, 61, who was abused when he was a 12 year-old boy, described Henry Clarke as “a monster”.

Mr Brown, who has waived his right to anonymity, said: “You just had to stay away from him. You went to bed at night, you pulled your blankets around you as tightly as you could.”

Henry Clarke emigrated to Canada in the late seventies but he eventually admitted the accusations of abuse during an interview with police in Belfast in 1985 and afterwards in a letter he wrote from Canada.

Clarke was pastor of four churches in Canada after he emigrated.

 
Henry Clarke’s confessions first came to light at the Historical Institutional Abuse (HIA) inquiry which reported earlier this year.

His identity had been protected by the inquiry’s offer of blanket anonymity but that ruling was successfully challenged by BBC News NI.

http://www.bbc.com/news/uk-northern-ireland-39495877

 

via walkerdine:

Dr Morris Fraser Abuser

 

Colin Wallace Statement on HIA and Kincora

January 20, 2017 by

Statement issued by Colin Wallace following the publication of the Historical Institutional Abuse Inquiry Report.

Although I initially offered to give evidence to the Inquiry, I later decided not to, mainly on the grounds that the Government repeatedly refused to give it the same legal powers as the corresponding Inquiry in London.

I believe that both the perception and the reality of the Government’s decision is one ofunfairness to the victims.

Despite my decision, I did, however, provide the Inquiry with 265 pages of comment and supportingdocuments, drawing attention to false or misleading information contained in the transcripts of thepublic hearings. My reason for doing so was to enable the Inquiry to investigate and corroborate theaccuracy of my past comments about Kincora and related matters, and to provide the Inquiry with theopportunity to correct the relevant errors in the its published transcripts.

None of the information I provided to the Inquiry is new.

Although some of it has not previously been in the public domain, it has been in the possession of the Ministry of Defence and other Government agencies for many years and should have been made available by those authorities to the Inquiry.

It should, therefore, also have been made available by the authorities to previous Inquiries and the Government needs to explain why that did not happen. Even more worrying, is the acknowledged fact that key Army Intelligence files relating to Tara and William McGrath – including the one compiled by Intelligence officer, Captain Brian Gemmell – appear to have gone missing after they were handed over by the Army to MI5 in 1989, prior to Prime Minister Margaret Thatcher’s admission to Parliament (30 January 1990) that Ministers had“inadvertently misled” Parliament about my case.

Clockwork Orange

There also appears to be no record whatsoever of what became of all the ‘Clockwork Orange’ project files which I handed over to my superiors when Ileft Army Headquarters in Lisburn in February 1975. Some of those files related to William McGrath.

To make matters worse, it is now clear from the Inquiry’s transcripts that a senior MI5 officer, Ian Cameron, falsely accused me of ‘leaking’, without authority, information to the press about William McGrath.

The MI5 claim is bizarre.

As my Army superior at the time has confirmed in the press, I was officially instructed by my superiors in Psychological Operations, at the behest of Major General Peter Leng, to brief the press about McGrath as early as 1973, in a bid to attract media attention to his activities.

It is also significant that the MI5 officer who accused me of ‘leaking’ information about McGrath to the press later refused to be interviewed by the Terry Inquiry investigators about why he ordered Captain Brain Gemmell, to stop investigating McGrath.

Intelligence Agenda

Clearly, the Army and MI5 had very different agendas regarding McGrath and his activities.The astonishing claim by the authorities that they knew nothing about the allegations surrounding McGrath’s sexual activities until 1980 is a total travesty.

As my documents clearly show, it is simply not credible that I knew more about McGrath and his activities than the combined Intelligence community did in 1973/74. One must conclude, therefore, that the Intelligence Services did not tell the Inquiry all they knew about McGrath during the 1970s.

Indeed, most of the information I possessed about McGrath in 1973/74 came from within the Intelligence community and was quite substantial. Moreover, my 1973 press briefing document clearly contains more information about McGrath than the Intelligence Services have claimed to the Inquiry that they possessed at that time!

For example, that document states that McGrath “is a known homosexual” and that he “runs a home for children on the (236) Upper Newtownards Road. Telephone: B’fast 657838.”

Finally, to suggest that because I gave the press the exact postal address (including the street number of the property), plus the telephone number of the Kincora home, but did not actually include the name,‘Kincora’, that somehow invalidates my evidence.

That is an unacceptable attempt to avoid facing up to what I have been saying over the years, and also shows that the claim made by the Intelligence Services to the Inquiry that they were not aware until 1980 of where McGrath worked is demonstrably false.

Overall, I believe the Inquiry has been a wasted opportunity to establish the full facts relating to this matter and I feel the victims have been let down yet again, as they were by previous Inquiries.

Further Information by Ciarán

Colin Wallace has been a great supporter of the McGurk’s Bar Campaign for Truth and was actually on-site at British Army Headquarters when word of the bombing was reported by Security Forces on the ground.

He has written that the authorities that Army HQ knew that the bar was attacked and this has since been proved beyond any doubt with my latest archive find.

He also wrote the Foreword of my book which you can read here.

link


P.I.E – Paedophile Information Exchange

Members/Activists/Connected of P.I.E
Former PIE Chairperson and current pro-paedophile activist Tom O’Carroll
tom

David Joy, 66 – once No2 in the notorious Paedophile Information Exchange. In 1984 he was jailed for 18 months for publishing obscene material in a PIE newsletter. In 1996 he got two more years after admitting indecent assaults dating back to the 80s. Then in January 2006 cops found 1,129 images of children aged one to 13 at his rundown flat in Loughborough, Leics. Some were in the level 5 category – featuring sado-masochism, torture or bestiality.
david-joy1

DR Morris Fraser – P.I.E founder member & leading child psychiatrist – had a criminal record for taking indecent photographs of children and assault in 1972. Good friends with both Napier, Waters and Righton
morris

Terrence Waters – Former prep school teacher – Closely linked to several P.I.E members incl Andrew Sadler – adopted the alias “James Opphin daler”. The name contains an anagram of the word “paedophile”. In 1994 Waters was sentenced to ten years for possessing child abuse images and the sexual abuse of a 10 year old boy. In 2011 convicted for more sexual abuse against children at Allen House School – More on Waters on this link
Michael Johnson – jailed for four years on six specimen counts of indecent assault against two boys aged nine and 11. In 1988 Dr Morris Fraser and Michael Johnson set up a sailing charity for disadvantaged boys called the Azimuth Trust based in Cornwall.
Andrew Sadler – Former teacher who was jailed abroad for sex offences against boys – Links to Fraser and Napier –
Andrew Sadler

More on Sadler on this link
Leo Adamson helped set up Pie to distribute obscene pictures of young boys while John Parratt aka Warren Middleton was a former vice-chairman of the organisation
Leo Adamson, left. John Parratt right

Former chairman/leader Steven Freeman aka Steven Adrian Smith
freeman

Freeman/Smith was a former Home Office security guard and was described in court in 1984 as the, “powerhouse and engine room of P.I.E, and the life blood of contact which he edited and printed.
The members’ hotline for the Paedophile Information Exchange (PIE) rang, of all places, inside the Home Office. The phone would be picked up by Steven Smith, a paedophile and member of the group who worked in security in Whitehall, from where he would tell callers where to go for the next meeting to discuss issues including decriminalising sex with children as young as four.
John Morrison and Barry cutler – Members
john morrison left. Barry Cutler, right

Geoffrey Prime – Former member and KGB spy
957218

Sir Peter Hayman – Several links to P.I.E and its members – Former High Commissioner to Canada
peterhayman01

Notorious paedophile and TV presenter Jimmy Savile was almost certainly a full member of P.I.E
Jimmy+Savile

Peter Bremner (aka Roger Nash) Member level – Bremner has convictions for indecently assaulting children. Jailed for 6 months in 1994 with David Joy. in 1978 Bremner was given a three month prison sentence suspended for 2 years and fined £150 for indecently assaulting 3 boys, two aged 8 and one aged just 5
peter brmner

John Stamford – A former church minister published international guides for child molesters. He died before his trial. Stamford used a homosexual travel guide called spartacus as a front for a mailing ordering service offering information on child prostitutes in Thailand, Brazil and other nations. The organisation was alleged to have operated through a box number in London. The details of each of the members, including their sexual preferences, the desired age of the children and preferred countries of origin were stored on a computer. The members received personalised lists of children.

Some PIE Members


Stephen King aka Stephen Gosling – so called child expert was a member of P.I.E. His unbelievable role was to advise UK judges on sentencing for paedophiles

Child rapist Stephen King who used to advise judges on sex offenders jailed for sick photos, videos and ‘paedophile manual’

25 Sept 2017

A convicted child rapist who used to advise judges on how to deal with paedophiles has been jailed again after he was found with thousands of sick videos and photos, including a ‘Paedophile manual’.

Stephen King, 68, pleaded guilty to six charges, including possessing indecent images of children, nearly 3,000 of which were the most extreme kind.

Included were 85 videos in the worst category, which included a baby being sexually abused.

He was also caught in possession of a ‘paedophile manual’ at a house in Richmond on May 1 which “contained guidance about abusing children sexually”.

King was sentenced today (September 25) to 20 months in prison, the most lenient possible, due to his ill health – he recently suffered a heart attack and a stroke.

The 68-year-old was also charged with meeting up with another sex offender in Richmond, which he was prevented from doing under a sexual harm order, but pleaded not guilty to this charge, which will lie on file.

King, of Herne Hill, who appeared at Kingston Crown Court via video from Wandsworth Prison, was convicted in 2004 of more than 20 of sexual offences, including having sex with a girl under 13 years old.

Previous to his first conviction, he had given government agencies and judges advice on protecting youngsters from child molesters, and even suggested jail terms for child sex offenders.

After being released from prison, King was staying at a house in Richmond.

In May, King tried to contact a six-year-old girl, something he was prevented from doing under a sexual harm order.

He was arrested and charged on May 1. After admitting the charge, he was sentenced to eight months in Wandsworth Prison.

On May 3, two days after he was arrested, a cleaner in the house he had been staying at found a black suitcase. After asking the other tenants if it belonged to them, she concluded it must have been King’s.

She brought it to Richmond police station, where he was brought after the arrest, and police found thousands of indecent images on memory sticks, along with letters purporting to be from children who had sex with him and “enjoyed it”.

No child has been connected to the letters, and his defence lawyer Peter Cordwell said the letters were “self-penned”.

There was also “extreme” bestiality images on the memory sticks.

Judge Judith Coello described the images found in King’s possession as “disgusting and debauched”.

Sentencing, she said: “By engaging in this type of activity you and others like you are providing a market for a heinous crime.

“You encourage those who make these images to continue making them.

“People like you are an absolute menace to decent society.”

http://www.richmondandtwickenhamtimes.co.uk/news/15556114.Child_rapist_who_used_to_advise_judges_on_sex_offenders_jailed_for_sick_photos__videos_and__paedophile_manual_/?ref=twtrec

Richard Bigham – Eldest son of viscount of Mersey admitted he was a member

Former Vicar and millionaire Michael Studdert –financial backer and member level millionaire-michael-studdert

David Wade – The treasurer of P.I.E
Entry level members – Robert Bushell, Geoffrey Taylor, David Hooper, Nigel Beatman – Click this to see summary of their convictions
Michael Hanson – First chairman (set up P.I.E. as a special interest group within the Scottish Minorities Group with Ian Dunn)
Keith Hose – 2ND Chairman In the PIE Chairperson’s Annual Report for 1975-6, Keith Hose wrote that ‘The only way for PIE to survive, was to seek out as much publicity for the organization as possible…. If we got bad publicity we would not run into a corner but stand and fight. We felt that the only way to get more paedophiles joining P I E… was to seek out and try to get all kinds of publications to print our organization’s name and address and to make pedophilia a real public issue.’
British antiques expert Keith Harding was active in the Paedophile Information Exchange
Harding was convicted of indecent assault against four children aged eight and nine in the late 1950s and was a “schedule 1” offender – meaning his convictions remained on his police file for life.
But he was later given the Freedom of the City of London and became a member of the Worshipful Company of Clockmakers, meeting business and political figures at the height of his career. The clockmaker and music box expert ran a museum regularly visited by children, despite social services being aware 20 years ago of his convictions for child abuse.
harding1

 

A document held by police in the mid-1980s listed Keith Harding as PIE member number 329 next to his north London address.
Ian Campbell Dunn – Co-founder (born 01/05/43 died 10/03/98)
iandunn1


Michel José Rosoor, Jacques Francis, Beat Meier ‘London tape’ Witte Comites Blancs, p7

Michel José Rosoor, Jacques Francis, Beat Meier ‘London tape’ Witte Comites Blancs, p8

The tortured victim on the “London Cassette”, an 8-year-old British child identified by the British police, had been placed at the disposal of the network by his parents who had attended Meier from 1983 to 1987.
I assume the parents are from London and had known Beat Meier very well and they themselves may of been paedophiles.
Roger Lawrence was in the car with Beat Meier but released without charge
Libido was a Belgium paedophile magazine which was written in German
 Those parents of the boy in the Beat Meier video tape must be still alive. And how many other paedophiles do they know.
 

 

The boys father was an international lorry driver, the most serious offences were outside of the UK jurisdiction hence deportation

No mention of snuff at all though

Martyn Simons had also used the alias of Roger E Hunt

PIE member Roger Lawrence aka Roger E Hunt Executive Editor of PAN

Snuff

Shortly before his death, Dunn, a prominent gay activist, became convener of lobby group Outright Scotland. In 1997, he condemned police over a camera surveillance operation in public toilets in Stirling which led to several gay men being charged – even though the investigation also revealed that some men had sex with a 13-year-old boy. In 1974, Dunn co -founded the Paedophile Information Exchange ( PIE) with Michael Hanson. It became the leading contact group for adults campaigning for the right to have sex with children. In an interview in 1997, Dunn admitted he and Hanson had agreed to facilitate research into sex with children.
Dunn was caught on tape bragging abut interfering with a fourteen-year-old boy. The existence of the tape caused him to abandon a libel action he had brought against a Sunday newspaper, which named him as a paedophile. The encounter itself does not seem to have been a one-off – at his funeral in 1998, a young man claimed Dunn had raped him when he was fifteen. Dunn also supported a paedophile magazine called ‘Minor Problems.’
Charles Napier One-time treasurer of PIE Charles Napier is alleged to have sexually assaulted boys whilst a gym master at Copthorne School. He became an English Language Trainer at the British Council and was convicted of sexual assault against minors in London in 1995 and investigated as an alleged member of a paedophile network operating in British schools in 1996. He set up his own school in Turkey and resumed English Language Training with the British Council after serving his sentence
Charles Napier

Michael Dagnall · Tony Zalewski – Lee Edwards –Named in Daily Express, 26th August 1983

 

Lee Edwards aka Edward Brand executive committee member of PIE Does the photofit look like him ?

 

Lee Edwards & the Paedophile Friendship Service

Bernard Haunch – Teacher – He was also a member of a group called the Paedophile Information Exchange but apparently claimed it was a discussion group
Bernard Haunch

Dr Edward Brongersma (Deceased) – has written extensively in the area of sexuology, especially on pornography, ephebophilia, pedophilia and the age of consent. His books on this subjects include: Das Verfehmte Geschlecht (in German, 1970), Sex en Straf (“Sex and Punishment”, 1972), Over pedofielen en kinderlokkers (“On Pedophiles and Child Molesters”, 1975), and his last work is his magnum opus and entitled Loving Boys (two volumes, 1988–1990).
Dr Edward Brongersma

Peter Righton AKA Paul Pelham – Righton was the former director of education at the National Institute for Social Work, and a consultant for the National Children’s Bureau. Yet he was also a founding member of the Paedophile Information Exchange (PIE), which wanted the age of consent reduced to four. Righton published essays justifying paedophilia, which he called no more mysterious than “a penchant for redheads”. Police raided his home and found hundreds of letters between him and other paedophiles

Warren Middleton, aka John Parratt one of PIE’s first London members – Creater of the Understanding Paedophilia (UP) magazine that was eventually replaced by Magpie
Michael Dagnall – Close friend and fellow abuser with Tom O’carroll Click this , it mentions Dagnall and P.I.E involvement @ page 19
Richard Travell – Active member status – Travell was handed a three-year community order in 2006 for possessing indecent images of children.
Untitled

Alan John Doggett (1936-1978), (pictured above) conductor, composer and choir master. Leader of London Boys Choir – A letter in Magpie 10 reported and commented on the suspected suicide of Alan Doggett weeks before he was due to face child sex charges for having sex with a choir boy. Hit by train. Also has links to a certain Paul Raven aka Gary Glitter
C. J. Bradbury Robinson – American author who wrote several times for Magpie magazine – His pro-paedophile books include A crocodile of choirboys “Bare Knees, Boy Knees.” The latter offers an “unmatched” and “startling trip into the strange world of the Paederast,” says the description on Amazon, which has one used copy for sale for $500
Richard James – Writer at Magpie
Paul Green – Writer at Magpie
Peter Deathman – P.I.E member who was regulary visited in prison by Tom O’Carroll. Deathman served a 10 year sentence not for mere sexual abuse but for child stealing
Den Nichols – Author of paedophilia literature called “Towards a Better Perspective For Boy-Lovers”. Published in 1976. In its preface to ‘serious minded adult males who feel an existential attraction to young boys”. Copies were advertised and sold by P.I.E/Magpie for £1 each, including post & packaging
David Grove – AKA Robin Brabban – born 1904 – secretary and Ex treasurer of PIE
Michael Walker – London – Member level of P.I.E – He did not agree on certain issues of P.I.E but condemned hostility against P.I.E
Anthony Green – Somerset – He attended a meeting of P.I.E that was attacked by the Nation Front. He urged tolerance and understanding of paedophiles
William Thornycroft – He was disgusted at attacks on P.I.E. He was quoted “The sexual freedom of children was needed” – Member of Communist Party Gay Rights Committee in the 70’s
Robert Atkinson – Newcastle teacher was arrested for sexually abusing a 13 year old student. He was fined £200. The headmaster and staff however continued to support him after the his guilt. Member level status in P.I.E
Ian Harvey – P.I.E member – He sought to differentiate bewteen “good paedophiles” and pedarasts, but without defining his terms or explaining why
Micky Burbidge – He supported P.I.E’s proposal to abolish the age of consent laws. Also wrote a book entitled“Evidence on the law relating to and penalties for certain sexual offences involving children for the Home Office Criminal Law Revision Committee” with Kieth Hose
Frits Bernard (1920 – 2006) was a Dutch psychologist,sexologist, homosexual activist, and pro-pedophile activist.Together with the late Edward Brongersma, he laid the foundations of the emancipation movement of boylovers in the Netherlands.
Keith Spence – He applauded the “courage” of the leaders of P.I.E in the face of ; quote – Hysteria, hostility and violence, also wrote several paedophile articles for Magpie about sexual abuse of young boys
June 1983: Scoutmaster Michael Williams of Castle Bromwich. Birmingham, resigned after being exposed as a member of P.I.E
Jane Rule – Canadian Writer of lesbian-themed novels and non-fiction. Co author of Magpie: Journal of the Paedophile Information Exchange – Also supporter of NAMBLA (The North American Man-Boy Love Association (NAMBLA) was founded in December 1978 and is an activist homosexual and pedophilia coalition group. Their primary aim is stated to be the overturn of statutory rape laws and reduction of “age of consent” laws that require a child be of a certain age (which varies by state) before they can agree to sexual intercourse.
John Finnin – Co author of Magpie: Journal of the Paedophile Information Exchange
Peter Saxon – Co author of Magpie: Journal of the Paedophile Information Exchange
Derry Webster – Tom O’Carroll was named in court as a ‘customer’ for Webster’s child abuse images and video collection. Webster was jailed for his part for selling the obscene films, magazines and pictures
Kenneth Plummer – Involved with O’Carroll. He stated “Any study that can take adult-child sexuality out of the zone of shrieking horror and place it in the demystified zone of everyday experience must be welcomed”. sociologist Dr Kenneth Plummer of Essex University, sent a “warm message of support” for “Betrayal of Youth,” and, in company with Nettie Pollard and Professor Donald West (qv), also read, made suggestions and then praised “Paedophilia the Radical Case” receiving “heartfelt thanks” from its author, Paedophile Information Exchange Chairman Tom O’Carroll. Attented several P.I.E meetings
.
.Harman letter PIE http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://www.telegraph.co.uk/news/politics/labour/4949555/Harriet-Harman-under-attack-over-bid-to-water-down-child-pornography-law.html
.
http://cigpapers.wordpress.com/2013/06/05/p-i-e-paedophile-information-exchange-exposed-part-two/
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://en.m.wikipedia.org/wiki/Age_of_consent_manifestations_(UK)
.
http://labour25.com/category/age-of-consent/
.
http://en.m.wikipedia.org/wiki/Liberty_(pressure_group)
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://blogs.spectator.co.uk/nick-cohen/2014/02/when-is-a-scandal-not-a-scandal/.
.
http://ufohunterorguk.com/tag/nccl/
.
http://www.wikileaks-forum.com/united-states/479/the-truth-about-some-politicians-backing-practicing-pedophiles-and-cp/15984/
.
http://www.theguardian.com/society/2014/feb/26/lobbying-paedophile-campaign-revealed-hewitt
.
http://aangirfan.blogspot.co.uk/2013/02/nspcc-mi6.html?m=1
.
PIE’s new name
http://www.libertarian.co.uk
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-
love/p-i-e
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-love/p-i-e/
.
Tony Blair part of PIE
http://www.thedailybeast.com/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html#url=/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html
.
PIE & HMqueen
https://m.facebook.com/story.php?story_fbid=638499922852151&id=100000764465111&refid=7&_ft_=qid.5988561366331161130%3Amf_story_key.1134116637656814874
.
http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://dailybalenews.com/2014/02/08/paedophiles-plan-to-build-village-in-devon-update/
.
http://m.couriermail.com.au/news/opinion/opinion-why-does-the-left-support-this-avalanche-of-pedophile-filth/story-fnihsr9v-1226861620956
.
Liverpool (NICHE)
http://sindonax.wordpress.com/2014/03/25/paedophile-cover-ups-the-hows-and-whys/
.
PIE
http://spotlightonabuse.wordpress.com/category/pie-paedophile-information-exchange/
.
https://docs.google.com/file/d/0B4PQp1NQ39MPYzU5NDVhY2QtMWViYi00MDRkLWE4OWQtOTc2NjA5MWZiNWI3/edit
.
http://ianpace.wordpress.com/2014/03/15/pie-and-the-home-office-three-memberssupporters-on-inside-funded-magazine-printed-and-phone-line/
.
http://web.archive.org/web/20041116144121/http://home.wanadoo.nl/host/wilson_83/index.htm
.
Labour controlled BBC
http://gaiusmarcellus.blogspot.co.uk/2010/03/unacceptable-links-between-labour-and.html
.
Tories & PIE
http://tompride.wordpress.com/2014/04/05/the-truth-about-the-tory-partys-cover-up-of-its-links-to-paedophilia/
.
Silent
http://www.silentlambs.org/
Silent
http://iamthewitness.com/listeners/Jewish.child.molesters.that.are.never.on.the.NEWS-WHY.htm
.

https://gettingreadyfor2015.wordpress.com/2014/01/18/a-bill-maloney-up-date/
.
http://www.real-whitby.co.uk/savilejaconelli-yewtreehibiscus-sborough-paedo-ring-time-line
.
http://www.nationalarchives.gov.uk/a2a/records.aspx?cat=097-hcagrey&cid=-1
.
https://m.facebook.com/story.php?story_fbid=747913618599372&id=100001422211809&refid=28&_ft_=qid.6033289562555813767%3Amf_story_key.2800040682799693877&__tn__=%2As&fbt_id=747913618599372&lul&_rdr#s_ff81768c6432b3819fe18456041bb4e6
.
http://order-order.com/2014/07/08/watch-former-tory-whip-boasts-about-paedo-mp-cover-up/

link

Keith Hose

The Guardian

London, Greater London, England

Thursday, August 25, 1977 – 22

Paedophile diplomat Sir Peter Hayman – PIE member

via walkerdine:

The Guardian
(London, Greater London, England)
20 Mar 1981, Fri  • Page 2


via walkerdine:

P.I.E BLACKMAIL COURT TRIAL

The Guardian
(London, Greater London, England)
04 Feb 1977, Fri  • Page 8

via walkerdine:

The Guardian
(London, Greater London, England)
20 Mar 1981, Fri  • Page 26

 

Ralph Alden aka Ralph Bruno Siegesmund Aubram

https://www.thegazette.co.uk/London/issue/38289/page/2936/data.pdf

People27283

Sir Peter Hayman & Ralph Alden both PIE members

Alias: Ralph Bruno Siegesmund Aubram.

Ralph Alden aka Ralph Bruno Siegesmund

BRIGHTON BOY ATTACK 1983 (By 3 PIE members)

HOMOSEX WASNT ENOUGH TO BLACKMAIL , SO PEADO NETWORKS HAD TO BE USED

link

Albany Trust run by Antony Grey aka Edgar Wright

harding-vintage-show

Keith Harding live at Northleach Steam and Vintage Show 2013

link

 Keith Harding’s shop, was not too far away from, where Jeremy Corbyn lives. And a number of PIE members lived near by the shop.

Paedophile Information Exchange founding member who plied victims as young as 10 with alcohol and parties is jailed for 24 years

 

Douglas Slade was expelled from the Philippines and brought back to the UK to be charged with 13 offences of abusing children

Douglas Slade was expelled from the Philippines and brought back to the UK to be charged with 13 offences of abusing children Credit: Avon and Somerset Police

A founding member of the Paedophile Information Exchange, a group which campaigned for sex with children to be decriminalised, has been jailed for 24 years.

Douglas Slade, 75, was expelled from the Philippines in 2015 and brought back to the UK to be charged with 13 offences of abusing children between the 1960s and 1980s.

Slade, formerly of Bristol, was convicted of all charges against him following a trial at Bristol Crown Court.

The offences, committed in Bristol and other parts of the country between 1965 and 1980, were against five boys – the youngest aged 10 at the time.

He’s shown absolutely no remorse for his sickening crimes or for the lasting emotional and psychological damage he’s causedDet Sgt Paul Merton

Judge Euan Ambrose jailed Slade for 24 years and ordered him to serve an additional 12 months on licence upon his release.

“Your interest in young boys was well established,” the judge told Slade, who has no previous convictions.

“It had led you to become involved in two notorious organisations, Paedophile Action for Liberation and the Paedophile Information Exchange.

“I am satisfied that you were involved in both organisations. I cannot determine the precise role that you played. You liked to boast about having been involved in setting them up, whether that was in fact true or not.

“It reflected your interest in sex with young boys and your wish to see sex between adults and young boys decriminalised.”

Slade was convicted of seven offences of indecent assault and six other sexual offences against his victims, who were aged between 10 and 16 at the time.

Victim impact statements provided to the court showed the “extremely deep and long lasting” effect of the abuse on their lives, the judge said.

The investigation into paedophile Douglas Slade began in 2010 when one victim came forward to report being abused in the 1970s
The investigation into paedophile Douglas Slade began in 2010 when one victim came forward to report being abused in the 1970s

Those targeted had home lives that were chaotic, with Slade providing them with parties, alcohol and cigarettes.

“The dreadful truth was that behind all that lay, the objection of persuading these boys to have sex with you,” the judge said.

Slade, who suffers from diabetes and high cholesterol, remained emotionless as the sentence against him was passed.

The investigation into Slade began in 2010 when one victim came forward to report being abused by him and several others in the 1970s.

A second victim was identified and three men were convicted of sexual offences, but charges could not be brought against Slade as he was living in Angeles City in the Philippines.

Avon and Somerset Police worked with the National Crime Agency to identify further victims, with Slade expelled from the Philippines in 2015, brought to the UK and charged.

“What has happened is your past has caught up with you – a past about which you appear wholly unrepentant,” Judge Ambrose added.

Douglas Slade was convicted of all charges against him following a trial at Bristol Crown Court
Douglas Slade was convicted of all charges against him following a trial at Bristol Crown Court

Slade was ordered to sign the Sex Offenders’ Register for life and adhere to a Sexual Harm Prevention Order banning him from contacting boys aged under 16.

Following the sentencing, Detective Sergeant Paul Melton, of Avon and Somerset Police, said: “Slade was part of a network of men whose sole aim was to find vulnerable children to abuse.

“He’s shown absolutely no remorse for his sickening crimes or for the lasting emotional and psychological damage he’s caused. No child will ever be safe in his company.”

Christopher Skeaping, 72, formerly of Hounslow in London, will be sentenced for one count of indecent assault against one of Slade’s victims at a date to be fixed.

Morris Fraser of PIE:

 

Belfast hospital’s paedophile doctor Morris Fraser and unanswered questions that won’t go away

Belfast hospital’s paedophile doctor and unanswered questions that won’t go away

The case of serial sex abuser Dr Morris Fraser should have rung bells when Niall Meehan sent his report on it to Judge Anthony Hart’s Historical Institutional Abuse inquiry… so why didn’t it?

  • 13/02/2017
    Career paedophile: Dr Morris Fraser
    Career paedophile: Dr Morris Fraser

    Dr Morris Fraser is a career paedophile whose abuse of boys was detected in 1971, but whose