Tag Archives: Crusaders

Rev Mark Carey son of former Archbishop of Canterbury Lord George Carey arrested over 1980s child sex abuse claims

The Archbishop of Canterbury with his son Rev Mark Carey

The Archbishop of Canterbury George Carey  with his son Rev Mark Carey (right)

The son of the former Archbishop of Canterbury, Lord Carey, has been suspended by the Diocese of Leeds after a complaint was filed with the Durham Constabulary alleging that over 30 years ago he abused a young girl.

link

Mark Carey cleared

06 Apr 2017

Author:

George Conger



Police and prosecutors are considering a criminal investigation into a former Archbishop of Canterbury over an alleged cover-up of sexual abuse.

George Carey stepped down as an honorary bishop last year after a report found the Church had “colluded” with convicted sex abuser Bishop Peter Ball under his leadership.

Now the Crown Prosecution Service (CPS) is discussing with Scotland Yard detectives whether to pursue criminal charges against Lord Carey, the Telegraph understands.

The Metropolitan Police said it had not launched an official criminal investigation into Lord Carey. A spokesman for the Carey family declined to comment.

It comes as the Independent Inquiry into Child Sexual Abuse (IICSA)…


Former Archbishop of Canterbury could face police probe into whether he broke the law by covering up for a paedophile bishop

  • Police are considering a formal inquiry into Church of England’s former leader
  • Lord Carey, 82, could face being interviewed under caution in investigation
  • Rev Peter Ball indecently assaulted 18 boys and young men from 1977 to 1992 
  • Former leaders could face criminal charges for not passing on abuse complaints 

The former Archbishop of Canterbury, Lord Carey, could face a police investigation into whether he broke the law by covering up for a paedophile bishop.

Officers are understood to be considering a formal inquiry to determine whether the former leader of the Church of England and other senior church officials should face criminal charges over their failure to pass on sex abuse complaints made against ex-bishop Peter Ball.

Such an investigation would be highly controversial and may involve 82-year-old Lord Carey being interviewed under caution.

Sources say police are collecting evidence and scrutinising a scathing Church of England report commissioned by the current Archbishop of Canterbury, Justin Welby.

It concludes that senior church figures ‘colluded’ to protect Ball and says the decision by Lambeth Palace not to pass the complaints to police ‘must give rise to a perception of deliberate concealment’.

Lawyers representing victims of Ball, who have called for a police investigation, believe the former Archbishop could face a charge of misconduct in a public office, for which the maximum penalty is life imprisonment.

Ball, a friend of the Prince of Wales, (and other members of the royal family) was jailed for 32 months in 2015 after indecently assaulting 18 boys and young men between 1977 and 1992 in one of the biggest scandals ever to rock the Church of England.

It has been claimed, however, that he might have been convicted more than 20 years earlier had Lord Carey and his staff at Lambeth Palace not withheld from the police six letters making other claims about his behaviour. The letters were sent in by members of the public after allegations against Ball surfaced in the 1990s. Ball was arrested and subsequently resigned as Bishop of Gloucester in 1993.

But his only punishment at that time was a caution for gross indecency for molesting a teenage monk and he was later allowed a licence to work as a retired priest.

Peter Ball, pictured with Prince Charles, was jailed for 32 months in 2015 after indecently assaulting 18 boys and young men between 1977 and 1992

Last year, The Mail on Sunday revealed that Anglican officials who had privately reviewed the case suggested that had the letters been given to detectives in 1993, Ball may have been convicted of serious sexual offences.

The report commissioned by Archbishop Welby, published this summer, concluded that the ‘greatest failure’ of the handling of the case was the ‘management’ of the correspondence, in which Lord Carey was ‘significantly involved’.

Lord Carey strongly denies any cover-up or collusion. His supporters have also argued that Ball could still have received a caution in 1993 even if Lambeth Palace had handed the letters to the authorities.

David Greenwood, the head of the child abuse department at Switalskis solicitors and who represents a number of victims of Peter Ball, said the failure to pass them on provided ‘reasonable grounds’ for the Metropolitan police to open a formal investigation.

The Met and Lord Carey both declined to comment.

Lord Carey is already facing questioning next year by the Government’s independent inquiry into child sexual abuse.

http://www.dailymail.co.uk/news/article-5117815/Former-Archbishop-face-probe-paedophile-bishop.html

 

8 . 0 7. 9 5
Paedophile Jimmy Savile Invited to celebrate Archbishop of Canterbury’s  birthday at Lambeth Palace

http://www.leedsth.nhs.uk/assets/Uploads/40482-LIBRA-main-accessible-v2.3.pdf


Chichester church abuser ‘allowed back into choir’

27 June 2017

Alesha Racine

Alesha Racine has waived her right of anonymity to speak to BBC South East

A woman who was sexually abused by a lay vicar in Sussex says she was “completely failed” by the former Archbishop of Canterbury George Carey.

Alesha Racine wrote to Lord Carey in 1992 after discovering her abuser had returned to the church where she had been sexually assaulted.

On Monday Lord Carey announced his resignation as an honorary bishop.

A review by Dame Moira Gibb found he had failed to pass on information about abuse carried out by Bishop Peter Ball.

Ms Racine’s abuser, Michael Walsh, was convicted of five indecent assault charges and confessed to sexual relationships with a further eight children.

He was sent to prison in 1990.

He had been a teacher, a lay vicar at Chichester Cathedral and also ran a choir at a church in Chichester.

Child abuse ‘inevitable’

After his release in 1992, Walsh returned to the same church to be part of the choir.

Concerned for the safety of other girls, in July of that year Ms Racine wrote to the then Archbishop of Canterbury, George Carey, requesting his help.

 

Speaking after Lord Carey’s resignation, Ms Racine, 54, said: “I was very concerned that my abuser had just come out of prison and it appeared that he’d just gone straight back into the parish church where he’d originally worked, and was again in a position of authority in the choir there where young children – specifically girls – sang.

“I was really worried that these girls were at a huge risk. I felt it was inevitable that children would be abused.”

Three months after writing her letter she was told Lord Carey had been unable to consider her concerns because he was “committed to a series of visits overseas, together with his summer break”.

‘Duty of forgiveness’

She was informed one month later that the “Archbishop had been assured that there was no question of Michael Walsh being reinstated in the choir,” but nine months after raising her concerns she received a letter from the Archbishop’s chief of staff confirming her abuser was back in the choir.

Lambeth Palace wrote to Ms Racine saying the parish authorities had taken “great care” in coming to their decision to allow Walsh’s return to his position “weighing carefully the risk of re-offending against… the Christian duty of forgiveness”.

Michael Walsh

Michael Walsh, seen here in the 1990s, was allowed to return to the same church choir after his release from prison

The letters revealed Lord Carey regretted the decision which allowed Alesha’s abuser back into churches and offered her his sympathies.

Ms Racine said: “I thought his response was deeply hurtful, in that it had taken me a lot of courage to write to him at all.

“Most of what he said was in defence of the Church and the people in it, rather than try to reach out to me as a victim.

“I do feel it was a complete failure on his part.”

A spokesman for the former Archbishop of Canterbury said the correspondence with Ms Racine had been conducted on Lord Carey’s behalf by his chief of staff.

He said: “Lord Carey has absolutely no memory of this chain of correspondence or these events. He cannot therefore comment.”

http://www.bbc.com/news/uk-england-surrey-40418476

26 June 2017

Former Archbishop Lord Carey resigns after review into child abuse

Ex-Archbishop of Canterbury Lord Carey.
Ex-Archbishop of Canterbury Lord Carey. Credit: PA.

The former Archbishop of Canterbury Lord Carey has resigned after a review into child abuse.

Lord Carey has now left his last remaining formal role in the church.

He was criticised in an independent review of the church’s handling of abuse carried out by Bishop Peter Ball.

In 2015, Peter Ball, the former Bishop of Lewes and Gloucester from Somerset, was jailed for 32 months for sexually abusing boys and young men.

Disgraced Peter Ball who was once the Bishop of Gloucester.
Disgraced Peter Ball who was once the Bishop of Gloucester.

http://www.itv.com/news/westcountry/update/2017-06-26/former-archbishop-lord-carey-resigns-after-review-into-child-abuse/

Richard Scorer‏ @Richard_Scorer

report on Bishop Ball a damning indictment of how the establishment in this country protect their own.

 

Trent @RandolphTrent

Multiple times a criminal!

alun:

In no way would I wish to influence the decision about Bishop Ball. No? But you did so pull the other one next time!

Moira Gibb Report on the Church of England – convicted paedophile Bishop Ball:

In 1993 the CPS agreed to issue Ball with a caution, rather than prosecute, after the personal intervention of then-Archbishop of Canterbury George Carey.

Alun:

I have only 2 explanations for this: 1) Carey condones abuse, or 2) he was protecting a friend of Bishop Ball.

Dame Alun Roberts @ciabaudo

for Ball was an honorable man. They are all honourable men. Including yourself Mr Carey!


Bishop Ball was given special treatment because he was mates with Prince Charles!


Tory MP Tim Rathbone

Alun:

Rathbone was not only David Cameron’s godfather; he was also a relative. David Cameron is related to Queenie. Is that the secret to the support to Ball?

Establishment figures who helped disgraced bishop avoid prosecution for sex abuse revealed

http://www.telegraph.co.uk/news/uknews/crime/12076285/Establishment-figures-who-helped-disgraced-bishop-avoid-prosecution-for-sex-abuse-revealed.html

Bishop of Chichester Eric Kemp labelling Ball’s accusers as ‘mischief makers’

Harvey Proctor being pronounced a saint by his buddies reminds me of the way Don’t-Carey took Ball under his wings.

David Cameron’s late godfather then Tory MP of Lewes, Tim Rathbone, who gave Mr Cameron his first work experience in the House of Commons.

Mr Rathbone, wrote that he found it “literally inconceivable” that Ball would ever become involved with anyone in the way described.

https://goodnessandharmony.wordpress.com/2016/01/02/establishment-figures-who-helped-paedophile-bishop-peter-ball-avoid-prosecution-for-sex-abuse-revealed/

 
 Lord Chief Justice Anthony Lloyd helped Bishop Ball with character ref 

Image result for nicholas soames and prince charles

Alongside Bishop Ball, Harvey Proctor and Bea Carthew, Enoch Powell also corresponded with Nicholas Soames, Proctor’s most ardent defender.

Former Lord Justice Anthony Lloyd and David Cameron’s late godfather Tory MP Tim Rathbone among figures who wrote in support of former Bishop of Gloucester, Peter Ball, one said he was a “saint”

 

Prince Charles denies trying to help sex crimes bishop escape jail

Unnamed member of the Royal Family sent a letter of support for Peter Ball as prosecutors considered putting him on trial

http://www.independent.co.uk/news/uk/crime/prince-charles-denies-using-influence-to-protect-bishop-from-sex-crimes-prosecution-a6685366.html

Dr Andrew Watt @DrAndrewWatt

It’s important to know if Prince of Wales helped Ball. cf

Dame Alun Roberts @ciabaudo

With a little help from his friend: Ball promised to go abroad but went to stay on Charles’ estate.

 

This video highlights ‘Lord’ Carey’s role in preventing the earlier prosecution of Prince Charles’ mate Bishop Ball

Dame Alun Roberts‏ @ciabaudo

Northleach = Ball = Harding = Jennings (lifelong Ball friend) = Prince Charles Coincidence?


Previously:

Goddard inquiry: Outrage as bishop Peter Ball jailed for sex offences given public funding for legal team

A lawyer close to the inquiry said: “I was really surprised Ball was given funding. The issue is about how he was allowed to get away with it by the Church not about his offending. He has already been investigated and pleaded guilty.”

http://www.telegraph.co.uk/news/2016/07/30/goddard-inquiry-outrage-as-bishop-jailed-for-sex-offences-given/

 

Chris Stacey @chrisstacey1

He’s one of the gatekeepers I’ve seen campaigning in Lords to clear name of another Bishop Bell from 1950s. Children don’t feature at all

We cannot allow the Bishop Ball story to be put to bed! Ball’s links to paedophiles and royalty with links to paedos warrants scrutiny!

terryfletcher‏ @terry45336188
If he declined to pass on evidence to the police, doesn’t that make him culpable?
Alun:
Not passing on information re. Bishop Ball was a criminal act on the part of ‘Lord’ Carey. What are the consequences?
How did ‘Lord’ Carey, a man who actively protected an evil paedophile bishop, make it to the top of CoE? Or have I answered my own question?
The case of Hubert Brasier, Theresa May’s father, must be revisited after Carey’s evil coverup of Bishop Peter Ball

Bishop Peter Ball, convicted, to Enoch Powell, fascist and alleged satanist and child abuser:

Oh, just remind me again who were Enoch’s two aides and buddies! Ah, yes. Proctor and Denby!

Peter Ball sending the love of God to Enoch and Pam! What a mistake!

Further evidence of close relationship between godly convict Bishop Ball and ‘Rivers of Blood’ Enoch:

Interesting that Enoch Powell corresponded both with Ball and Montagu who were both let off the hook by Skelhorn.
Can you see what it is yet?
Rev Peter Ball was one of many to correspond with Enoch. Others included Atkinson friend Tonypandy, another alleged abuser.
 

Image result for bishop ball and prince charles

22 June 2017

Church of England colluded with bishop who abused boys, says Welby

Report about bishop Peter Ball, finding collusion over 20 years, is ‘harrowing reading’


Collusion: Secret or illegal cooperation or conspiracy

HRH Crafty Muvva @craftymuvva

Prince Charles gave him a grace & favour cottage. Like the church, did he also overlook Ball’s abuse of young boys?


Senior figures in the Church of England colluded for a period of 20 years with a disgraced former bishop who sexually abused boys and men, a damning independent report has found.

The archbishop of Canterbury, Justin Welby, said the report on the church’s handling of former bishop Peter Ball made “harrowing reading”.

“The church colluded and concealed rather than seeking to help those who were brave enough to come forward. This is inexcusable and shocking behaviour,” he said.

“To the survivors who were brave enough to share their story and bring Peter Ball to justice, I once again offer an unreserved apology. There are no excuses whatsoever for what took place and the systemic abuse of trust perpetrated by Peter Ball over decades.”

Two former archbishops of Canterbury, George Carey and Rowan Williams, apologised to the victims of Peter Ball after being criticised for their failures in relation to him.

Ball, the former bishop of both Gloucester and Lewes, was jailed in October 2015 for the grooming, sexual exploitation and abuse of 18 vulnerable young men aged 17-25 who had sought spiritual guidance from him between 1977 and 1992. He was released from prison in February after serving 16 months.

His trial heard that after Ball was first accused in 1993, a string of senior establishment figures – including Carey, an unidentified member of the royal family, cabinet ministers and a high court judge – came forward in his support, writing letters to the police and Crown Prosecution Service.

Ball was cautioned by police. He resigned his post as bishop and retired to a rented cottage on the Prince of Wales’s Duchy of Cornwall estate but continued to officiate in 17 public schools until 2007. A fresh investigation was opened in 2012 which led to his conviction.

One of Ball’s victims, Neil Todd – the first to come forward with allegations of abuse – attempted suicide three times before killing himself in 2012.

Welby ordered an independent review of the church’s handling of the case, chaired by Dame Moira Gibb, former chief executive of Camden council.

The report said Ball’s case was dealt with at the highest levels within the church. He “was seen by the church as the man in trouble who the church needed to help”.

Ball was portrayed as a victim, and the review found “little evidence of compassion for Neil Todd even though from the outset it was clear that he was a vulnerable young man who had come to harm”.

It added: “The church appears to have been most interested in protecting itself.”

In the foreword to her report, An Abuse of Faith, published on Thursday, Gibb said the serious sexual wrongdoing of Ball “is shocking in itself but is compounded by the failure of the church to respond appropriately to his misconduct, again over a period of many years”.

“Ball’s priority was to protect and promote himself and he maligned the abused. The church colluded. The church colluded with that rather than seeking to help those he had harmed, or assuring itself of the safety of others.”

The report added, “progress has been slow and continuing, faster improvement is still required”.

Gibb made 11 recommendations in her report, including improving support to survivors of clerical abuse and taking steps to “demonstrate the individual and collective accountability of bishops”.

Peter Hancock, the C of E’s lead safeguarding bishop, who received the report on behalf of the church, said it had failed Ball’s survivors. “Having read the report I am appalled and disturbed by its contents … As a church we colluded, we failed to act and protect those who came forward for help. There are no excuses. We accept all the recommendations and are working to action them.”

 ( Lauren Alder‏ @LaurenAlder
Bishop Ball given a license to abuse from the police and CPS to ‘save the Church embarrassment.’)

Rowan Williams: ‘It is clear I did not give adequate priority to sorting out the concerns and allegations surrounding Peter Ball.’

He added: “For the survivors, it may feel this is all too late.”

According to the report, Ball intimated “on many occasions, to Lord Carey and others, that he enjoys the status of confidant of the Prince of Wales” and “sought to exploit his contact with members of the royal family in order to bolster his position”.

 

The Royal family with the Archbishop Rowan Williams at Windsor Castle for wedding of Prince Charles and Camilla Stock Photo

The Royal family with the Archbishop Rowan Williams, beside protected padophile Bishop Ball, at Windsor Castle for wedding of Prince Charles and Camilla Parker Bowles

 

Goddard inquiry: Outrage as bishop Peter Ball jailed for sex offences given public funding for legal team

Bishop Ball with Prince Charles and Camilla. Ball gave the homily at the funeral of Camilla Parker Bowles’s father, Major Bruce Shand, in 2006

Image result for moira gibb and prince charles

Image result for moira gibb and prince charles

Moira Gibb is made a Dame CBE by the Prince Charles at Buckingham Palace back in 2012

However, Dame Moira Gibb’s report went on, it “found no evidence that the Prince of Wales or any other member of the royal family sought to intervene at any point in order to protect or promote Ball”.

( CharlieBoab @VanCharleston

Is “found no evidence” a bit like 114 files disappearing?)

Image result for bishop ball and camilla funeral and prince charles

Carey was criticised in the report, which said he “set the tone for the church’s response to Ball’s crimes and gave the steer which allowed Ball’s assertions that he was innocent to gain credence”.

Image result for bishop ball and prince charles

In a statement responding to the report, Carey said it made “uncomfortable reading” and he accepted its criticisms of him. “I apologise to the victims of Peter Ball. I believed Peter Ball’s protestations and gave too little credence to the vulnerable young men and boys behind those allegations.”

Carey said he regretted not putting Ball’s name on the Lambeth List – names of people whose suitability for ministry is under question – after he was cautioned.

Under the leadership of Williams, the church began reviewing past cases, a move which ultimately led to the criminal case against Ball being reopened, the report said. However, he was criticised as being “lamentably slow” in making change.

In a statement, Williams said: “Having read the report and reflected on its details, it is clear I did not give adequate priority to sorting out the concerns and allegations surrounding Peter Ball at the earliest opportunity. I recognise such a delay is likely to have increased the pressure and distress experienced by the survivors of his abuse and I am sincerely sorry for this.”

https://www.theguardian.com/world/2017/jun/22/church-of-england-colluded-with-bishop-peter-ball-who-abused-boys-says-justin-welby?CMP=Share_iOSApp_Other

Dame Alun Roberts @ciabaudo

It’s quite simple: Lord Carey is a paedophile enabler and sympathiser.

Justin Welby has asked a former Archbishop of Canterbury to step down from his current role after a report found that he and other senior figures in the Church of England “colluded” with a disgraced paedophile bishop to prevent him facing criminal charges.

George Carey, currently an honorary Assistant Bishop in the diocese of Oxford, has been urged to “carefully consider his position” by Justin Welby, the current Archbishop of Canterbury.

A damning report by former social worker Dame Moira Gibb, the result of an 18-month long enquiry, found that the Church of England had failed to protect the victims of Peter Ball, who abused 18 vulnerable men and boys over a 20-year period.

Ball, a former bishop of Lewes and of Gloucester, was jailed in October 2015 for indecent assault and misconduct in public office. He was released from prison earlier this year.

He had initially been investigated by police in 1993 after Neil Todd, a young man who had stayed with him, told Church figures there had been “sexual activity” between the two. Mr Todd killed himself in 2012.

That investigation ended when Ball accepted a caution for gross indecency and resigned as Bishop of Gloucester.

Former Bishop of Lewes Peter Ball arriving at the Old Bailey
Former Bishop of Lewes Peter Ball arriving at the Old Bailey Credit: John Stillwell/PA

The report, published on Thursday, found that Lord Carey, then the Archbishop of Canterbury, wrote to Ball’s twin brother, Bishop Michael Ball, in 1993, after the caution, saying he believed Ball was “basically innocent”.

At that stage Lord Carey was already aware of six letters which had been sent to Lambeth Palace by members of the public, making further allegations about Ball’s behaviour.

These included parents who said their children had been sexually propositioned by Ball and a man who said he had been asked to masturbate in front of him at the age of 15.

The letters were never passed on to police.

Following the caution Ball retired to a rented cottage on the Prince of Wales’ Duchy of Cornwall estate and started to draw a pension. The report also criticises the “unusual degree of financial support from the Church” that he received in retirement, authorised by Lord Carey.

He was also allowed him to carry out services including baptisms and confirmations, as well as speaking at 17 public schools, some until as late as 2007, the report said, a decision in which Lord Carey “played the lead role”.

The former Archbishop also decided not to add him to the “Lambeth List”, which identifies clergyman about whom there are questions as to their suitability for ministry.

Ball was convicted of the offences after a renewed investigation into his actions was opened in 2012 following a review of past cases by Dr Rowan Williams, who became Archbishop of Canterbury in 2002.

The Archbishop of Canterbury Justin Welby processes to Canterbury Cathedral to deliver his Easter sermon
Justin Welby: report makes for “harrowing reading” Credit: Christopher Pledger

The report said Lord Carey “set the tone for the Church’s response to Ball’s crimes and gave the steer which allowed Ball’s assertions that the was innocent to gain credence”.

In a statement, Lord Carey said the report “makes deeply uncomfortable reading” and apologised to Ball’s victims.

He added: “I believed Peter Ball’s protestations and gave too little credence to the vulnerable young men and boys behind these allegations”.

In a statement the Rt Revd Dr Steven Croft, the Bishop of Oxford, said: “The Archbishop of Canterbury has written to Lord Carey and asked him to carefully consider his position as honorary Assistant Bishop.

“As I hold responsibility for granting him a licence to enable him to carry out his duties, Archbishop Justin has asked Lord Carey to talk to me and we have agreed to meet in the coming days for that conversation.

“In the meantime he has voluntarily agreed to step back from public ministry.”

Victims called for the former Archbishop to face criminal proceedings.

Richard Scorer, a specialist abuse lawyer at Slater and Gordon, who represents a number of Ball’s victims, said: “Given what’s in the report, there is now a clear case for the police and CPS to consider criminal charges against senior figures, including Lord Carey, for offences of misconduct in public office and perverting the course of justice.

“This report bears out our clients’ complaint that the Church of England deliberately concealed evidence of Ball’s criminality, and they are appalled by the true extent of collusion in abuse.”

In a foreword to the report, Dame Moira Gibb said: “Ball’s priority was to protect and promote himself and he maligned the abused. The Church colluded with that rather than seeking to help those he had harmed, or assuring itself of the safety of others.”

Archbishop Justin Welby said the report, titled Abuses of Faith, made “harrowing reading”.

“The Church colluded and concealed rather than seeking to help those who were brave enough to come forward,” he said.

http://www.telegraph.co.uk/news/2017/06/22/senior-church-figures-colluded-disgraced-bishop-peter-ball-cover/?utm_source=dlvr.it&utm_medium=twitter

Lord Carey steps back from ministry after ‘harrowing’ report on Peter Ball case

22 June 2017

BOTH the Archbishop of Canterbury’s predecessors have issued personal apologies, and the Archbishop has asked Lord Carey to consider his position as an honorary assistant bishop in the diocese of Oxford, after the publication of an independent report on the Peter Ball case and the Church’s part in it.

Lord Carey has been strongly criticised in the report of the review group, chaired by Dame Moira Gibb, which was published on Thursday, almost two years after the review was announced by Archbishop Welby (News, 7 October 2015).

The 81-page report, Abuse of Faith, sets out in detail the events and circumstances leading up to, surrounding, and following the arrest and imprisonment of Ball, who received a three-year sentence in October 2015, having admitted to a series of indecent assaults and the abuse of 18 young men aged 17-25. One of his victims took his own life. Ball, who is 85, was released in February after serving 16 months of his sentence.

The report criticises the conduct of several senior Church of England figures — in particular, Lord Carey, who, it says, failed to respond to repeated expressions of concern and allegations against Bishop Ball — most notably those of the late Neil Todd, who was repeatedly abused by the bishop during the 1980s and ’90s.

In a statement on the report, which he described as “harrowing”, Archbishop Welby said that the Church had “colluded and concealed” rather than acted to help survivors to come forward; and he repeated an “unreserved apology” for this.

“This is inexcusable and shocking behaviour, and, although Dame Moira notes that most of the events took place many years ago, and does not think that the Church now would conduct itself in the ways described, we can never be complacent: we must learn lessons.”

A copy of a letter to Lord Carey, requesting that he “carefully consider” relinquishing his title as honorary assistant bishop, was leaked online on Thursday morning. The existence of the correspondence was later confirmed in a statement from the Bishop of Oxford, Dr Steven Croft, who said that he had agreed to meet Lord Carey in the coming days. “In the mean time, he has voluntarily agreed to step back from public ministry.”

Receiving the report on behalf of Archbishop Welby, on Thursday, however, the Bishop of Bath & Wells, the Rt Revd Peter Hancock, who is the lead bishop on safeguarding, said that news of the leaked letter was “very disappointing”, since the focus should have been on the survivors.

“Having read the report, I am appalled and deeply disturbed by its contents. . . Today is a reminder of how we have failed, and this report provides robust recommendations for how we can improve our safeguarding practice.”

Ball had continued to abuse young boys and men sexually and physically for his own gratification, under the pretence of providing spiritual enlightenment, for the duration of his ministry as monk, priest, and, later, bishop, the report says. He had been involved in founding and running monastic religious communities since 1960, when concerns were first raised about his behaviour — including reports of praying naked on the chapel floor, self-flagellation, and the physical and sexual harassment and abuse of others, including schoolboys.

The Church’s “trivialisation” of such allegations, together with its naïve, prescriptive, and prejudiced attitude towards homosexuality, were in part to blame for its repeated failure to acknowledge and conduct a proper investigation into the exploitation carried out by Ball throughout his ministry, the report says.

It describes how, in October 1992, Mr Todd, after attempting to take his own life, disclosed the abuse to a “Mr A”, who passed on the allegations to the Bishop of Chichester at the time, the late Dr Eric Kemp, who subsequently briefed Lord Carey. It was not until Mr Todd attempted to take his life for a second time, however, that his worried parents contacted Gloucester Police. This eventually led to a Metropolitan Police investigation into the allegations.

Lambeth Palace later issued a press statement acknowledging the investigations. It stated that Lord Carey had instructed Bishop Ball to “rest” from his official duties, and was praying for him. There was no mention of survivors, and it said: “It must be emphasized that no charges have been brought against the Bishop, and the allegations about him are unsubstantiated. Moreover, the Bishop has a proven record of outstanding pastoral work, particularly amongst young people.”

In 1993, Ball stood down as Bishop of Gloucester after his arrest and caution for gross indecency. In the December, Lambeth Palace received seven letters containing “potentially disturbing information” about Ball, but did not release them during the police investigation. Lord Carey chose not to place Ball on the Lambeth list — naming clerics of questionable suitability, and during a CRB check of Ball in 2004, no evidence of the police caution had been recorded.

“Only one of those letters was handed over,” Dame Moira said on Thursday. “It is perfectly possible that the course of events would have been altered had those letters been handed over. It was deeply inappropriate that the Church did not hand them over at that time.”

Bishop Hancock said: “It was disgraceful that the Church consistently and completely failed those survivors at that time.”

Mr Todd took his own life in 2012, after the allegations against Ball resurfaced. This led to an investigation by Sussex Police, Operation Dunhill. Lord Carey had played down previous concerns, allowed Ball to continue his ministry, and even provided funds to assist Ball during this time, the report says.

Both Lord Carey and Lord Williams, who was Archbishop when the police investigation into Ball was conducted in 2012, have apologised.

Lord Carey states: “I accept the criticisms made of me. I apologise to the victims of Peter Ball. I believed Peter Ball’s protestations and gave too little credence to the vulnerable young men and boys behind those allegations. I regret that after Peter Ball was cautioned I did not place his name on the Lambeth list.”

While Lord Williams had “inherited a confused situation” from his predecessor, and started the process that led to Ball’s arrest and imprisonment, he had been too slow, and “missed the opportunity to review and clarify” the case, the report says.

Lord Williams acknowledged this in his apology. “It is clear that I did not give adequate priority to sorting out the concerns and allegations surrounding Peter Ball at the earliest opportunity. I recognise that such a delay is likely to have increased the pressure and distress experienced by the survivors of his abuse and I am sincerely sorry for this.”

The report also criticises other senior church figures, including Ball’s predecessor as Bishop of Gloucester, the Rt Revd John Yates, as well as Peter Ball’s idenitical twin brother, the Rt Revd Michael Ball, who conducted a “manipulative” campaign to allow his brother to continue his ministry.

Concerning one aspect of the twins’ relationship, it concludes: “It appears to us extraordinary that a bishop should, at best, be so careless as to allow himself to be impersonated, and particularly to be impersonated by a former bishop who had resigned in the circumstances detailed above. However, the Church has considered these matters and has taken no further action. That may be appropriate in the light of Bishop Michael Ball’s age, and status as a retired bishop.”

The report dismisses allegations that any member of the royal family intervened on Peter Ball’s behalf. “Ball himself, both in his correspondence and in his public statements, sought to exploit his contact with members of the Royal Family in order to bolster his position, particularly in the eyes of Lord Carey and others from whom he hoped to receive sympathetic treatment.

“We have reviewed all the relevant material including the correspondence passing between the Prince of Wales and Ball held by the Church and found no evidence that the Prince of Wales or any other member of the Royal Family sought to intervene at any point in order to protect or promote Ball.”

The report also notes of Peter Ball: “His decision to withhold his co-operation with this review does not sit well with [his] declarations [of remorse].”

Presenting the report, Dame Moira said: “Peter Ball abused his faith and his Church, appearing outwardly as a good and holy man while actively harming others. He abused the faith that people rightly had in him as a leader in the Church, and most importantly he abused the faith of those who sought spiritual guidance from him, and instead found hurt, deceit, and manipulation.”

These “shocking” acts were compounded by the failure of the Church to “respond appropriately” to numerous concerns raised by survivors and others, including those who had known and worked with Ball, she said.

Her report sets out 11 recommendations for the Church, both to support the complex needs of survivors properly, and to prevent further abuse. This includes reviewing its safeguarding procedures, as well as the responsibilities of the National Safeguarding Team and the Lambeth, Bishopthorpe, and Archbishops’ lists.

Bishop Hancock said that a copy of the report had been sent to all the Bishops, and that survivors would be invited to tell of their experiences, including the family of Mr Todd. He also referred to new safeguarding legislation and updated guidance from the House of Bishops.

“For the survivors, it may feel this is all too late. I am personally aware from my meetings with individual survivors in the course of my work that they live with the effects of this abuse for their whole life. I once again offer them my wholehearted apology.”

Report in full here.

https://www.churchtimes.co.uk/articles/2017/30-june/news/uk/lord-carey-steps-back-from-ministry-after-harrowing-report-on-peter-ball-case

Former Bishop of Truro Michael Ball and his paedophile ex-bishop twin Peter want to become Catholics so they can live in anonymity

8 DEC 2017

Peter Ball, the former Bishop of Lewes and Gloucester who boasted of links to royalty, has asked to join the Roman Catholic Diocese of Clifton in Bristol, a spokesman for the Church confirmed.

His identical twin brother Michael Ball, who was Bishop of Truro from 1990 to 1997, also sent an email to friends telling them of the idea.

From the email…”The events of the last years and rightly or wrongly the battering by the Church have totally wearied and reduced us.

“We will probably be joining the Roman Catholic Church soon.

…Michael Ball’s complaint of taking a “battering” from the Church was “flippant” and it was “disgusting” the pair were acting as though they were the victims.

A spokesman for the Roman Catholic diocese of Arundel and Brighton said: “We confirm that Peter Ball has been in contact with the Roman Catholic diocese of Clifton, in which diocese he now lives, expressing an interest in becoming a member of the Catholic Church.

“This matter is subject to discussions between Clifton diocese and the statutory authorities, who are the lead with regards to Peter Ball’s risk management in the community.

Disgraced paedophile former bishop Peter Ball with close friend Prince Charles

Disgraced paedophile former bishop Peter Ball with close friend Prince Charles

Peter Ball’s sentence came 22 years after the abuse first surfaced. He eventually admitted misconduct in a public office and two counts of indecent assault.

The court heard how Peter Ball had convinced some of his victims to strip naked to pray and even suggested they submit to beatings between 1977 and 1992.

The first of his victims to come forward took his own life in 2012 after hearing Sussex Police had reopened the case.

Former Archbishop of Canterbury George Carey resigned as honorary assistant bishop in the Diocese of Oxford after the public inquiry into child sex abuse last year heard he delayed a “proper investigation” into Peter Ball’s crimes for two decades by failing to pass information to police.

There were fears Peter Ball may have taken the place of his twin, who was Bishop of Truro in the Nineties, and therefore duped congregations in other parts of the UK.

The Diocese of Truro was understood to be looking into the evidence that Peter Ball conducted services in Cornwall.

Now it has emerged the Archbishop of Canterbury’s headquarters received at least six letters from other alleged victims detailing “potentially criminal” and “totally inappropriate behaviour” by Peter Ball in the early 1990s but did not pass them on to police until years later.

“The Church appears to have resorted to staggering levels of deceit in order to prevent the true extent of Ball’s offending coming to light,” said Richard Scorer, a solicitor who is representing victims of Peter Ball.

Details of the letters, all sent to the Church between December 1992 and February 1993, reveal that Peter Ball encouraged victims to pray naked, perform sex acts in front of him and share his bed.

Anglican officials who reviewed the letters in 2009 suggested that, had such evidence been given to detectives in 1993, Peter Ball may have been convicted of serious sexual offences rather than merely cautioned.

But instead of being made public, the letters were kept in confidential files at Lambeth Palace.

It was not until 2012, after several internal inquiries, that the Church finally released documents to police.

An independent review is also currently under way into the way the Church of England responded to the case involving Peter Ball.

https://www.cornwalllive.com/news/cornwall-news/former-bishop-truro-michael-ball-895920#ICID=sharebar_twitter

Church knew about allegations before Cornish preacher went on to abuse boys, investigation reveals

The diocese failed to investigate the accusations against Jeremy Dowling

25 MAY 2018

Dowling became such an important and valued worker and volunteer during a 40-year association with the diocese that a special service of thanks was given in his honour when he retired in 2009

A leading figure in the Church of England in Cornwall went on to commit child sex offences for several years after allegations about his behaviour with young boys were raised with the diocese and not acted upon, an official investigation has revealed.

The diocese failed to investigate the accusations against Jeremy Dowling, a lay preacher, allowing him to rise to influential positions including communications officer to the bishop, an independent review for the church concludes.

The report, released today, says there were “historic failings” within the diocese in dealing with the allegations, first raised in 1972. There was “ongoing knowledge” of the situation among senior figures in the diocese “well into the 1980s” with references to “a big fat file” on Dowling.

After the first allegations of Dowling abusing boys at a North Cornwall school where he taught were dropped by the Director of Public Prosecutions – because of a lack of corroborative evidence – the then Bishop of Truro Maurice Key wrote: “I suppose the problem will now be to find him some other work”.

Dowling became such an important and valued worker and volunteer during a 40-year association with the diocese that a special service of thanks was given in his honour when he retired in 2009.

In 2015 he was jailed for seven years after pleading guilty at Truro Crown Court to 15 charges of sexually abusing boys under 16.

In 2016 he was jailed for an additional eight years after being found guilty of six further charges of indecently assaulting a boy between 1973 and 1977. Those offences happened when he befriended the boy while a lay preacher at a church in Budehaven – and took place after concerns were first raised with the diocese.

The report’s author said the lack of action by the diocese allowed Dowling to gain credibility and authority.

“Because they didn’t take it any further it enabled Jeremy Dowling to reach a position where he made up his own rules, and his position within the church lent him credibility and authority,” said Dr Andy Thompson, an academic, magistrate and member of the Diocesan Council.

The Bishop of St Germans, Rt Revd Dr Chris Goldsmith, apologised for the lack of action and the suffering that resulted.

https://www.cornwalllive.com/news/cornwall-news/church-knew-allegations-before-cornish-1606727#ICID=sharebar_twitter

Bishop who ignored warnings about preacher Jeremy Dowling who went on to abuse boys is identical twin of paedophile ex-bishop

Former Bishop of Truro Michael Ball’s twin Peter Ball, the former Bishop of Lewes and Gloucester, was convicted of abusing young boys

25 May 2018

One of the bishops who ignored warnings about a preacher who went on to sexaully abuse boys is the identical twin of a paedophile ex-bishop.

It emerged this week that a leading figure in the Church of England in Cornwall went on to commit child sex offences for several years after allegations about his behaviour with young boys were raised with the diocese and not acted upon, an official investigation has revealed.

The diocese failed to investigate the accusations against Jeremy Dowling, a lay preacher, allowing him to rise to influential positions including communications officer to the bishop, an independent review for the church concludes.

The report, released on Friday (May 25), says there were “historic failings” within the diocese in dealing with the allegations, first raised in 1972. There was “ongoing knowledge” of the situation among senior figures in the diocese “well into the 1980s” with references to “a big fat file” on Dowling.

Dowling became such an important and valued worker and volunteer during a 40-year association with the diocese that a special service of thanks was given in his honour when he retired in 2009.

Cornwall mum made homeless with Down’s Syndrome son after mouldy flat sees child hospitalised

In 2015 he was jailed for seven years after pleading guilty at Truro Crown Court to 15 charges of sexually abusing boys under 16.

In 2016 he was jailed for an additional eight years after being found guilty of six further charges of indecently assaulting a boy between 1973 and 1977. Those offences happened when he befriended the boy while a lay preacher at a church in Budehaven – and took place after concerns were first raised with the diocese.

One of the leaders who was named in the report was Michael Ball, 86, who was Bishop of Truro from 1990 to 1997. The Right Reverend Ball told the diocese he had been informed of the allegations about Dowling but had not seen any need to take action as there had not been a prosecution.

His identical twin, Peter Ball, the former Bishop of Lewes and Gloucester who boasted of links to royalty, was jailed for 32 months in October 2015 for offences dating back to the 1970s against 18 young men at his home in East Sussex.

His sentence came 22 years after the abuse first surfaced. He eventually admitted misconduct in a public office and two counts of indecent assault. The court heard how Peter Ball had convinced some of his victims to strip naked to pray and even suggested they submit to beatings between 1977 and 1992.

The first of his victims to come forward took his own life in 2012 after hearing Sussex Police had reopened the case.

There were fears Peter Ball may have taken the place of his twin, who was Bishop of Truro in the Nineties, and therefore duped congregations in other parts of the UK.

The Diocese of Truro was understood to be looking into the evidence that Peter Ball conducted services in Cornwall.

Last year the brothers decided they wanted to become Catholics so they could live in anonimity. Peter Ball asked to join the Roman Catholic Diocese of Clifton in Bristol and both said they wanted to switch faith from the Church of England so they could “live and worship in anonymity” within the Catholic Church.

https://www.cornwalllive.com/news/cornwall-news/bishop-who-ignored-warnings-preacher-1608976

Image result for "jeremy dowling" + "bishop ball"

Former Bishop of Truro was Michael Ball, twin brother of convicted paedophile/friend of the royal family and Jimmy Savile – Bishop Peter Ball.


Jeremy Dowling

The Right Reverend Michael Ball – Bishop of Truro from 1990-97 – told the diocese he had been informed of the allegations but had not seen any need to take action as there had not been a prosecution.

His identical twin, former bishop Peter Ball, was jailed in 2015 for a string of indecent assaults on teenagers and young men.

A file found “in an unusual place” at the Bishop of Truro’s residence in 2013 was passed to police and led to Dowling’s prosecution.

http://www.bbc.com/news/uk-england-cornwall-44240688

A RECENT service at Truro Cathedral paid tribute to the work of Jeremy Dowling, the Diocese of Truro’s Communications Officer, who steps down at the end of December after more than 25 years in post. He has lived in the Bude area for more than 40 years.

On a wet and windswept evening, a congregation made up from clergy and people from across the diocese enjoyed a service that included readings, hymns and a sermon given by the former Bishop of Truro, Bishop Bill Ind. Also present were the current Bishop of Truro, The Rt Rev Tim Thornton, the Dean of Truro, The Very Rev Dr Christopher Hardwick, both Archdeacons and Mr Martin Follett, the Diocesan Registrar.

During his sermon, Bishop Bill paid tribute not only to the work that Jeremy undertook as Communications Officer but also his very substantial other work for the Diocese including nearly 40 years as a Reader,

seventeen years as Chairman of the House of Laity of the Diocesan Synod, one of the first people to be made Lay Canons of the Cathedral, a member of the General Synod for 27 years, as well as sitting at one time or another on virtually every Board and Committee of the Diocese.

He said, “Jeremy’s media and broadcasting skills are second to none.”

His experience and expertise in the television broadcast area was particularly noted, especially the background work he was able to do which led to programmes such as the very successful and popular BBC series ’Seaside Parish’ featuring Boscastle and the surrounding parishes, which enjoyed weekly audiences if over three million, ’Island Parish’ featuring the Isles of Scilly and ’The Monastery.’

Summing up, Bishop Bill said: “He has been a critical friend, someone who has told me the truth as he sees it. He has made me and indeed others both laugh and think and for both these things and much else I remain profoundly grateful. The Diocese owes him an enormous amount and so indeed do I and a host of others.”

Jeremy Dowling has lived in the Bude area of North Cornwall for more than forty years, with thirty years spent in the parish of St Gennys, and he is Chair of Governors of Budehaven Community School.

In his thanks and response to Bishop Bill, Jeremy noted how the communications role had changed greatly with much more emphasis today on electronic media. He acknowledged with gratitude the work of the local press and media, recognising its essential vitality and the key role it played in championing issues which were important for the church and for society.

“We have enjoyed excellent relations with the westcountry media” he said “and it has been a privilege to work with local journalists and broadcasters.”

He concluded by saying: “In my view, the strength of the Church remains in the local community. There is a lot going on. And the thread which runs through most of the stories is undeniably positive. They chronicle a vigorous, interesting, dynamic, eccentric and imaginative life in the church in Cornwall. Long may it

continue.”

After refreshments, a large bouquet was presented by Bishop Tim to Daphne Dowling in recognition of her support for her husband, and Jeremy was presented with a substantial cheque from parishes and individuals in the Diocese

Prime Minister lauds accomplishments of Bude organisation as he presents Big Society Award

BIG SOCIETY: Pictured above, with Prime Minister David Cameron and North Cornwall MP Dan Rogerson, are Co-founder of Community Action Through Sport (CATS) and volunteer Denise Jane May, CATS trustee and volunteer Jeremy Dowling, CATS Project Development Manager Karen Hemmings, CATS Project Development Assistant Louise Anne Harris and CATS trustee and volunteer Sharon Caroline Marshall.

 

Ex Truro Diocese worker Jeremy Dowling sexually abused boys

5 June 2015

An ex-Diocese of Truro press officer has admitted sexually abusing boys over a period of more than 10 years.

Jeremy Dowling, 76, carried out the assaults on five children, aged between 12 and 15, from 1959 to 1971.

Truro Crown Court heard Dowling abused the boys at sporting events and in toilets while working as a teacher in Devon.

The Bishop of Truro described Dowling’s offences as “deeply shocking” and said his thoughts were with the victims.

Sentencing was adjourned until July 10 for a pre-sentence report to be prepared.

Dowling, of Church Path, Bude, retired from the Diocese of Truro in 2009 after 25 years of service.

‘Damaging impact’

He pleaded guilty to 13 counts of indecent assault on boys aged 12 to 15 and two counts of indecency with a child.

The court heard one assault was carried out on a boy at a cricket match. Others took place in an attic, in storage rooms at a sporting pavilion and in outside toilets.

The Right Reverend Tim Thornton, Bishop of Truro, said many people would have known Dowling as a reader at St Michael’s Church and St Genny’s Church in Bude and as a member of the Diocesan and General Synods.

Bishop Thornton said: “Offences like this will have a damaging and lasting impact on people’s lives.

http://www.bbc.com/news/uk-england-cornwall-33025742

Former Cornwall preacher Jeremy Dowling ‘assaulted boy’

The assaults happened when Jeremy Dowling was a lay preacher at two churches in the Bude area of Cornwall, Truro Crown Court was told.

Mr Dowling met the boy when he was 10 through church activities and “took him under his wing”.

He has denied six counts of indecent assault on a child and two counts of gross indecency with a child.

The assaults happened in the 1970s before Mr Dowling became a press spokesman for the Diocese of Truro, the court heard.

‘Long time ago’

Jo Martin, prosecuting, said some of the assaults took place at Mr Dowling’s house after the boy had been invited for dinner and on one occasion he was taken to a church on the north coast.

She said Mr Dowling took him up a tower and showed him the view, then took him to a room and assaulted him.

The alleged victim did not tell anyone when he was a child but later, when he was married, told his wife about the assaults.

He said when his wife rang up Mr Dowling, accusing him of being a paedophile, Mr Dowling replied “that was a long time ago”.

He said he eventually went to the police after reading in news reports that Mr Dowling had admitted abusing five boys when he was a teacher at a private school in the 1960s.

Mr Dowling is currently serving a jail term for those offences.

http://www.bbc.com/news/uk-england-cornwall-37225234

Tributes paid as Bude man retires as diocesan communications officer after 25 years

A RECENT service at Truro Cathedral paid tribute to the work of Jeremy Dowling, the Diocese of Truro’s Communications Officer, who steps down at the end of December after more than 25 years in post. He has lived in the Bude area for more than 40 years.

On a wet and windswept evening, a congregation made up from clergy and people from across the diocese enjoyed a service that included readings, hymns and a sermon given by the former Bishop of Truro, Bishop Bill Ind. Also present were the current Bishop of Truro, The Rt Rev Tim Thornton, the Dean of Truro, The Very Rev Dr Christopher Hardwick, both Archdeacons and Mr Martin Follett, the Diocesan Registrar.

During his sermon, Bishop Bill paid tribute not only to the work that Jeremy undertook as Communications Officer but also his very substantial other work for the Diocese including nearly 40 years as a Reader,

seventeen years as Chairman of the House of Laity of the Diocesan Synod, one of the first people to be made Lay Canons of the Cathedral, a member of the General Synod for 27 years, as well as sitting at one time or another on virtually every Board and Committee of the Diocese.

He said, “Jeremy’s media and broadcasting skills are second to none.”

His experience and expertise in the television broadcast area was particularly noted, especially the background work he was able to do which led to programmes such as the very successful and popular BBC series ’Seaside Parish’ featuring Boscastle and the surrounding parishes, which enjoyed weekly audiences if over three million, ’Island Parish’ featuring the Isles of Scilly and ’The Monastery.’

Summing up, Bishop Bill said: “He has been a critical friend, someone who has told me the truth as he sees it. He has made me and indeed others both laugh and think and for both these things and much else I remain profoundly grateful. The Diocese owes him an enormous amount and so indeed do I and a host of others.”

Jeremy Dowling has lived in the Bude area of North Cornwall for more than forty years, with thirty years spent in the parish of St Gennys, and he is Chair of Governors of Budehaven Community School.

In his thanks and response to Bishop Bill, Jeremy noted how the communications role had changed greatly with much more emphasis today on electronic media. He acknowledged with gratitude the work of the local press and media, recognising its essential vitality and the key role it played in championing issues which were important for the church and for society.

“We have enjoyed excellent relations with the westcountry media” he said “and it has been a privilege to work with local journalists and broadcasters.”

He concluded by saying: “In my view, the strength of the Church remains in the local community. There is a lot going on. And the thread which runs through most of the stories is undeniably positive. They chronicle a vigorous, interesting, dynamic, eccentric and imaginative life in the church in Cornwall. Long may it

continue.”

After refreshments, a large bouquet was presented by Bishop Tim to Daphne Dowling in recognition of her support for her husband, and Jeremy was presented with a substantial cheque from parishes and individuals in the Diocese



Theresa May has held private PRAYER sessions with the Archbishop of Canterbury

  • PM and Justin Welby have met for private sessions since May entered No 10 
  • Lambeth Palace is on the South Bank just a short drive from 10 Downing Street

The Prime Minister, who is regularly pictured at church, is said to find the meetings with Justin Welby a ‘great comfort’

…she has had meetings and held prayers with the Archbishop of Canterbury.’

Justin Welby (file picture left in February) lives at Lambeth Palace, which is just minutes from Downing Street 

Justin Welby lives at Lambeth Palace, which is just minutes from Downing Street

Elders of Cape Town church expel alleged abuser John Smyth

09 June 2017

JOHN SMYTH, the Evangelical Christian camp leader accused of savagely beating young men during the 1970s and ’80s in his garden shed (News, 13 April), has been formally expelled from his church in South Africa, where he now lives.

In a lengthy statement, the elders of Church-on-Main, Cape Town, where Mr Smyth and his wife, Anne, have worshipped since 2013, announced that the Smyths would be “excommunicated, with all its scriptural implications”, because of Mr Smyth’s refusal to engage with the church leadership about the allegations.

The statement explains that the church was aware that some had criticised Mr Smyth’s holiday-camp ministry in Zimbabwe when he first joined Church-on-Main, four years ago, but had been assured that this was nothing more than jealousy at the ministry’s success.

Last September, however, the church elders found out that Mr Smyth was regularly meeting young men from Church-on-Main at a sports club, playing squash before showering together and then questioning them about “pornography, masturbation, and other sexual matters”.

They then discovered that Mr Smyth’s Zimbabwe camps had been involved in a court case. The elders’ statement said, however, that whenever they attempted to discuss the matter with Mr Smyth, he became defensive, and attacked the elders’ leadership of the church.

After the allegations first surfaced in the UK in February (News, 10 February), the elders said that they had urged Mr Smyth to return to the UK to work with the police, and told him not to attend Church-on-Main meetings or contact any other church members.

Because he has refused to engage with the leaders, or follow their advice, he has now been excommunicated from the church, the statement says.”

Our counsel has always been for John to present himself to the UK authorities for whatever consequences he could face, admitting, if necessary, to any accusation that holds substance, and to apologise, asking for forgiveness and mercy,” it says.”

If our having had John as a leader of a discipleship group, or his role in any form of ministry has led to hurt or risk to anyone, or to bringing the glorious gospel of Jesus Christ into disrepute in any way; for this we apologise.”

Channel 4 News, which first broke the story in February, has broadcast new details that appear to suggest that the Archbishop of Canterbury continued to be involved with Iwerne Trust camps at the same time as Mr Smyth.

Archbishop Welby was a dormitory officer at the holiday camps in the late 1970s, when Mr Smyth was one of the leaders. A statement from Lambeth Palace, issued after the Channel 4 programme, said that the Archbishop had worked with Mr Smyth, but that no one had discussed the allegations with him.”

I was completely unaware of any abuse,” the Archbishop told LBC radio in February. “I never heard anything at all, at any point. I never had the slightest suspicion that there was anything going on.”

Last week, Channel 4 News reported that the Archbishop’s name appeared on a speaker roster for an Iwerne Trust camp in 1979, as did Mr Smyth’s, and he remained on the camps’ mailing list, despite then living in France.

Archbishop Welby denied that these documents implied that he was connected to Mr Smyth. “I left to work and live in Paris in 1978 — as I understand it, a year before the abuse was to begin — and did not return to work in the UK until 1983,” he said in a statement this week.”

As I have previously stated, I was not one of the inner circle of people surrounding John Smyth, or in the leadership of the camps. A talk on reading the Bible, which I did as a one-off in 1979, does not make anyone a member of an ‘inner circle’.”

A spokeswoman for the Archbishop declined to comment on Mr Smyth’s expulsion from Church-on-Main.

https://www.churchtimes.co.uk/articles/2017/9-june/news/uk/elders-of-cape-town-church-expel-john-smyth

methinks Welby doth ‘protest too much’

Update on Mark Carey: Apr 6 2017

Very Curious...only two sites reporting this news on Mark Carey – Christian Today.com -&  Anglican Ink and not one of the major newspaper sites that published the original arrest news??

Were they instructed not to??….


Son of former Archbishop of Canterbury cleared of sex abuse charges

The son of former Archbishop of Canterbury George Carey has been cleared of sex abuse charges against a young woman.

Rev Mark Carey was suspended from ministering by the Diocese of Leeds after he was arrested in October 2016 for allegedly sexually attacking a young woman in the 1980s.

He was later released on bail but has since reported the case has been dropped and no further action will be taken, according to Anglican Ink.

A source close to Mr Carey told Christian Today that both he and the diocese of Leeds had been informed by the police that the allegations were ‘unfounded’. 

The incident was said to have taken place while his father, now Lord Carey, was vicar at St Nicholas’, Durham, between 1975 and 1982.

Mark Carey, now 51, would have been in his teens at the time. Carey Senior then became Archbishop of Canterbury between 1991 and 2002. He has maintained a high profile since as a media commentator and campaigner.

‘Woke up with a sense of freedom for first time in 5 months. Accusation & condemnation wiped out,’ Mark Carey wrote on Facebook last month. ‘Now in recovery mode.’

He later posted on Facebook his relief and celebration at being cleared.

Carey describes himself as a ‘pioneer minster’ in the Church of England. He is involved in the Kairos Christian fellowship which is a Christian community movement that meets in pubs, cafes and homes.

Christian Today has requested a comment from the Leeds diocese.

https://www.christiantoday.com/article/son.of.former.archbishop.of.canterbury.cleared.of.sex.abuse.charges/106876.htm

Here’s the Anglican link article:

 

Carey cleared

06 Apr 2017

Author:

George Conger

The son of the former Archbishop of Canterbury, Lord Carey, has been cleared of charges that he abused a young girl. The accusations against the Rev. Mark Carey led to his suspension by the Diocese of Leeds and questioning by police. However, on 8 March 2017 he reported: “Just heard that police have dropped case & no further action.”

On 19 Oct 2016, Mr Carey was arrested at his home in Harrogate, North Yorkshire, by officers of the Durham Constabulary accused of having sexually abused a young women in the 1980s. He was released after posting bail, pending further inquiries. The incident is alleged to have occurred during Lord Carey’s tenure as vicar of St Nicholas’ Church in Durham between 1975 and 1982. Mark Carey, now 51, would have been no more than 17 years old at the time.

Supported by family, friends and his parishioners, Mr. Carey maintained his innocence throughout his five month ordeal and was grateful for his vindication. Friends of the Harrogate vicar told AI they were shocked by the accusations and considered them “absurd”. Following his vindication from the false charges of abuse, Mr. Carey wrote on his On his Facebook: “Woke up with a sense of freedom for first time in 5 months. Accusation & condemnation wiped out. Now in recovery mode.”

For six years Mr Carey has served as the “pioneer minister” of the Kairos Christian fellowship that meets in homes, pubs, and cafes. At its launch in 2010, Mr. Carey told the BBC “Kairos focuses on releasing communities of followers to live out the mission of Jesus.”

“While it is one church it is also six smaller network churches, small to mid-size groups of up to thirty people known, officially, as ‘mission-shaped communities’ (MSCs).”

“With a variety of imaginative titles, each MSC is treated as a church in its own right, meeting not in a church building but in homes, cafes, pubs, or even outdoors”.

Disclaimer: While the author of this report has never met the Rev. Mark Carey, he was a colleague of the brother of the accused, Andrew, for several years at the Church of England Newspaper.

Comments:

Let’s be honest, dropping the case is a far cry from having been cleared.

http://anglican.ink/article/carey-cleared

“Unfounded” Does Not Mean “Found Innocent”

In reading coverage of various rape and/or sexual assault accusations, I’ve been struck repeatedly by the bizarre conflation of the term “unfounded” with the words “false”, “false accusation”, and “proven innocent” to describe accusations that never made it to court.

link


Rev Mark Carey son of former Archbishop of Canterbury Lord George Carey arrested over historic child sex abuse claims

21 Oct 2016Mark Carey (left) with his father, who was The Archbishop of Canterbury, at Wakefield Cathedral after ordained as a priest in the Church of England in 1995

The Archbishop of Canterbury, Dr George Carey, at Wakefield Cathedral at his son Mark  Carey’s ordination – July 2 1995

Rev Mark Carey, 51, is accused of assaulting a young girl in the 1980s when he was in his late teens

His alleged victim, now in her 30s, claimed she was assaulted when he was in his late teens and Lord Carey was a priest in the North-East.

The incident is alleged to have occurred during Lord Carey’s tenure as vicar of St Nicholas’ Church in Durham between 1975 and 1982.

Mark Carey, now 51, would have been no more than 17 years old at the time.

(Mark Carey was born in 1965.  He was 17 in 1982. If the woman is in her 30s, now, she would have been born between 1977-1986; so in 1982, the oldest she would have been was 5 years old.)

Rev Carey was released on police bail and has since been suspended by the Church of England pending inquiries.

Father of three Rev Carey, who followed his father into the church in 1995

Rev Carey’s father was Archbishop between 1991 and 2002.  George Carey became a member of the Privy Council in the same year that he was made Archbishop – 1991.

He was joined at his home in Harrogate, North Yorks, yesterday by his father and mother Eileen. His wife Penny, 53, whom he married in 1988, refused to comment.

The alleged victim approached Durham Police to make the complaint. Officers from North Yorkshire police arrested him.

The former social worker – was ordained in 1995 at Wakefield Cathedral, witnessed by his father.

He had previously been curate of Christ Church in South Ossett, West Yorks and went on to be a parish priest in Sheffield and then Harrogate in 2007.

Last night, a Church of England spokesman said: “A 51-year-old priest in the Diocese of Leeds has been suspended by the Bishop following his arrest by Durham Constabulary concerning allegations of historical abuse.

link

In 2010 he launched the Kairos church in the town to replace the redundant St Mary’s and now worships in homes, pubs, cafes and even outdoors.

His brother Andrew, who works at the Christian charity Barnabas Fund, told the Sunday Telegraph that his family did not wish to comment on the allegations against Rev Carey.

link


Mark Carey

I used to work with children and young people as a Residential Social Worker in Bristol before becoming a C of E Vicar. I now lead Kairos Church, formerly St Mary’s Harrogate with All Saint’s, Harlow Hill.

mark-carey-fb

link

Page 58

Nursing Times, Nursing Mirror, Volume 83 – 1987

Mark Carey was a residential social worker. 1987

Mark Carey is passionate about adoption.

Mark CareyProtected Tweets
@kairoscarey

Follower & friend of Christ, husband, father of 3. Pioneer Minister Kairos Network Church.

Passionate about discipleship, adoption & Arsenal FC.

https://twitter.com/kairoscarey

(Notable Crusader Peter Broadbent  was at St Nicholas’ Church til 1980.

Ordained in 1977, His first parish job was as Curate to George Carey, when he was Vicar of St Nicholas, Durham and he was an Islington Labor councillor 1982-1990.)

Image result for islington councillor pete broadbent 1982

link

Broadbent was educated at Merchant Taylors’ School, Northwood, Middlesex. He was 15 when he became a committed Christian through the Crusaders youth organisation. He studied English at Jesus College, Cambridge and then studied theology at St John’s College, Nottingham before being ordained.

more on Broadbent below-back to Mark Carey…


‘Homeless’ church welcomes new vicar
A NEW vicar at St Mary’s and All Saints Church has been welcomed with open arms to a congregation displaced after their church building was made redundant. Rev Mark Carey, who is the son of former Archbishop of Canterbury Dr George Carey, was delighted at his reception.

Since 2006 when their building was declared unsafe, the congregation have been worshipping at Harrogate Grammar School where Mr Carey was licensed as Priest in Charge during a ceremony at the beginning of this month. The Bishop of Leeds and Ripon was there to lead the ceremony.

Mr Carey was previously vicar at St Mark’s Church Grenoside, Sheffield, where he had been for eight years. His wife Penny, and three children joined him at the vicarage in September as they embarked on their new life in Harrogate.

http://www.harrogateadvertiser.co.uk/news/homeless-churchwelcomes-new-vicar-1-2639829


New Wine is a national network of clergy and churches supporting and encouraging one another
mark-carey-inspire-wine
george-carey-GETTY.jpg

GEORGE AND MARK CAREY; ABUSE CLAIMS


 Image result for Former Archbishop of Canterbury admits he deserves criticism over ex-bishop sex abuse 'cover up'Image result for Former Archbishop of Canterbury admits he deserves criticism over ex-bishop sex abuse 'cover up'
Lord Carey ‘may face explicit criticism’ from abuse inquiry

21 Oct 2016

THE former Archbishop of Canter­bury Lord Carey has been granted core-participant status at the In­­dependent Inquiry into Child Sexual Abuse (IICSA) after Professor Alexis Jay, who chairs it, ruled that he “may be subject to explicit crit­­­­ic­­ism by the Inquiry in due course”.

Core participants are entitled to legal representation at the Inquiry and to receive advance disclosure of evidence. They may also cross-examine witnesses when the public hearings begin, something that is expected to happen next year.

In his application for core parti­cipant status, lawyers for Lord Carey explained that, as a retired office-holder, he was led to be believe that he would be represented at the In­­quiry by lawyers for the Arch­bishops’ Council, which also has core-participant status. “Once the Archbishops’ Council indicated to Lord Carey that there might be some conflict between their interests and those of Lord Carey, he made contact with alternative legal repres­entatives,” Professor Jay said.

ball-carey-cover-up

In granting core-participant status, Professor Jay said that “Lord Carey was Archbishop of Canter­bury at the time when [the former Bishop of Lewes, then of Gloucester] Peter Ball’s sexual abuse came to light in 1992, and when he received a police caution in 1993, and it is stated in Lord Carey’s application that he had a pastoral and discip­linary role in relation to Peter Ball at that time.

I also understand that Lord Carey was involved in deciding on Peter Ball’s further officiation within the Church of Eng­land after he received that caution.

”The Inquiry will consider the extent to which any failings identi­fied in relation to the diocese of Chichester and Peter Ball are repres­entative of wider failings within the Church of England and/or the An­­glican Church in general, and the nature and extent of any failings of institutions to protect children from abuse.

link

A lawyer representing victims of an abusive Church of England bishop has called for an investigation into the ‘misconduct’ of former Archbishop of Canterbury Lord Carey of Clifton.

According to this report, David Greenwood, representing several of Peter Ball’s victims, said he was sure the Church had covered up evidence and urged Scotland Yard to:

Consider opening an investigation into perverting the course of justice by church officials.

Church Witheld Evidence

Greenwood spoke out after the release of documents that suggest the head of the Church of England knew about the abuse allegations but failed to act.

Sussex police documents, released under the Freedom of Information (FoI) Act last week, reveal that Lambeth Palace, the residence of the head of the Church, received six letters and a number of verbal reports detailing allegations of abuse shortly after the initial investigation into Ball in 1992.

In the letters, Ball is accused of encouraged victims to pray naked, perform sex acts in front of him and share his bed.

Image result for PETER BALL AND PRINCE CHARLES

Friends: Prince Charles is pictured here with the former Bishop of Lewes and Gloucester Peter Ball in 1992

Lord Carey, who was Archbishop of Canterbury from 1991 to 2002, became Chancellor of the University of Gloucestershire in Cheltenham after he retired.

Lord Carey – correspondence with the Crown Prosecution Service (CPS) -a cover-up

The files indicate the Church failed to pass this evidence on to police. In February 1993, Lord Carey wrote to the Director of Public Prosecutions and a chief constable in support of Ball.

Last October, current Archbishop Justin Welby launched an independent review into the Church of England’s response to the allegations.

A spokesperson for Lord Carey declined to comment but said Carey was cooperating fully with Welby’s inquiry.

The newly released documents also suggest Ball associated with other known sex offenders in the clergy and was investigated in 2008 for being part of suspected pedophile ring.

The documents show Ball covered for and helped priests accused of sex abuse.

link

Image result for george carey and queen mum elizabeth

Lord George Carey

In England his time saw notable national events: he took part in the funeral of Diana, Princess of Wales in 1997,

led worship for the nation in the Dome for the new Millennium;

quoted at the Service commemorating the victims of the 9/11 attacks; 

led the tributes at the funeral of Queen Elizabeth the Queen Mother in 2001 and

preached memorably at Golden Jubilee of the Queen in 2002

He retired in 2002 at the age of 66 and was made a life peer, taking the title Lord Carey of Clifton, reflecting appreciation of his time as Bishop of Bath and Wells.

link

Lord Carey said he was ‘appalled’ at the way it (the church) handled the accusations against Bishop George Bell

link

Image result for St Nicholas church , Durham lord carey

georg-carey-bio

link

[The Rt. Rev. George Leona...]

Carey left school at age 15 and served as a radio operator in the Royal Air Force from 1954 to 1956. By 20 he had undergone a religious conversion—not Paul’s experience on the road to Damascus, he admitted, but the simple conviction that he had found something special. He was then admitted to King’s College, London University, from which he received a bachelor of divinity degree in 1962. Beginning his clerical career as a curate in Islington (1962–66), Carey was also a lecturer at Oakhill College in Southgate (1966–70) and at St. John’s College in Nottingham (1970–75). He was vicar of St. Nicholas Church in Durham (1975–82) and principal of Trinity College, Bristol (1982–87). In 1987 Carey was made bishop of Bath and Wells, and in 1990 he was named to succeed as archbishop of Canterbury.

link

Archbishop of Canterbury Robert Runcie announced that Queen Elizabeth II had just officially appointed Dr. George Carey to succeed him when he retires next January 31.

The appointment came as a surprise to many who were following the nomination process. In his prepared statement, Runcie said the appointment was “imaginative…

Some observers were surprised because Carey was not mentioned on the lists of possible choices circulating in the press. At 54 years of age, Carey is also considered comparatively young for such an appointment — and he has been bishop of Bath and Wells only since 1987.

link

https://i1.wp.com/www.glcarey.co.uk/Images/Pictures/GardenParty.jpg

2001 Her Majesty the Queen greets members of the Carey family at the Lambeth Palace Garden Party – sharing a special handshake with Carey family member.https://web.archive.org/web/20070807190908/http://glcarey.co.uk/Images/Pictures/HRH-meets-Carey-family.jpg 2001

http://www.glcarey.co.uk/Pages/PhotoFile.html

Image result for lord chris patten and wife

Lord Chris Patten with wife, Lavender

Lord George Leonard Carey director at same company as Chris Patten’s wife LADY MARY LAVENDER ST LEGER PATTEN OF BARNES

United Learning Trust – To advance, for the public benefit, education in the United Kingdom by establishing, maintaining, operating and developing schools. A charity, limited by guarantee

https://companycheck.co.uk/company/04439859/UNITED-LEARNING-TRUST/companies-house-data

Lord Carey is a director of

Christian Weekly Newspapers along with RT REVD PETER ALAN BROADBENT

link

Image result for crusaders PETER BROADBENT founder

RT REVD PETER ALAN BROADBENTdirector at son Mark Carey’s school ST.JOHN’S COLLEGE NOTTINGHAM LIMITED

He became a Christian at 14 through ‘Crusaders’, a Christian youth organisation. He trained for the ministry at St John’s College, Nottingham.

link

link

Image result for RT REVD PETER ALAN BROADBENT

Peter Alan “Pete” Broadbent is a British Anglican bishop. He is the current Church of England Bishop of Willesden, an area bishopric in the Diocese of London. He was also the acting area Bishop of Stepney

He was 15 when he became a committed Christian through the Crusaders youth organisation. He studied English at Jesus College, Cambridge and then studied theology at St John’s College, Nottingham before being ordained.

Broadbent’s  first parish job was as Curate to George Carey, the previous Archbishop of Canterbury, when he was Vicar of St Nicholas, Durham

Broadbent moved to the Diocese of London in 1980 to be curate of Emmanuel Church, Holloway and the Bishop of Stepney‘s Chaplain for Mission.

Pete Broadbent has served as a member of General Synod on and off since 1985 and was a member of its Standing Committee. He chaired the Business Committee of Synod from 1996 – 2000 and was also a founder member of the Archbishops’ Council.

In 1983 he became Anglican Chaplain to the Polytechnic of North London (now London Metropolitan University) as well as honorary curate of St Mary’s, Islington. He moved to the Willesden Area in 1989 to become Vicar of Trinity St Michael, Harrow and was made Area Dean of Harrow in 1994. The following year he was appointed as Archdeacon of Northolt, working with the former Bishop of Willesden.

link

broadbent

broadbent-isl-and-polytechnic

1989

Broadbent is a member of the Labour Party and was a councillor for the London Borough of Islington from 1982 and 1990, being the chair of their Development and Planning Committee.

Jeremy Corbyn was elected as the Member of Parliament for Islington North in 1983.

Image result for margaret hodge and pete broadbent islington

Horrific crimes against children in the care of Islington Council were committed while Margaret Hodge was council leader (1982-1992).

When a shocking catalogue of abuse was exposed by the Evening Standard in 1992, Hodge accused the paper of “sensationalist gutter journalism”. Tony Blair later appointed her as the first Minister for Children.

link

Derek Sawyer – Leader of Islington Council 1992-1994

Pete Broadbent councillor for the London Borough of Islington from 1982 and 1990

Jeremy Corbyn – Member of Parliament (MP) for Islington North since 1983

link

Councillors row over ‘breach of conduct’ (18.11.82)

Islington
Clr David yams attacked some Labour councillors re: the appointment of a new superintendent at Sheringham Road Children’s Home

Pete Broadbent

Bishop of Willesden

London, United Kingdom
Religious Institutions
Current
  1. Memralife Group,
  2. West London YMCA,
  3. Church of England
Previous
  1. Church Urban Fund,
  2. St John’s Nottingham
Education
  1. St John’s College Nottingham

Experience

  • Chair of Board

    Memralife Group
    2009 – Present (7 years)
  • President

    West London YMCA
    2004 – Present (12 years)
  • Bishop of Willesden

    Church of England
    2001 – Present (15 years)
  • Trustee

    London Diocesan Fund
    1988 – Present (28 years)
  • Member

    Spring Harvest
    1988 – Present (28 years)
  • Trustee

    Church Urban Fund
    2002 – 2011 (9 years)
  • Chair of Council

    St John’s Nottingham
    2002 – 2010 (8 years)

Volunteer Experience & Causes

Causes Pete cares about:

  • Arts and Culture
  • Education
  • Politics

Organizations Pete supports:

  • Tottenham Hotspur FC

link


Image result for bishop George Carey's wife, Eileen

George Carey with wife Eileen.

George Carey’s wife, Eileen, was won over by Billy Graham Crusade

When Eileen was sixteen the young American preacher, Billy Graham, was conducting his London Crusade and once a week Eileen took a chartered bus to London.

Later she welcomed Billy Graham to Canterbury Cathedral for the enthronement of her husband.

link

cliff-richard-and-billy-graham
Jun. 20, 1967 – Evangelist Billy Graham visits the set of the new Cliff Richard film ”Two a Penny”: Evangelist Billy Graham today paid a visit to the set at Goldhawk studies, London W. C. where he met pop star Cliff Richard, actress Dora Bryan and Ann Holloway, stars of his film ”two a penny”, which has a religious theme. The film is financed by the Graham organisation and the profits will go to help their work. Cliff Richard, who is quitting show business at the end of the year, is working in the film without pay.
Image result for billy graham and cliff richard
Billy Graham and Cliff Richard

Archbishop of Canterbury George Carey made a personal and pastoral visit to the Revd Dr Billy Graham today.
Archbishop George and Eileen Carey are close friends of Dr and Mrs. Graham.
Image result for billy graham and lord carey
Billy Graham and George Carey
Dr Graham was present at the Archbishop’s enthronement 10 years ago and met together several years ago during a meeting at Kanuga Episcopal Conference Centre in North Carolina.
March 8, 2001
HABERDASHERS’ ASKE’S SCHOOL FOR GIRLS
…the panel secured for the debate was equal in caliber to any TV current affairs programme. Chaired by Sky News presenter Gillian Joseph, the panel of six was drawn from the world of Westminster politics, journalism, medicine and the Church: Keith Vaz (MP for Leicester East), Danny Finkelstein (political columnist at The Times), Dr. Ellie Cannon (GP The Mail, journalist & author), Oliver Dowden (MP for Hertsmere), Matthew Parris (political columnist at The Times & former MP), and Pete Broadbent (Bishop of Willesden). 
Image result
Peter Bottomley and George Carey

I’ll sue if anyone links me to untrue paedophile claims, says Tory grandee Sir Peter Bottomley

Denied there had been a major Establishment conspiracy to cover up abuse


George Carey blasts Trump protesters in London over ‘hysterical’ attacks on President

Feb 5 2017

FORMER Archbishop of Canterbury George Carey has called for the world to give Donald Trump a chance.

In an extraordinary intervention, he accused the new US President’s critics of a “hysterical overreaction that poses a danger to the kind of constructive relationship we should have with the President”.

it is one of the key characteristics of those who consider themselves progressive to reserve condemnation for America, ‘the West’, or Israel and ignore much greater evil-doers.”

http://www.express.co.uk/news/uk/763210/trump-protest-london-criticism-george-carey-theresa-may-uk-us-president

Collection of many articles re: clergy abuse

 
George Carey and Greville Janner

 DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.
Advertisements

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader charged with buggery of a 14-yr old.


Update

Croydon headmaster John Coatman spared jail for abusing teenage boy

Jan 12 2018

A former headmaster, honoured for his services to young people, has been spared jail after admitting sexually abusing a 15-year-old boy.

In August 2016 retired John Coatman, 76, was found guilty of gross indecency for an offence committed in the 1970s.

His conviction had been thrown out by the Court of Appeal last April because of an error on his charge sheet.

When the case returned to the Old Bailey for a retrial he pleaded guilty to a charge of indecent assault.

‘Rough and tumble’

Coatman, of Leyburn Gardens, Croydon, south London, was sentenced by Judge Anne Molyneux to 21 months imprisonment, suspended for two years.

He was also made subject to a 12-month supervision order.

The court heard that the teenager would visit Coatman’s home, where they would engage in “rough and tumble”, which later took a sexual turn as the adult touched the boy over his clothes.

Matters escalated when, on three separate occasions, the pair undressed in Coatman’s bedroom and the head teacher touched the boy sexually.

‘Difficult to comprehend’

The defendant was headteacher of St Andrew’s secondary school in Croydon, but the complainant was not a pupil there.

Coatman retired in 1998 after 42 years as a teacher and was awarded an MBE in 2012.

Prosecutor Mark Trafford QC told the Old Bailey: “The defendant’s MBE for services to young people was something that he (the complainant) found difficult to comprehend under the circumstances.”

Claims against Coatman, who has inoperable cancer, surfaced in 2014.

In a victim impact statement, the complainant said the incidents had left him with emotional and relationship difficulties.

Sentencing, Ms Molyneux said: “You were in a position of considerable trust, and he trusted you. He enjoyed being with you over a short period of time.”

http://www.bbc.com/news/uk-england-london-42664643


Retired Croydon headteacher admits sexually abusing 14-year-old four decades ago

The retired headteacher of a Croydon school, honoured with an MBE by the Queen in 2012 for services to young people, today admitted to sexually abusing a 14-year-old boy over 40 years ago.

John Coatman of Leyburn Gardens, 76, was found guilty of gross indecency in August 2016 when volunteering at a Christian youth group called The Crusaders in the 1970s.

However, soon after his conviction it emerged that there had been an error in the level of the charges against him by the Crown Prosecution Service and the judge adjourned sentencing as it became obvious the case would go to the Court of Appeal. The Court eventually quashed his conviction in April this year and ordered a re-trial.

At his retrial at the Old Bailey on Monday, Coatman pleaded guilty to an amended charge of indecent assault.

Coatman was headteacher at St Andrew’s Church of England High School in Waddon. During his trial, he told the jury he worked with over 22,000 young people during a 50-year association with the Christian group for boys but “had never had any sort of complaint”. The jury rejected Coatman’s explanations and found him guilty of two counts of gross indecency but not guilty of buggery.

Claims against Coatman emerged in 2014 after the victim was suffering from problems at work and his marriage broke down.

At his trial, he denied the claims that “rough and tumble” had turned sexual, saying the only physical activity the young people engaged in was the children’s game British Bulldog.

Coatman told jurors he was “shocked” and “deeply shaken” after his arrest, saying the theme of sex cropped up in youth group meetings only in reference to religion.

http://www.eastlondonlines.co.uk/2017/12/retired-croydon-headteacher-admits-sexually-abusing-14-year-old-four-decades-ago/

Former Croydon headteacher John Coatman has buggery convictions annulled by High Court judges due to police and Crown Prosecution Service errors.

18 Apr 2017

A retired headmaster who had been found guilty of gross indecency with a 14-year-old boy has had his conviction nulled due to police and Crown Prosecution Service errors.

John Coatman, 76, a former headteacher at St Andrew’s Church of England High School in Waddon appealed to the High Court to overturn his conviction for historic sexual abuse at the Old Bailey in August.

Senior judges this month overturned the jury’s verdicts that Mr Coatman, who had also been honoured by the Queen for his services to young people, had sexual activity with the teenager in the 1970s.

Three judges at the Royal Courts of Justice quashed his outstanding convictions on April 6, ruling that Mr Coatman should not have faced the charges under section 1 of the Indecency With Children Act 1960 and section 13 of the Sexual Offences Act 1956.

The Right Honourable Lady Justice Hallett DBE stated: “Both (the police and Crown Prosecution Service) were wrong (to pursue these charges).

“The appellant could not be charged with offences under section 1 because of the age of the complainant at the time and could not be charged with offences under section 13 because they were time barred.”

Mr Coatman could not have committed an offence against a 14-year-old boy in 1973 under Section 1 of the 1960 Act because the law did not relate to alleged victims of that age until 2001, Lady Justice Hallett ruled.

Buggery charges levied against Mr Coatman under Section 13 of the 1956 Act – provided at the time under the heading ‘Indecency with Men’ – were ‘inapt’, the judge ruled, because the alleged conduct amounted to an assault towards a victim, rather than a sexual act with another man.

Lady Justice Hallett added: “Over the last few years this court has issued repeated warnings about the dangers of poor drafting of indictments in cases of alleged ‘historic sexual abuse’.”

A Crown Prosecution Service (CPS) spokesperson said: “We have contacted the complainant in this case to explain the issue and apologised.

“The CPS has issued advice to our specialist sexual offences prosecutors about the appropriate offences to charge in these particular circumstances, to reflect the changes in the law and recent Court of Appeal judgements.

“Cases currently before the courts have also been re-checked to ensure the error does not happen again.”

http://www.yourlocalguardian.co.uk/news/15230961.Former_headteacher_has_buggery_convictions_anulled/

The judges said the Crown Prosecution Service (CPS) was “responsible for this deeply regrettable state of affairs” and added a new case could potentially be brought against Mr Coatman alleging different charges.

Mr Coatman was made an MBE in 2012 for services to young people. During his trial he told the court he had worked with about 22,000 young people in his lifetime,

http://www.croydonadvertiser.co.uk/former-croydon-head-teacher-cleared-by/story-30254096-detail/story.html


Ex-head teacher John Coatman appeals conviction after being found guilty of gross indecency

A jury at the Old Bailey in August found John Coatman, 75, guilty of gross indecency with a boy in the early 1970s

Coatman, of Leyburn Gardens, was due to be sentenced at the Old Bailey today, but applied to the Court of Appeal to overturn his conviction. He did not appear in court himself.

The hearing was indefinitely adjourned by Judge Richard Hone, who previously warned Coatman, who taught for 42 years, to expect a jail term.
link

Update: August 26, 2016

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader found guilty of gross indecency with young boy

John Coatman, leader of Urban Saints Youth Group, Croydon was warned by Judge Richard Hone QC that he faced a jail term. He is due to be sentenced on September 30.

Sexual contact took place on about four or five occasions.

In emotional testimony in front of the jury, the man – who was 14 at the time at the time – broke down in tears as he described the alleged abuse taking place 

“… the effects of abuse on a young person can be quite traumatic…”

The survivor also said Coatman had asked whether any other boys he knew “might be interested”.

 link

link

 

377e2a9100000578-3753419-image-a-3_1471886185455
A retired headmaster, John Coatman, has been charged with having sex with a 14-year-old boy he met through a Christian youth group in the 1970s.

Jurors heard that at the time of the incidents, Coatman was not only the headteacher of a secondary school in south London (St Andrew’s Church of England High School), but was also involved in a Christian group for boys.  

The name of the Christian youth group is – Crusaders/now called  Urban Saints Youth Group organisation – Cliff Richard’s group

http://research.omicsgroup.org/index.php/Urban_Saints

http://www.dailymail.co.uk/news/article-3753419/Retired-headmaster-75-head-sex-14-year-old-boy-met-Christian-youth-group-1970s.html

Mr Coatman, who described himself as a bachelor told jurors that the topic of sex did crop up during youth group meetings, but only in reference to passages in the Bible involving “Christian aspects of sexual behaviour”, he added.

link

John Coatman MBE Supporters

From a lonely John Coatman testimonial website (comprised of a handful of supporters)

Testimonial by Victoria Swainson

“…I also did my bronze and silver Duke of Edinburgh awards outside of school, through a group organised and led by John (Coatman), and attended a residential Crusaders weekend on the Isle of Wight, again which he’d organised”

 Testimonial by Dr Amy Kendrick

 My name is Amy Kendrick and I was a pupil at St Andrew’s Church of England School in Croydon between 1992 and 1997.

http:///search?updated-min=2015-01-01T00:00:00-08:00&updated-max=2016-01-01T00:00:00-08:00&max-results=3

Dr Amy Kendrick – related to evangelical songwriter Graham Kendrick?

Graham Kendrick

Special commissions from such charities as Tear Fund, the Children’s Society, Church Army and Care for the Family, have resulted in songs of compassion and justice. They have been sung at major public occasions – including the Dunblane memorial service.

Festival of LightAmong these were Malcolm Muggeridge, Lord Longford, Bishop Trevor Huddleston and Cliff Richard. Among the performers were Cliff Richard, and Graham Kendrick.

link

link

Truthseeker1‏ @thewakeupcall09

Crusaders launch Network for Revival

General Eva Burrows, Rev David Coffey, Rt Rev Michael Hare-Duke, Rev Selwyn Hughes, Rev Dr Donald English, Gerald Williams, Rt Rev Dr James L Weatherhead, Jill Dando, Most Rev Desmond Tutu, Rt Rev Stanley Booth-Clibborn

Gyles Brandreth – part of Lord Longford’s porno junket – (which included Jimmy Savile and Cliff Richard)…

Amongst those who were included, and who stayed the course, were singer Cliff Richard and Radio One DJ Jimmy Savile, alongside more obvious suspects like Malcolm Muggeridge (he had spoken at VALA’s first convention, declaring that ‘if Till Death Us Do Part is life, I cannot see that there would be anything to do but commit suicide’) and the Rt. Revd Ronald Ralph Williams, the Bishop of Leicester,

 

 

Here is a list of people who signed off on Longford’s porn report in 1972

There were 47 signatories, with three notes of reservation from Kingsley Amis, Elizabeth Jane Howard and David Goodbourn (from Times, Sep. 20th, 1972):

Mr Kingsley Amis
Professor J. N. D. Anderson
Dr. G. R. Beasley-Murray
Miss Dorothy Berridge
Mrs Sara Binney
Lieutenant-Colonel Sir Ian Bowater
The Rt Rev Bishop B. C. Butler
Professor Francis Camps
Sir Frederick Catherwood
the Rev Thomas Corbishley SJ
Lord Justice Edmund Davies
Mr Peter Dawson
Mr Dennis Delderfield
Lord Douglass
Lord Dulverton
Dr. Stanley Ellison
Canon S. H. Evans
Lord Fletcher
Mr Frank Gillard
Mr David Goodbourn
Mr Peter Grosvenor
Professor Agnes Headlam-Morley
Mr David Holbrook
Miss Elizabeth Jane Howard
Mr Martin Hughes
Miss Angela Jones
Mr Herbert Kerrigan
Mr Peter Kettle
Mr Ronald H Kirkwood
The Bishop of Leicester, Dr Williams
Mr John Godfray Le Quesne, QC
The Rev Joseph McCulloch
Miss Carol McCullough
Lady Masham
Mrs Mary Miles
Mr Malcolm Muggeridge
Mr Jeremy Murray-Brown
Mr Cliff Richard
Mr Basil Rooke-Ley
Mr Jimmy Savile
Dr. Christine F. T. Saville
Dr. Peter D. Scott
Mr James Sharkey
Lord Shawcross
The Rev. Lord Soper
The Bishop of Stepney Dr. Huddleston
The Rev. K. M. Steven
Colonel S. J. Watson
Mrs Shiela Wiltshire
Mr Peregrine Worsthorne
The Archbishop of York Dr. Coggan
Mrs. P. S. Ziegler

link

 

logo2x

The Tear Fund charity was created out of the Evangelical Alliance (EA) and the Evangelical Refugee Fund created by the United Nations.

In January 1969 Cliff Richard did two fundraising concerts for Tearfund at London’s Royal Albert Hall. He has served as the charity’s Vice President and in 1999 served as its president

article-1053130-026e2fc900000578-126_468x311

Life-long bachelor Cliff Richard – his manager and live-in companion of more than 30 years, Bill Latham (right) was  hugely involved with charity work and was in “on the start of Tearfund”

In 1972  Latham was Deputy Director of Tearfund and had been instrumental in persuading Jean Le Maistre, a Christian politician on the island who was just launching Jersey Overseas Aid, to take a team for his first project to a hospital in Nazareth.

link

cliff tear fund

1978 English pop singer Cliff Richard in concert for the Christian charity, Tear Fund.

jamesogilvyroyalweddingpreweddingdinneriaqmd75ldgtl

Julia Ogilvy  (centre)– a Trustee of Tearfund with Princess Alexandra and James Ogilvy

Julia Ogilvy is a member of the extended British Royal Family. She is the wife of James Ogilvy, the only son of Sir Angus Ogilvy and Princess Alexandra, The Honourable Lady Ogilvy, a granddaughter of King George V and first cousin of Her Majesty the Queen.

link

Jimmy Savile admitted getting knighthood was ‘a relief because it got me off the hook’

His OBE folder contained a handwritten letter from Angus Ogilvy

link

More on the Ogilvys- The Ogilvys

Testimonial by Joshua Woodcock
 John Coatman was at first my leader, then as i grew older my co-leader as i joined the team leading the group and even after i left a dear friend mine. My very first contact with John was at St Andrews school where he was my sisters head master.
I went to Wallington crusaders with John for the best part of 15 years
From mass groups of us walking over box hill in the middle of the night every year to may trips away to Westbrook on the isle of white.

John Coatman reckons he’s been to about 300 Crusaders camps over the years

link

img_0071

westbrook_new_website

westbrook20front

Westbrook started life as a large Victorian residence surrounded by 25 acres of mixed parkland that was purchased by Crusaders Union in 1948

The original intention of the Committee at the time was to use a Memorial Fund of just over £500 to purchase a field as a permanent camp site for the ever developing Crusader holidays

link

 Crusaders Youth Group/Urban Saints

(Notable Crusader Peter Broadbent 

RT REVD PETER ALAN BROADBENTdirector at George Carey’s son Mark Carey’s school ST.JOHN’S COLLEGE NOTTINGHAM LIMITED

Peter Broadbent became a Christian at 14 through ‘Crusaders’, a Christian youth organisation. He trained for the ministry at St John’s College, Nottingham.

link

link

broadbent

Ordained in 1977, His first parish job was as Curate to George Carey, when he was Vicar of St Nicholas, Durham. He  was at St Nicholas’ Church til 1980 and he was an Islington Labor councillor 1982-1990.)

Lord Carey is a director of Christian Weekly Newspapers along with RT REVD PETER ALAN BROADBENT

link

Other notable Crusaders

link

Donald Wiseman worked for military intelligence.

In 1942 he became senior intelligence officer of the Mediterranean Allied Tactical Air Forces.

Wiseman joined a special intelligence group handling the Ultra signals, deciphered at Bletchley Park.

Wiseman worked with the Christian Crusaders

Wiseman also maintained a close connection with the Crusaders organisation. He was leader of the class at Finchley, which included Cliff Richard

Martin J. Selman, “Donald J. Wiseman,” in Walter A. Elwell and J. D. Weaver (eds.), Bible Interpreters of the 20th Century (Grand Rapids: Baker, 1999) p. 309

http://aanirfan.blogspot.com/2016/06/cliff-richard-crusaders-military.html


1979 Margaret Thatcher immediately carried out her promise to slash public spending, recommending that heating be drastically rationed in offices and schools.

This led to a remarkable revolt in Westerham in October 1979 when rebel children from Churchill School, led by senior pupils, burned their text books and walked out in protest against the cold. When headmaster John Coatman went into the playing field to remonstrate, many returned. Around 50 to 60 protesters stayed outside until a caretaker confirmed that the boilers were on.

link

 T H E O L D W H I T G I F T I A N A S S O C I A T I O N , C R O H A M M A N O R R O A D , S O U T H C R O Y D O N , S U R R E Y

John A Coatman attended Whitgift (1952-59) as did his brother Robert William Coatman, MBE, JP

coatman family whitgift
Robert William Coatman, MBE
3007948-large
Robert William Coatman, MBE – ONE of Croydon’s longest-serving councillors.He was first elected as a Conservative for Croydon Central ward in 1966 and went on to represent its successor ward, Fairfield, until his retirement.

Councillor Coatman was elected in 1966 to represent Croydon Central ward, following a family tradition after his great-uncle, GF Coatman, represented Croydon Central in the 1920s

Bob Coatman was educated at Whitgift School and worked for 41 years as a chartered surveyor.

He was best known on the council for his role in planning – serving on the planning committee from 1968 and spending 16 years as its chairman.

 He was Mayor of Croydon in 1977-78.

In 1993, Mr Coatman was made an MBE for his services to local government, and he received a lifelong service award from the council in 2006.

He also served as a magistrate at Croydon Magistrates’ Court for 21 years from 1976.

Outside of council business, Mr Coatman was founder president of both the Rotary Club of Croydon South and the Croydon Mayors’ Association.

He had also been a member of the Croydon South Probus Club and the Old Whitgiftian Association and a longstanding member of the court of the Whitgift Foundation.

His interests included classic cars, he was  a member of the A40 Farina Club and the history of Croydon, and he was a member of the Croydon Corps of Drums.

coatman john

2012 John Coatman. Leader, Urban Saints Youth Group, Croydon – MBE for services to Young People. (London, CR0)

standrews

Coatman was head teacher at St Andrew’s until he retired in 1997 and was awarded with an MBE by The Queen in 2012 for his services to young people.

Life-long youth worker given MBE

A FORMER head teacher who has spent his life working with Croydon’s youth has been recognised for his services to young people.

John Coatman, who taught at St Andrew’s School in Warrington Road, has been appointed an MBE.

Mr Coatman joined youth group the Croydon Crusaders, now known as Urban Saints, in 1949 aged eight and rose to represent the club on a national and international level.

 John Coatman

John is very active “for his years”, keeps fit and loves to travel the world – he’s always looking for travel companions who can keep up with him.

Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people leading expeditions to Austria, a project which has secured European Union funding, and on countless Duke of Edinburgh Award trips.


Imperial College LondonJohn Coatman, BSc Civil Engineering 1962

link

link


Ten English Days or TED – by John Coatman, on behalf of the leadership team:

Coatman TED Austria

The expedition is being run as part of the work of Croydon Crusaders. Crusaders is a registered charity and the expedition is a charitable activity supporting the work of a charity in Austria. Please ask for information about gift aid.
EU GRANTS
In 2001, 2002, 2003, 2004 and 2005 we had generous grants towards the project from the European Union and we may be applying again this year.
This will be my seventh year leading the TED expedition so I know a great deal about where we are going and what we will be doing. For the first 3 years the trip was part of the Crusoe (Crusaders Overseas Expeditions) programme organised by Crusaders. From 2003 the same expedition has been run under my own Croydon Crusaders Group. Apart from that, all is the same and it is a great success. The 2006 trip is open to any Christian young person aged 15 to 25 who wants to serve God on a working holiday. For legal reasons, by applying they become members of Croydon Crusaders. I promise a great deal of fun in one of the most beautiful parts of Europe in a building that you will find tobe very hospitable and lovely. You will live in luxury but I also promise that you will work hard!
We will be going to Schloss Klaus in Upper Austria.

https://web.archive.org/web/20160823154816/http://www.youthblog.org/tedaustria2006.pdf

Schloss Klaus

link


b2zkx5aciaafnbm

One of our loyal readers, John Coatman of The Croydon Crusaders, decided to pop in this morning and say hello!

The Pass is a magazine inspiring the UK’s Group Travel Organisers.


2011 Croydon Council consultant – John Coatman Crusaders

https://www.croydon.gov.uk/sites/default/files/articles/downloads/appendices1-3.pdf


coatman com ck

Nature of business (SIC) – 7020 Letting of own property

https://companycheck.co.uk/director/906652625/MR-JOHN-ANTHONY-COATMAN/companies


WALLINGTON CRUSADER HALL

Crusader Hall in Carshalton, England

Charitable Objects

“To Be Used For All Or Any Of The Purposes Of The Wallington Crusaders’ Bible Class For Public And Private Schoolboys And Young Men In Such Manner As The Leader Of Learders For The Time Being Thereof Shall Think Fit Within The Limits Of The Trusts Hereinafter Declared And Subject To Such Terms And Obligations As May Be Agreed Between The Trustees And The Wallington Crusaders’ Bible Class Aforesaid.”

Operations

Operation Location(s) Domestic
Surrey
Sutton

Trustees

Name

CHRISTIAN AND SPORTING ACTIVITIES MOSTLY FOR YOUNG PEOPLE WALLINGTON 253811

253811 MR BOB HEDDERLY, MR DERRICK CHARLES LEWIN 462944 MR NOEL GODFREY CARPENTER 467551 ROBERT VERNON HEDDERLY 468174 IVAN RATNAYAKE 3266458 JOHN COATMAN 3266459


 

cr1970chtimes08_21x_zps3eca9245

1970 Cliff had just returned from spending two weeks at a Christian Crusader camp. Cliff has entertained many young people on a boat that he moors on the Norfolk Broads

 …………………………………….

Cliff Richard led an armada of five motor cruisers along the Norfolk Broads…Last night with 27 boys from the Crusaders’ Union...in his six-berth Pomander ...

cliff2b-2bnorfolk2bbroads2b

cr1972dexp04_04x_zps256ad2f4

cr1966chtimes11_18x_zps31ab0c54

link

cliff2bbroads

WHAT IS AN URBAN SAINTS GROUP ANYWAY? There was a bumper crop of Urban Saints family members included in the 2012 New Year’s Honours list by Her Majesty The Queen.

This included MBEs for John Coatman (for his work with young people in Croydon, including the Wallington Urban Saints group), Dr Avice Hall & Stephen Hammersley (for their work in education, the community and their own local groups, in St Albans and Harpenden respectively). Former Crusaders Director, Dr Alan Kerbey, received an OBE for his work with young people in education and another former staff team member, Colin Henry, was recognised for with a MBE, for services to education in his role as Chair of Governors at Christ’s College in Guildford.

URBAN SAINTS is the operating name of The Crusaders’ Union, a company limited by guarantee and registered in England & Wales, company number 07771037, charity number 1144923

https://companycheck.co.uk/company/07771037/THE-CRUSADERS-UNION/companies-house-data

http://docslide.us/documents/engage-spring-2012-56f388fd581ab.html


l-r-president-of-crusaders-steve-chalke-sir-cliff-richard

2006
Crusaders, the youth missionary movement, hosted “An Evening with Sir Cliff Richard” recently in Central London to celebrate its centenary.

Alongside Steve Chalke, the President of Crusaders, Sir Cliff shared his personal life and faith, as well as performing a couple of songs from his repertoire.

Sir Cliff shared openly about his early days as a young performer, his big break, his very public conversion to Christ and the significant role played by Crusader leaders in his early Christian journey.

He spoke fondly of his time with Crusaders.

Sir Cliff is Patron of the Crusaders

http://www.christiantoday.com/article/sir.cliff.richard.shares.faith.at.crusaders.centenary/8014.htm

 


Paul O’Grady: “He’s really been through it this year, poor Cliff. He’s had a terrible time.”

Cliff Richard to O’Grady: “…you and I we’ve stood side by side through the storms together and all through the years you have been golden”

sir-cliff-richard-and-paul-ogrady

Cliff Richard’s drag queen friend and supporter, Paul O’Grady worked at care homes where Jimmy Savile abused and where Crusaders (members of the organisation that Cliff Richard is patron of)  were charged with abuse.

lily-savage-580x350_73610a

Paul O’Grady as drag queen, Lily Savage (Carlton Television) worked for Camden Council Social Services

Cilla Black used to go on holiday with Lily Savage aka Paul O’Grady, who worked as a social worker in Lambeth at the time of the paedophile gang and neglect of clients in that Borough. Diane Abbott was Lambeth Borough Council’s press officer/PR person.

http://www.drsallybaker.com/tag/diane-abbott/

 

1004410

O’Grady worked at The Children’s Convalescent Home and School on Meols Drive, West Kirby Meols Drive, West Kirby

link

paul-o-grady-the-devil-rides-out

From his autobiography:

o grady children's home

link

Last night TV funnyman Paul O’Grady told how Savile was banned from being alone on a girls’ ward at a care home where the Lily Savage star once worked.

Paul says: “When I worked in a children’s home in West Kirby in the 1970s, Jimmy Savile came to visit.

O’Grady, recalled the “creepy” DJ, Jimmy Savile visiting the Conny Home in West Kirby, Merseyside, which housed disabled and abused children in the 1970s.

He said: “Some of the house mothers were told not to let him on the girls’
unit unsupervised.”

Esther Rantzen and Paul O’Grady

31d765e700000578-0-image-m-101_1457094029831

link

link

paul o grady crusaders quote

o grady crusaders

link

West Kirby Residential School, West Kirby, Wirral

A group of 10 claimants has already issued legal proceedings relating to claims for severe physical and sexual abuse from the mid 1970s to the early 1990s at West Kirby Residential School in Meols Drive.

Three men (Graham Charles Webb, Henry Christie, Matthew Johnson) received jail sentences at Liverpool Crown Court for their part in the physical and sexual abuse at the residential school.

*Former head of care Graham Charles Webb, was jailed for seven years in July 1997 for abusing boys at the school and at camps he helped organise.

Webb, who also worked for a well known Christian youth movement, admitted abusing 20 children over a period of almost 20 years.

https://theukdatabase.com/2013/05/04/west-kirby-residential-school/

(West Kirby Residential School, West Kirby, Wirral

Matthew Johnson was also at Balliol School, Sedburgh, Cumbria.

The former house parent, of Kirby Stephen, Cumbria, committed the offences on five pupils at the residential school and three boy scouts who were in his care when he was a scout master.)

 

 


And another Crusader leader charged with abusing boys:

Crusader leader vicar Rev David Henry McIntosh:

 

Crusader Graham Webb charged along with

fellow Crusader leader vicar Rev David Henry McIntosh:

Alongside McIntosh in the dock was 41-year-old Graham Webb, who was care head at a West Kirby residential school, and Bournemouth man Robert Moses.

Some of the charges involve both McIntosh and Webb, who were leaders of activity holidays.

FORMER West Kirby residential school head Graham Webb and a vicar face indecency charges.

23 May 1997

Rev David Henry McIntosh, of Fenwick Lane, Runcorn, has been bailed with sureties of £2,000. A condition of bail is to make no contact with Webb. They will appear at Crown Court to plea on June 12, after being directed to the higher court by Wirral magistrates.

http://www.wirralglobe.co.uk/news/7439630.Head_and_vicar_face_sex_trial/?ref=arc

 26 Mar 1997

The Rev McIntosh had been staying at an address in Fenwick Lane, Halton Lodge, Runcorn, but has now been moved to a secret venue which was not revealed in open court.

Reporting restrictions have not been lifted.

link

A Church of England VICAR, the Rev David Henry McIntosh,

who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

The court was told that the “shower games” took place during Crusader holidays at a boarding school in Swindon, Wiltshire, in 1988,1994 and 1995 and at a weekend gathering of boys for a reunion at a church commissioner’s house in Llandudno in 1994.

His position was made more serious by the fact he had helped draw up documents advising leaders about appropriate behaviour with the boys.

The Church of England vicar, who resigned from his post at Barnton, near Northwich, after his arrest last December, used to work as part of a ministry team in Ellesmere Port

He studied maths and physics at Durham University.

He is charged with 19 indecent assault allegations at West Kirby, Swindon, Minehead, Malvern and Cheltenham, four matters of gross indecency at West Kirby and two other offences brought under the Sexual Offences Act.

He had been involved with the Crusaders for longer than his involvement in the church, attending more than 40 holidays during that period of time.

link

link

 December 1997

 PERVERT VICAR JAILED

 A VICAR who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

McIntosh, who was camp chaplain at the holidays at Pinewood boarding school, Swindon, from 1988 to 1991, became overall holiday leader there in 1993.

The two boys whom McIntosh abused in Llandudno were both from an Ellesmere Port school where he was vicar.

https://theukdatabase.com/2012/04/23/david-mcintosh-swindonruncornwarrington/

link

link


 Another Crusader charged with abusing boys at a care home:

image-24m

Mr Gilbart-Smith… who had led the Crusaders children’s group for fifty years was accused of abuse

All the allegations were said to have involved Mr Gilbart-Smith and others at Greenfield House children’s hostel in Maidenhead, Berkshire.

During that time the court heard residents were subjected to sustained, systemic abuse at the hands of the home’s managers and numerous visitors.

The youngsters were repeatedly raped and even ‘loaned out’ to other paedophiles elsewhere.

Mr Gilbart-Smith, a successful businessman, was accused of being one of those who took part in the sex attacks.

http://www.dailymail.co.uk/news/article-1292277/Paedophile-suspect-doused-petrol-victim-court-dock-drama-acquittal.html

Nine men “horrendously abused” by a paedophile ring in a children’s home 40 years ago have received an out-of-court settlement totalling more than £300,000

The civil settlement came despite the fact that no-one has ever been convicted of criminal offences regarding the abuse at the council-run Green Field House in Maidenhead, Berkshire, between 1964 and 1970

The home was then managed by ex-soldier Don Prescott, who died about 19 years ago.

He used to abuse the boys and rent them out to other paedophiles as far afield as Leicester, London, Cambridge and Reading

https://theukdatabase.com/2012/04/21/green-field-house-childrens-home-maidenhead/

“Unfortunately for the boys staying at Green Field House, it was the centre of a paedophile ring numbering so many men some of the boys lost count of those who abused them.

“They suffered the most horrendous abuse – it was the worst type of sexual abuse. They were filmed, photographed and had to take part in the abuse.

“… it went on for six years.”

http://news.bbc.co.uk/2/hi/uk_news/england/berkshire/6195572.stm

Nine men all with children and grandchildren claimed to have been raped by Gilbart-Smith the Lloyds investor during their stay at Green Field House children’s home Maidenhead (Theresa May’s constituency).

Gilbart-Smith, offered no defence other than a denial and a moral smoke screen, as he claimed to be a “Christian” who was a church leader at Foxes Piece School, Newfield Road, Marlow. Gilbart-Smith also told the court that he was a Bible teaching missionary and friends with a David Pawson.

http://www.thepaedotrial.com/crown-court-paedo-defence/

link

Oliver Denham Gilbart-Smith

Theresa May’s reply about Oliver Denham Gilbart-Smith & Green Field House child abuse scandal

https://companycheck.co.uk/director/903650898/MR-OLIVER-DENHAM-GILBART-SMITH/companies

Image result for Oliver Denham Gilbart-Smith

NOTE: Theresa May doesn’t respond to the question that was asked about the secret RBWM paedophile deal, but rather in typical politician fashion, she evades the question with statements like;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

Theresa May was specifically asked whether the secret £300,000 RBWM payment was moral, legal or in the public interest? For whatever reason the now Prime Minister has refused to look into this matter.

Myself and numerous other victims and or their MPs including; Norman Baker MP, Mike Thornton MP, Nick de Bois, MP, John Redwood MP, Mims Davies MP have all written to Theresa May as MP then Home Secretary and now Prime Minister asking the same question and Theresa May has consistently refused to answer this very simple question.

The Prime Minister & The Nobbler

In 1970 the council in Theresa Mays Maidenhead constituency, brushed the horrific Green Field House child abuse scandal under the carpet, hoping  it would never again see the light of day.

The child abuse surfaced again some thirty years later in 2000. Maidenhead police investigated but there was insufficient evidence to proceed with a criminal case, so a civil case was pursued by two complainants.

For the following five years *RBWM, denied the abuse ever took place. However, on the 29th November 2006 RBWM were forced to accept responsibility, and they agreed to settle a £300,000 compensation claim with nine rape victims, plus the considerable legal costs incurred from a five year investigation by solicitors Dyer Burdett.

*When we reference RBWM we are referring to the Royal Borough of Windsor & Maidenhead or Berkshire County Council (BBC) whose responsibilities RBWM inherited and or their insurers.

 

http://news.bbc.co.uk/1/hi/england/berkshire/6195572.stm

RBWM by settling the claims and paying £300,000 in compensation, agreed with the claimants and the Dyer-Burdett legal team that the unnamed man mentioned in the BBC website article, was a paedophile and had raped and abused 4 of the 9 claimants.

To recover their loss, RWBM immediately sued the unnamed man, who promptly paid RBWM £300,000 to cover their loss.

On top of the £300,000 the unnamed man also paid RBWM’s legal bill, including the costs relating to Dyer Burdett’s five year investigation. However, before committing to settle this payment, the unnamed man insisted on the following caveats:

  • RBWM would keep his name secret.
  • RBWM would keep the amount of cash he paid them a secret.
  • RBWM would exclude him from any future claims if they paid compensation to any more of his rape victims. 

With total disregard for the spirit of the law and public funds, RBWM amazingly agreed to the caveats and struck a deal with the now self confessed paedophile. This secret paedophile deal included a substantial payment to exclude the unnamed man from any future claims, if RBWM compensated any more of his rape victims.

THE BELOW STATEMENT IS A FACT!

The amount the unnamed man paid was over £1,000,000!

TO PAY HIS PAEDO-BILL THE UNNAMED MAN TOOK THE FOLLOWING ACTION!

April 12th 2007, the unnamed man sold his family home of twenty five years, Winterberry Jobs Lane, Cookham, SL6 9TX, for £1,475,000,00.

 

Winterberry Jobs Lane Cookham

Around the same time the unnamed man sold Ballyhaise Quarry Road, Marlow, SL7 1RE for £1,251,423,00. Ballyhaise had been a family home for about 35 years.

MORE INVESTMENTS WERE CASHED IN INCLUDING CAPE MARCO HOTELS.

 

By 2010 RBWM had settled 21 individual compensation claims for abuse that had taken place at the Green Field House children’s home. RBWM settled more than 10 compensation claims for rape by the unnamed man. None of the later claimants were made aware that their compensation claim was being paid with money RBWM had received from the rapist in a secret deal. 

After three years of writing to Theresa May concerning the corrupt RBWM paedophile hush payment with ZERO response, the below letter & the book Rich Man Poor Man was sent to 100’s of MP’s.

 

Out of the 300 MPs the letter and book was sent to, one Scottish MP Brian Donohoe responded with a phone call.  Mr Donohoe suggested that I approach Theresa May through my local MP which at that time was Mike Thornton, I acted on Mr Donohoe’s simple advice.

In the below email to Mike Thornton MP, RBWM break their secret agreement and name (Denham) Gilbart-Smith as the unnamed man that paid the RBWM rape bill. 

 

2010 17th May

After a 2 year police investigation, Gilbart-Smith stood trial for 17 charges of raping and abusing 8 kids as young as nine. The secret RBWM deal was not allowed to be mentioned during the trial.

WATCH THE TRIAL VIDEO 

  •  Gilbart-Smith agreed with the prosecution that all of his friends that went to the children’s home were paedophiles.
  • Gilbart-Smith agreed to being an unpaid helper at the kids home and going on holidays with the children and the paedophiles.
  • Gilbart-Smith agreed to being at the numerous places where the children were raped sold and abused by paedophiles.
  • Gilbart-Smith’s only defence during the six week trial was, he didn’t know that his friends were paedophiles, he had no idea that the boys were being raped by his friends, and he personally did not rape or abuse any of the boys.
  • Nine men who for the best part hadn’t seen each other for 40 years all claimed to have been raped or abused by Gilbart-Smith.
    (One of the 9 made a complaint too late for charges to be made)
  • The purpose of a jury is to return a verdict based on the evidence presented to the court, this jury returned a verdict in total contradiction to the overwhelming and robust evidence. All the jury had to decide in what for all intense and purposes was a ‘cut and dried’ case was: “Who is telling the truth, the nine men who hadn’t seen each other for 40 years or Gilbart-Smith?”

Watch the video and cringe at Gilbart-Smith’s pathetic lies, a jury of ten year old kids would have seen through Gilbart-Smith’s nonsense and found him guilty. In The Nobbler it is very clearly outlined how Gilbart-Smith, with no defence WHATSOEVER would once again outsmart the system with his wealth. If Gilbart-Smith had access to one million or fifty million pounds, all of it would be worthless to him in jail. No more Michelin Star restaurants for Greasy-Gilbart just porridge.

With the prospect of disgracing the family name and spending the rest of his life on the monster wing with child murderers, paedophiles, rapists and every other vile creature under the sun. True to his modus operandi, Gilbart-Smith paid out a large sum of *cash to nobble the jury.

*This would be very easy to establish as fact, seven years on a simple financial investigation on the jury members starting with the foreman would prove very interesting.

In 2010 Gilbart-Smith ran *IMS an insurance company that insured policy holders against kidnapping, international terrorism and such like. So Gilbart-Smith was no stranger to spooks and double dealing in the murky world of international intelligence, espionage, and subterfuge. Gilbart-Smith would communicate with spy academy type characters on a daily basis in his work environment.

*Gilbart-Smith is no longer connected with IMS.

http://www.bbc.co.uk/news/10513751

The author of The Nobbler John Affleck was sent to prison for 12 months for contempt of the court for protesting against the corrupt verdict. Gilbart-Smith left court a free man with the tax payer paying his massive legal bill. Had the jury found Gilbart-Smith guilty, he would have had to pay his own legal fees, so if the content of The Nobbler book is truthful, Gilbart-Smith in effect paid for his jury nobbling activities with tax payers money.

Instead of suing John for slander and false accusations including tampering with the jury and the murder of three blackmailers, immediately after the trial at the age of 64 The Nobbler swiftly cashed in his assets and left the UK, leaving behind his children and grandchildren, he became a citizen of Northern Cyprus, a Muslim country that has no extradition treaty with the UK.

…………………………………

After John was released from prison Maidenhead MP Theresa May refused to answer any of Johns correspondence for the following three years concerning this matter. However, Mrs May did write to another of Gilbart-Smiths rape victims who lives in her constituency.

 

NOTE: Theresa May doesn’t respond to the question that was asked about the secret RBWM paedophile deal, but rather in typical politician fashion, she evades the question with statements like;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

Theresa May was specifically asked whether the secret £300,000 RBWM payment was moral, legal or in the public interest? For whatever reason the now Prime Minister has refused to look into this matter.

Myself and numerous other victims and or their MPs including; Norman Baker MP, Mike Thornton MP, Nick de Bois, MP, John Redwood MP, Mims Davies MP have all written to Theresa May as MP then Home Secretary and now Prime Minister asking the same question and Theresa May has consistently refused to answer this very simple question.

ALL MP LETTERS  ARE IN THE JOURNALIST PACK

Prime Minister, instead of giving up salt & vinegar crisps for lent 2017, do you think it might be more appropriate for a person in your position to GIVE UP not answering a straight forward  simple question concerning the £300,000 rapist payment to the authority in your constituency?

 

On the 8th September John received a reply from Sarah Newton the minister for vulnerability at the Home Office. Incredibly Ms Newton advised John to complain to RBWM about the million pound plus payment that RBWM had received from  Denham Gilbart-Smith after RBWM accused Gilbart-Smith of raping around ten children in their care.

QUESTION FOR SARAH NEWTON THE MINISTER FOR VULNERABILITY

Dear Mrs Newton, Should I also complain to Mr Gilbart-Smith for raping me when I was a ten year old kid?

You really couldn’t make this stuff up, it’s taken five years to get that advice from the Home Office. 

http://thenobbler.com/


coatman mbe

Is John Coatman MBE  linked with these other Crusader leaders who have been charged with csa?

Is he part of a ring?

John Coatman reckons he’s been to about 300 Crusaders camps over the years”

link

“Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people”

link

Coatman …”rose to represent the club on a national and international level.”

link

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

“John (Coatman) was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member…”

policy statement urban saints

Coatman on the South East Regional Steering Group of the Urban Saints (formerly known as the Crusaders)

coatman steering group

The South East Regional Steering Group

The South East Regional Steering Group consists of  …

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

John was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member of the Croydon group.

link

John Coatman organised and took part in many residential Crusaders weekend on the Isle of Wight



crusader postcard

link

This Video May Prove Cliff Richard Is A Child Abuser

 “Richard faced accusations from four men, relating to the period between 1958 and 1983, but was never arrested or charged. The case was dropped by the Crown Prosecution Service in June, after it decided there was insufficient evidence to bring an action.”

I believe in the Devil, I spend more time with him than I do with God,” Would a devout Christian admit to that? I don’t think so.

link

proxy

Why does Kitty always refer to just one accuser (he) when he knows there were several?

link

it was 9 accusers…9!!! The file to CPS wasn’t blank! Good wholesome Christian who hangs about with shady characters


Misc info on Cliff Richard’s friend Paul O’Grady who worked at West Kirby Residential School

dsc_0390

Predator Savile’s attack on victim at High Royds Psychiatric Hospital in Menston

High Royds Hospital is a former psychiatric hospital south of the village of Menston, West Yorkshire, England. The hospital, which opened in 1888, closed in 2003 and the site has since been developed for residential use.

The hospital is located within in the City of Leeds metropolitan borough and was first opened on 8 October 1888 as the West Riding Pauper Lunatic Asylum.

It is near Ilkley.

In 1988, Jimmy Savile assaulted a patient at the hospital’s 100 anniversary celebrations.[1]

It was in 1988 that Savile was a guest at a garden party to celebrate High Royds’ 100th anniversary, said local historian Mark Davis.

He was a frequent visitor” said Mr Davis, a trustee of the Friends of High Royds Memorial Garden

http://www.ilkleygazette.co.uk/news/news_local/10168697.Predator_Savile___s_attack_on_victim_at_High_Royds/#
link

At Savile’s auction – a mug etched with ‘High Royds Hospital 1888-1988’ and ‘Presented to Jimmy Savile O.B.E. With our grateful thanks 9th July 1988.

Two victims were at High Royds Hospital, aged five and 45.

 

https://www.telegraph.co.uk/news/uknews/crime/jimmy-savile/10059496/Jimmy-Savile-further-details-of-hospital-abuse-revealed.html

 


I worked there (High Royd) from Oct 1984 to April 1987

Paul O’Grady used to work on one of the wards when I was there. He was a staff nurse and was training to be a comedian at the time.

http://www.highroydshospital.com/galleries/1902-2/

Menston

royds-hospital-to-st-marys-menston

High Royds Hospital to St Mary’s Menston School .6 mile


Menston

St Mary’s Menston Catholic Voluntary Academy

Perverts WILL be allowed to stay in the classroom

  • Teachers already cleared to return to work will not have cases reviewed

Image result for Geoffrey Bettley

Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Child porn: Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Bettley was working at St Mary’s Catholic High School in Menston, West Yorkshire, when he was arrested for downloading nearly 200 images.

He was cautioned and placed on a ‘barred list’ by the Independent Safeguarding Authority, although his name was taken off last June.

His case was heard by the National College for Teaching and Leadership professional conduct panel, which concluded that he was not a risk to children and the DfE backed the decision.

Peter Saunders, of the National Association for People Abused in Childhood, said he had ‘zero’ confidence in the Government’s ability to tackle child-related offences.

Everyone is aghast at the failure to grasp the common sense that everything must be done to ensure that these people can never go near classrooms again,’ he said.

Bettley, who joined St Mary’s in September 2001 from Yorkshire Martyrs Catholic School, in Bradford, West Yorks, was suspended from his job on December 9, 2010, and dismissed a year later.

In October 2011 the Independent Safeguarding Authority banned him from working with children, but removed the restriction on 21 June 2012


Mr Bettley, does not, in the view of the Panel, represent a risk to children and young people.

NAME OF DECISION MAKER: Alan Meyrick
DATE: 17 May 2013

Geoffrey Bettley

Former Employer:
St Mary’s, Menston, variously known as St Mary’s Catholic High School and
St Mary’s Catholic Comprehensive School
______________________________________________

link

National College for Teaching and Leadership (NCTL)

NCTL deputy director Alan Meyrick


LazerLight ‏@lazer_Light23

Alan Meyrick was Assistant Private Sec to Peter Brooke in NI. Hmmm


Image result for peter brooke kincora

Alan Meyrick Assistant PS 1989-91

uk.linkedin.com/in/alan-meyrick-a85aa86


Kincora: ‘Highest profile people connected to abuse’ claim

 Peter Brooke stonewalled.

The Kincora Boys’ Home in east Belfast was at the centre of a child abuse scandal in the 1980s

link

Kincora controversy

In February 1990, Brooke told Kevin McNamara, Labour’s then Northern Ireland spokesman, that the Kincora affair had been investigated ‘as fully and thoroughly as lies within the power of the Government to investigate it, and that no purpose would now be served by a further inquiry’

In October 1990, Brooke conceded for the first time, that the reports about the Kincora home came to the attention of the police.

link


Peter Brooke was sworn of the Privy Council in 1988. He was made Chairman of the Conservative Party in 1987, and then Secretary of State for Northern Ireland in 1989.

During his time as Heritage Secretary, he oversaw the restoration of Windsor Castle following the fire that had struck the state apartments in 1992.

via ww

Image result for peter bottomley i will sue

Peter Brooke’s PPS was a chap called Bottomley.

His PPS for a time was Peter Bottomley (1990). In September 1984, Peter was Parliamentary Under-Secretary of State at the Northern Ireland Office.

I’ll sue if anyone links me to untrue paedophile claims, says Tory grandee Sir Peter Bottomley

  • Worthing West MP issues public denial of any involvement in child abuse 
  • Denied there had been a major Establishment conspiracy to cover up abuse

Curious that after studying economics at Trinity College Peter Bottomley became a truck driver.

a very unlucky MP, Peter Bottomley at 2 disasters..

No it’s 3 ….Kings Cross, Heysel Stadium and Kegworth

No, it’s 4: EGH

 so ice cream van & truck driver Bottomley present at 4 areas of interest – & thrives


Alan Meyrick

Deputy Director Teacher Regulation at the Department for Education

Shrewsbury, United Kingdom
Education Management
Current
  1. Department for Education
Previous
  1. General Teaching Council for England,
  2. General Medical Council,
  3. Home Office – Metropolitan Police Committee
Education
  1. University of Cambridge

Experience

  • Deputy Director Teacher Regulation

    Department for Education
    April 2012 – Present (4 years 7 months)
  • Chief Executive

    General Teaching Council for England
    March 2011 – March 2012 (1 year 1 month)
  • Registrar

    General Teaching Council for England
    2000 – 2011 (11 years)
  • Head of Registration Policy

    General Medical Council
    April 1999 – March 2000 (1 year)
  • Deputy Secretary

    Home Office – Metropolitan Police Committee
    January 1996 – March 1999 (3 years 3 months)
  • Personnel Management and Programme Manager

    Home Office
    February 1991 – January 1996 (5 years)
  • Assistant Private Secretary to Secretary of State

    Northern Ireland Office
    January 1989 – February 1991 (2 years 2 months)
  • Internal Management Consultant

    Home Office
    September 1987 – January 1989 (1 year 5 months)
  • Project Officer

    Home Office Prison Department
    September 1985 – September 1987 (2 years 1 month)

    HM Prison

    Education

    • University of Cambridge

      BA Hons, Theology and Religious Studies
      1982 – 1985
    • King Edward VI School

      A’ Levels, English, Religious Studies; French
      1976 – 1981

    Service


St. Mary’s Menston
Bradford Road
Menston
West Yorkshire
United Kingdom
LS29 6AE

Jimmy Savile:  Two separate attacks in High Royds Hospital at Menston, near Ilkley, which treated psychiatric patients, in the 1970s and 1980s.



09c92615-b2b3-060a-b8836710146cc270

Paul O’Grady appointed MBE by Prince Charles – The star said: “I’m delighted. Now I’m part of the Establishment.”

Prince Charles – friend of  “creepy” Jimmy Savile:

prince-charles-jimmy-savile


 

Paul O’Grady:

Even now, 40 years on, the TV host and comedian shivers as he relives the night he saved the 18-month-old youngster’s life while working for social services. (Camden Council Social Services)

He tells how he fled the flat where he was keeping watch on the baby after a terrifying confrontation with the little lad’s drunken father – and how the drama ended with him making a desperate phone call to the Salvation Army for help.

Paul O’Grady reveals the terrifying moment in 1976 … he feared for his own survival

 Paul O'Grady: The Sally Army and Me

Paul O’Grady, while employed by Camden Council Social Services 

 took a toddler to a pub where Adam Ant was playing

Reliving his unforgettable ordeal in 1976, Paul says: “It was a dangerous situation for the kid, and for me.

“There were a few times when my life and that of The Sally Army crossed paths, but that night is one of the most memorable.”

After heading to London in the 70s, a few years before conjuring up Lily Savage , Liverpudlian Paul, then 21, worked for Camden Council Social Services providing respite care for families at home.

He says: “I remember the mother of this child had to go to hospital for an operation so I was there to look after him. He was only 18 months.

“It must have been about 2am when there was a banging at the door. I answered it …‘What are you doing carrying on with my wife?” he said.

“I tried to explain I was a care worker, but he just told me, ‘I want my kid.’

“‘You’re not getting your kid, mate,’ I said. ‘I’m sorry, you’ve got to get through me first.’

So I took the child in the middle of the night…I hurried into this club next to Camden Town tube. I remember Adam And The Ants* were playing a gig there that night.”

“I asked the manager if I could use his phone to call my duty worker. But I couldn’t get through to him for some reason. So I called The Sally Army instead and said, ‘can you bloody help me?’

“And they came. And they didn’t ask lots of questions. They wrapped the kid in a blanket. We had a place of safety in Kentish Town and they took him there.

http://www.mirror.co.uk/tv/tv-news/paul-ogrady-reveals-terrifying-moment-7635112


Adam Ant’s father, Alfred Leslie Goddard (left), was jailed for preying on runaway boys nearly 30 years ago.

 Leslie Alfred Goddard  worked as a chauffeur.

 

*Stuart Leslie Goddard/Adam Ant’s father- Leslie Alfred Goddard- was jailed in 1987 with Sidney Cooke as part of the Dirty Dozen gang.

http://aanirfan.blogspot.com/2015/08/goddard-cooke-adam-ant-and-security.html

Boys had been hawked around “safe houses” and passed on to other members of the gang which included council porter Alfred Goddard, father of 1980s pop star Adam Ant.

The former council porter was a member of a gang that included Britain’s most notorious paedophile, Sidney Cooke, who was later convicted of the sadistic gang rape and killing of a teenage boy and is suspected of murdering many more.

It has emerged that detectives investigating shock allegations of three murders and systemic child sex abuse by senior Establishment figures are looking into Goddard’s possible involvement.

Image result for westminster

The suggestion is that the child sex ring, dubbed the Dirty Dozen and known to have targeted vulnerable youngsters, could have passed on their victims for the MPs to abuse.

Image result for dolphin Square, Pimlico

At the time, Goddard lived in Eccleston Square, Pimlico, close to the exclusive apartments of Dolphin Square where the VIP child abuse ring is said to have been based.

29th Jan 1999 Sidney Cooke appears before Newbury Magistrates Court, charged with 14 serious sexual offences. which were said to have taken place in Battersea and Stockwell in south London; Twyford, Berks; Canterbury, Kent; Washington, Tyne and Wear and Hatfield, Berkhamsted and Tring in Herts.

link

adam-ant-margaret

Adam Ant’s mother was an embroiderer or the Queen’s dressmaker Norman Hartnell. and worked at Paul McCartney’s house as a cleaner.

Like Sidney Cooke, Leslie Alfred Goddard was also a chauffeur to rich families.
link

Alfred Leslie Goddard had served in the Royal Air Force.

https://en.wikipedia.org/wiki/Adam_Ant

Image result for martin allen missingImage result for martin allen missing

Anthony John Wixted‏ @TrojanManifesto

It looks like a young Harvey Proctor if you ask me…


Cliff Richard’s friend Paul O’Grady is a patron of  the Peter Tatchell Foundation

tatchell1

peter-tatchell-patrons

http://www.petertatchellfoundation.org/node/573

Is this the current CHE membership leaflet with photo of Nettie Pollard & Peter Tatchell from 2011?

“Pollard gave a constant stream of support to paedophiles and promoted their views.”

Photo below: Nettie Pollard (EC Member) with Peter Tatchell at the 2011 Annual Conference:

Nettie Pollard was member number 70 of the Paedophile Information Exchange.

link

tatchell-and-nettie-pollard

 

nettie-pollard

Pensioner backed Paedophile Information Exchange and may hold key to links with left wing groups

Nettie Pollard was a key figure in the London left – a Sunday People investigation reveals her to be a chief apologist for some of PIE’s most chilling demands

Even those who have lived beside her for years have little idea about her life – none of her neighbours has ever been invited inside the home she has lived in alone for almost 30 years.

But 69-year-old Nettie Pollard may hold the key to how the Paedophile Information Exchange infiltrated left wing groups in the 1970s.

She was a key figure in the London left, working for the National Council for Civil Liberties for two decades.

But a Sunday People investigation reveals Pollard to be chief apologist for some of PIE’s most chilling demands.

Our investigation found that throughout her career Pollard gave a constant stream of support to paedophiles and promoted their views. She also:

  • Supported PIE’s call to scrap the age of consent.
  • Argued against the introduction of a bill to protect children.
  • Sat on committees with known ­paedophiles and PIE members.
  • Wrote a twisted essay defending sex between adults and children.

It emerged MP Harriet Harman, ­husband Jack Dromey and former Health Secretary Patricia Hewitt had been involved with the NCCL when PIE was affiliated to it.

Mrs Harman has subsequently moved to distance herself from Pollard and paedophiles, with a spokesman stating they “did not influence any of the work she did there”.

Image result for harriet harman pie

However one source involved with the London left in the 70s claims – ­embarrassingly for Mrs Harman – that she and Pollard did work together on occasions within the NCCL .

The source said: “Nettie was a big presence in the movement back in the 1970s and couldn’t be ignored by anyone wanting to get on in the NCCL.”

Our investigation first places Pollard in 1975 working as the Gay and Lesbian Officer for the NCCL.

And that brought her into close ­contact with the infamous PIE – the child sex group which campaigned to have the age of consent lowered or scrapped.

As well as her role at the NCCL, Pollard was and remains a significant member of the Campaign for Homosexual Equality – a group that defended PIE’s rights at their 1983 conference.

But even after PIE was disbanded in 1984, Pollard made no secret of her ­sympathy for the organisation’s aims.

In 1993 she contributed a ­defence of the ­sexualisation of youngsters to a book called Bad Girls and Dirty Pictures.

Entitled The Small Matter of Children, Pollard’s essay draws on work by known paedophiles such as former PIE vice-chair Warren Middleton to build its case.

Pollard argues child sex should be legal if the act is “consensual”.

It also uses language like “willing partners” to describe sex between adults and children.

But by far the most disturbing section is Pollard’s attempt to justify the sexualisation of children.

She writes: “Far from being ‘innocent’ and becoming sexual at puberty, as was once the common belief, it is now indisputable that everyone is sexual, even before birth.”

The research cited was also used in PIE’s bid to reduce the age of consent to just four.

Pollard continued to work for the NCCL until her mysterious ­departure from the group in 1997.

She was made redundant but reports from Feminists Against Censorship implies murkier reasons ­behind her exit.

A ­newsletter from the time reads: “Within the last several months, two of NCCL’s employees have remarked that the organisation’s longest-serving staff member, Nettie Pollard, was the last civil libertarian left on the payroll.”

Challenging the cost-cutting explanation given it added: “Since she is one of the few indispensable staff members, and the most ­expensive to make redundant, we suspect economy is not the reason.”

Pollard, whose Facebook page currently shows her support for causes including an anti-drones campaign and attacks on the “Big Brother” state, also showcases her taste in music with a link to indie rock band The Donutsh – described by one of their following as sounding “like Johnny Cash biting off Johnny Rotten’s head”.

She refused to answer the door to us when we visited her home.

 Image result for harriet harman and nettie pollard
Harriet Harman and Peter Tatchell

 

link

Peter Tatchell was a leading member of the Gay Liberation Front (GLF) but never knew or met any GLF members that where paedophiles like John David Stamford ?


Harriet Harman, PIE , etc …..

Is Peter Tatchell A Paedophile Or Simply Misunderstood?

Peter Tatchell was born in Melbourne Australia on 25th January 1952, he moved to London in 1971 to avoid conscription. In 1978 Tatchell joined the Labour Party and moved to Bermondsey, South East London. Tatchell ran as the Bermondsey Labour Party candidate in the 1983 General Election. Despite Bermondsey being a Labour stronghold he lost to Liberal candidate Simon Hughes. In February 2000 he left the Labour Party for unknown reasons. In 2004 he joined the Green Party and was chosen to be their candidate for Oxford East in the 2010 General Election, however for some reason he withdrew his candidacy in 2009.
Comrade Tatchell
Peter Tatchell (the UK’s most prominent homosexual activist and a favourite of the BBC) has done more than demand the abolition of the age of consent, he has broken the law on the age of consent in Britain at least once.

Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophilie apologist.
Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophile apologist. They have also refused to state how much they have paid him for appearances.

As a gay 18-year-old Australian anti-Vietnam war draft-dodger, he came to the UK in 1971 and lived with a 16-year-old boy in London. The homosexual age of consent in England at the time was 21. Later he campaigned for lowering it to 16, and now he wants it lowered again to 14. What will he want after that?

When the age of consent for homosexuals was lowered to 16 an Outrage (Tatchell’s organization) banner said “16 is just a start” – it didn’t state what the end goal was.

Mr Tatchell criticises the age of consent laws. Here is a quotation from his own website:

“Nevertheless, like any minimum age, it is arbitrary and fails to acknowledge that different people mature sexually at different ages. A few are ready for sex at 12; others not until they’re 20. Having a single, inflexible age of consent doesn’t take into account these differences. It dogmatically imposes a limit, regardless of individual circumstances“.

Peter Tatchell wrote the chapter “Questioning Ages of Majority and Ages of Consent” for a book openly advocating paedophilia and finding ways “to make paedophilia acceptable“.

This book, published in 1986 and called The Betrayal of Youth (B.O.Y.), was edited by Warren Middleton, then vice-chairperson of the Paedophile Information Exchange, Britain’s number one paedophile advocacy group.

Stephen Green, anti-paedophile campaigner wrote: “The book was part of a campaign to abolish all ages of consent, destroy the responsibilities of parents for their children, deny any ill-effects on children of interference by paedophiles, and withal to make it easier for paedophiles to gain sexual access to children.“

In The Betrayal of Youth Tatchell wrote that the age of sexual consent is “Reinforcing a set of increasingly quaint, minority moral values left over from the Victorian era“.

Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.
Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.

He was not on his own in this belief.Many of his fellow socio-communists and homosexual activists thought the same:

Campaign for Homosexual Equality chairman Michael Jarrett was identifying paedophiles as an oppressed group, and the CHE list of “demands” included the complete abolition of minimum ages for sexual activity. The Labour Gay Rights Manifesto of 1985 said ‘A socialist society would supersede the family household. … Gay people and children should have the right to live together. … It follows from what we have already said that we favour the abolition of the age of consent.’

27092011583[1]


Feminists like Beatrice Faust contributed to The Betrayal of Youth, as well as other homosexual activists besides Tatchell, including Jeffrey Weeks and Eric Presland, who “related his first paedophile experience with an Asian boy of thirteen, and boasted of interfering with a little boy of six“.

The book is considered so toxic that Amazon doesn’t sell it and you cannot search its content in Google Books.

Tatchell is well aware of how much all this is bad publicity for him and keeps rationalizing and adjusting his positions, but only the ideologically blind or pathologically naive cannot see through his self-excuses.

He has prepared a standard self-defence which can be found on his own website and has been repeated verbatim on many outlets. It used to also be on the site of his friend militant atheist, Richard Dawkins, but it’s not there any more. Maybe even Dawkins draws a line at what is morally allowed, even though his motto is “There’s probably no God – now stop worrying and enjoy your life”.

In this article that supposedly should serve to exculpate him, Tatchell has nothing better than this: “The critics also cite Warren Middleton’s 1980s book, Betrayal of Youth, to which I contributed a chapter. I had no idea that he was involved in child sex abuse matters when I was asked to write.”

Considering that Warren Middleton was co-founder and vice-chairperson of the Paedophile Information Exchange (PIE), a prominent group promoting paedophilia, it was impossible for Tatchell not to have known his propensities. In addition, both Tatchell and Middleton were part of the Gay Liberation Front/Angry Brigade, a neo-Marxist revolutionary group of radical students at the London School of Economics, thus making Tatchell’s protestations of ignorance verge on the ridiculous.

Peter Righton of the Paedophile Information Exchange.
Peter Righton of the Paedophile Information Exchange – a Child welfare expert who wanted the age of consent lowering to four.

Were you aware that Tatchell contributed a chapter to this book?

THE BETRAYAL OF YOUTH

The contents and contributors of The Betrayal of Youth:

Chapter 1: ‘Incest’ by Clive Coliman: Described as “An ardent supporter of the children’s rights movement.”

Chapter 2: ‘Child Pornography and Erotica’ by Richard Green: Illustrator for the Paedophile Information Exchange magazine under the pseudonym “Dominik”

Chapter 3: ‘Child Prostitution’ by Warren Middleton of P.I.E.

Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from the anti-Christian Peace News.

Chapter 5: ‘Power and Consent’ by Eric Presland: Homosexual activist. Contributed also to the American paedophile book “The Age Taboo.”

Chapter 6: ‘Love and Let Love’ by Tuppy Owens, Editor of the Sex Maniac’s Diary, and Tom O’Carroll: ex-Chairman of P.I.E. who was convicted in 1981 of conspiracy to corrupt public morals by sending out a paedophile contact list.

Chapter 7: ‘Children and Sex’ by Fr Michael Ingram: Catholic priest, defender of paedophilia.

Chapter 8: ‘The Paedophiles’ by Beatrice Faust: militant feminist & civil libertarian.

Chapter 9: ‘Questioning Ages of Majority and Ages of Consent’ by Peter Tatchell.

Chapter 10: ‘Ends and Means: How to Make Paedophilia Acceptable?’ by Roger Moody of Peace News: “One of the most outspoken advocates of children’s rights in Britain .” Well-documented as a ubiquitous paedophile intellectual.

Chapter 11: ‘Socialism, Class, and Children’s Rights’ by John Lindsay: “ardent supporter of children’s rights.” Member of the Socialist Workers’ Party. Homosexual activist, hates the institution of the family.

Chapter 12: ‘Childhood Sexuality and Paedophilia: Some Questions Answered’ by Warren Middleton of P.I.E.

Chapter 13: ‘The Oppression of the Young: An Inside Perspective’ by Jeff Vernon: Involved in Gay Youth Movement and Campaign for Homosexual Equality.

Appendix 1: “P.I.E., from 1980 Until its Demise in 1985” by Steven A. Smith: ex-chairman of P.I.E. Fled to Holland in 1984, became “active in the Dutch crusade for children’s rights,” was deported back to the UK in 1991 and sentenced to 18 months for sending indecent articles through the post.

Appendix 2: “The Uranians” by Timothy d’Arch Smith: Bookseller. Author of “Love in Earnest.”

Peter Tatchell’s self-defence begins with:

“Unlike many Catholic clergy, I have never abused anyone. Unlike the Pope, I have never failed to report abusers or covered up their crimes.”

These are blatant falsities. It wasn’t many Catholic clergy, it was an extremely small minority. And, as shown in Lies About The Catholic Church Child Sex Abuse Scandal, there is no reason, except bigotry and prejudice, to single out Catholic clergy who in fact have committed fewer of these crimes than any other pedagogic institution, religious or secular.

Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religous values.
Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religious values.

Saying what he does about the Pope is a criminal act, it is slander. The Pope has never covered up for anyone.Tatchell and his friends in the mainstream media (especially the BBC) think that if you repeat a lie enough times your audience will start to believe that it’s true.

But blaming the Church whenever you’re in trouble is a good way to distract the public from your own deviations from the norm. It’s worked so far so why shouldn’t it work now? Maybe because people have started calling your bluff, Pete.

Peter Tatchell has a seething hatred of Christian morals and values.
Peter Tatchell has a seething hatred of Christian morals and values.

The above should tell you how trustworthy and credible Tatchell is, but there’s more.

Look at his defence of the book Dares To Speak:

“Dares to Speak was an academic book published in 1997, authored by professors, anthropologists, psychologists, sociologists, a Dutch senator and a former editor of a Catholic newspaper. It discussed the age of sexual consent and whether all sex between young people and adults is necessarily unwanted and harmful, based on what it said was objective research with young people.

The book does not endorse or excuse sexual relationships with young people that involve coercion, manipulation or damage. The authors queried, among other things, the balance between giving young people sexual rights and protecting them against abuse. These are entirely legitimate issues to discuss.”

Leaving aside the irony (probably lost on humorless Tatchell) about his using a “former editor of a Catholic newspaper” as a guarantor of the morality of a book while he constantly treats the Catholic Church like a den of abusers. The book Dares to Speak, that Tatchell praises so much as an academic achievement, was edited by Joseph Geraci, who was also the editor of Paidika: The Journal of Paedophilia. The book is a collection of articles from the journal.

Before it was quietly removed, this was Wikipedia’s entry for the publication:

Paidika: The Journal of Paedophilia (1987–1995) was a journal published by the Stichting Paidika Foundation whose purpose was to promote the normalization of pedophilia. Its editor was Joseph Geraci and the editorial board included articles by writers Frits Bernard, Edward Brongersma, Vern L. Bullough, and D. H. (Donald) Mader, some of whom campaigned as pro-pedophile activists.

After the normalization of homosexuality, we’ll have the normalization of paedophilia.


Image result for Maloney and Tatchell protesting TOGETHER against the Pope


Image result for Maloney and Tatchell protesting TOGETHER against the Pope

2010

Does Bill Maloney not know about Peter Tatchell?

tatchell1

 

 

Graham Ovenden was a Guest Editorial of Paidika Journal of Paedophilia in 1994

PAIDIKA NUMBER 10 WINTER 1994: Guest Editorial: Fall from Grace, by Graham Ovenden

Paidika: The Journal of Paedophilia
Full-Text Files (PDF, GIF and plain-text searchable HTML)
Documents Not Likely to be Widely Available in Libraries
archived here by
Gerald Jones, Ph.D.
University of Southern California, 1964-2007:
Student, Lecturer, Adjunct Assistant Professor of Statistics, Staff (Retired)

15092011573[1]

http://zoompad.blogspot.co.uk/2013/06/paidika-number-10-winter-1994-guest.html


Here is Tatchell’s letter to the Guardian dated 26th June 1997 (a few weeks after Labour’s General Election win) which he denied writing when I asked him about it. However I can find no record of a complaint to the Guardian, the Press Complaints Commission or any lawsuit for libel:
Ros Coward (Why Dares to Speak says nothing useful, June 23) thinks it is “shocking” that Gay Men’s Press has published a book, Dares To Speak, which challenges the assumption that all sex involving children and adults is abusive. I think it is courageous. The distinguished psychologists and anthropologists cited in this book deserve to be heard. Offering a rational, informed perspective on sexual relations between younger and older people, they document examples of societies where consenting inter-generational sex is considered normal, beneficial and enjoyable by old and young alike.
Prof Gilbert Herdt points to the Sambia tribe of Papua New Guinea, where all young boys have sex with older warriors as part of their initiation into manhood. Far from being harmed, Prof Herdt says the boys grow up to be happy, well-adjusted husbands and fathers. The positive nature of some child-adult sexual relationships is not confined to non-Western cultures. Several of my friends – gay and straight, male and female – had sex with adults from the ages of nine to 13. None feel they were abused. All say it was their conscious choice and gave them great joy. While it may be impossible to condone paedophilia, it is time society acknowledged the truth that not all sex involving children is unwanted,abusive and harmful.
Peter Tatchell.
Picture 9
Peter Tatchell has repeatedly denied writing the letter above. However below is his reply in the Guardian (1st July 1997) to criticism of his original letter. In his second letter (below) he never denies writing the first letter (above) or claims he was edited in any way.
Peter Tachell’s second letter to the Guardian on 1st July 1997.
Peter Tachell’s second letter to the Guardian on 1st July 1997.

Peter Tatchell has often claimed he lives a monk-like existence living on a mere £9,000 income per annum. When I challenged him on this he changed his claim to £29,000 plus expenses. However he has refused to disclose his payments for his numerous main stream media appearances or disclose how much his yearly expenses are.
Peter Tatchell in his Council flat.
Peter Tatchell in his Bermondsey Council flat.

Peter Tatchell has declined to be interviewed for this article, however I will leave him the option of the right of reply in the comments section.

__________________

P.I.E – Paedophile Information Exchange

Members/Activists/Connected of P.I.E
Former PIE Chairperson and current pro-paedophile activist Tom O’Carroll
tom

David Joy, 66 – once No2 in the notorious Paedophile Information Exchange. In 1984 he was jailed for 18 months for publishing obscene material in a PIE newsletter. In 1996 he got two more years after admitting indecent assaults dating back to the 80s. Then in January 2006 cops found 1,129 images of children aged one to 13 at his rundown flat in Loughborough, Leics. Some were in the level 5 category – featuring sado-masochism, torture or bestiality.
david-joy1

DR Morris Fraser – P.I.E founder member & leading child psychiatrist – had a criminal record for taking indecent photographs of children and assault in 1972. Good friends with both Napier, Waters and Righton
morris

Terrence Waters – Former prep school teacher – Closely linked to several P.I.E members incl Andrew Sadler – adopted the alias “James Opphin daler”. The name contains an anagram of the word “paedophile”. In 1994 Waters was sentenced to ten years for possessing child abuse images and the sexual abuse of a 10 year old boy. In 2011 convicted for more sexual abuse against children at Allen House School – More on Waters on this link
Michael Johnson – jailed for four years on six specimen counts of indecent assault against two boys aged nine and 11. In 1988 Dr Morris Fraser and Michael Johnson set up a sailing charity for disadvantaged boys called the Azimuth Trust based in Cornwall.
Andrew Sadler – Former teacher who was jailed abroad for sex offences against boys – Links to Fraser and Napier –
Andrew Sadler

More on Sadler on this link
Leo Adamson helped set up Pie to distribute obscene pictures of young boys while John Parratt aka Warren Middleton was a former vice-chairman of the organisation
Leo Adamson, left. John Parratt right

Former chairman/leader Steven Freeman aka Steven Adrian Smith
freeman

Freeman/Smith was a former Home Office security guard and was described in court in 1984 as the, “powerhouse and engine room of P.I.E, and the life blood of contact which he edited and printed.
The members’ hotline for the Paedophile Information Exchange (PIE) rang, of all places, inside the Home Office. The phone would be picked up by Steven Smith, a paedophile and member of the group who worked in security in Whitehall, from where he would tell callers where to go for the next meeting to discuss issues including decriminalising sex with children as young as four.
John Morrison and Barry cutler – Members
john morrison left. Barry Cutler, right

Geoffrey Prime – Former member and KGB spy
957218

Sir Peter Hayman – Several links to P.I.E and its members – Former High Commissioner to Canada
peterhayman01

Notorious paedophile and TV presenter Jimmy Savile was almost certainly a full member of P.I.E
Jimmy+Savile

Peter Bremner (aka Roger Nash) Member level – Bremner has convictions for indecently assaulting children. Jailed for 6 months in 1994 with David Joy. in 1978 Bremner was given a three month prison sentence suspended for 2 years and fined £150 for indecently assaulting 3 boys, two aged 8 and one aged just 5
peter brmner

John Stamford – A former church minister published international guides for child molesters. He died before his trial. Stamford used a homosexual travel guide called spartacus as a front for a mailing ordering service offering information on child prostitutes in Thailand, Brazil and other nations. The organisation was alleged to have operated through a box number in London. The details of each of the members, including their sexual preferences, the desired age of the children and preferred countries of origin were stored on a computer. The members received personalised lists of children.

For more on Stamford and Spartacus magazine click here
Stephen King aka Stephen Gosling – so called child expert was a member of P.I.E. His unbelievable role was to advise UK judges on sentencing for paedophiles
stephen_king

Richard Bigham – Eldest son of viscount of Mersey admitted he was a member

Former Vicar and millionaire Michael Studdert –financial backer and member level millionaire-michael-studdert

David Wade – The treasurer of P.I.E
Entry level members – Robert Bushell, Geoffrey Taylor, David Hooper, Nigel Beatman – Click this to see summary of their convictions

P.I.E members jailed in 1978

April 1978

‘Sinister Group Passed Boys Round The System’

A CHILD-SEX campaign was branded by an Old Bailey judge as a ‘sinister group’.

‘The Paedophile Information Exchange must cause deep anxiety to people who care about the welfare of children,’ said Judge Brian Gibbons.

His criticism came when he jailed four of the nine men who admitted homosexual acts with young boys and indecent assault. The others were given suspended sentences and fined.

Two of the men had met through the Exchange and a network of communication had been developed among the nine who ‘passed boys round the system.’

One of the men, 26-year-old Robert Bushell, of Golders Green was described by the judge as the worst offender.

He had committed some of the offences in the dormitory of a Surrey boarding school.

Judge Gibbons told him ‘You corrupted the uncorrupted at an early age. I consider you a grave danger to children.’

Judge Gibbons also jailed Geoffrey Taylor, aged 65, for four years for indecent assault; David Hooper, aged 35, four years for buggery; and Nigel Beatman, aged 32, jailed for 30 months for indecent assault.

 

Michael Hanson – First chairman (set up P.I.E. as a special interest group within the Scottish Minorities Group with Ian Dunn)
Keith Hose – 2ND Chairman In the PIE Chairperson’s Annual Report for 1975-6, Keith Hose wrote that ‘The only way for PIE to survive, was to seek out as much publicity for the organization as possible…. If we got bad publicity we would not run into a corner but stand and fight. We felt that the only way to get more paedophiles joining P I E… was to seek out and try to get all kinds of publications to print our organization’s name and address and to make pedophilia a real public issue.’
British antiques expert Keith Harding was active in the Paedophile Information Exchange
Harding was convicted of indecent assault against four children aged eight and nine in the late 1950s and was a “schedule 1” offender – meaning his convictions remained on his police file for life.
But he was later given the Freedom of the City of London and became a member of the Worshipful Company of Clockmakers, meeting business and political figures at the height of his career. The clockmaker and music box expert ran a museum regularly visited by children, despite social services being aware 20 years ago of his convictions for child abuse.
harding1

A document held by police in the mid-1980s listed Keith Harding as PIE member number 329 next to his north London address.
Ian Campbell Dunn – Co-founder (born 01/05/43 died 10/03/98)
iandunn1

Shortly before his death, Dunn, a prominent gay activist, became convener of lobby group Outright Scotland. In 1997, he condemned police over a camera surveillance operation in public toilets in Stirling which led to several gay men being charged – even though the investigation also revealed that some men had sex with a 13-year-old boy. In 1974, Dunn co -founded the Paedophile Information Exchange ( PIE) with Michael Hanson. It became the leading contact group for adults campaigning for the right to have sex with children. In an interview in 1997, Dunn admitted he and Hanson had agreed to facilitate research into sex with children.
Dunn was caught on tape bragging abut interfering with a fourteen-year-old boy. The existence of the tape caused him to abandon a libel action he had brought against a Sunday newspaper, which named him as a paedophile. The encounter itself does not seem to have been a one-off – at his funeral in 1998, a young man claimed Dunn had raped him when he was fifteen. Dunn also supported a paedophile magazine called ‘Minor Problems.’
Charles Napier One-time treasurer of PIE Charles Napier is alleged to have sexually assaulted boys whilst a gym master at Copthorne School. He became an English Language Trainer at the British Council and was convicted of sexual assault against minors in London in 1995 and investigated as an alleged member of a paedophile network operating in British schools in 1996. He set up his own school in Turkey and resumed English Language Training with the British Council after serving his sentence
Charles Napier

Michael Dagnall · Tony Zalewski – Lee Edwards –Named in Daily Express, 26th August 1983

Lee Edwards aka Edward Brand executive committee member of PIE Does the photofit look like him ?

 

Lee Edwards & the Paedophile Friendship Service

Bernard Haunch – Teacher – He was also a member of a group called the Paedophile Information Exchange but apparently claimed it was a discussion group
Bernard Haunch

Dr Edward Brongersma (Deceased) – has written extensively in the area of sexuology, especially on pornography, ephebophilia, pedophilia and the age of consent. His books on this subjects include: Das Verfehmte Geschlecht (in German, 1970), Sex en Straf (“Sex and Punishment”, 1972), Over pedofielen en kinderlokkers (“On Pedophiles and Child Molesters”, 1975), and his last work is his magnum opus and entitled Loving Boys (two volumes, 1988–1990).
Dr Edward Brongersma

Peter Righton AKA Paul Pelham – Righton was the former director of education at the National Institute for Social Work, and a consultant for the National Children’s Bureau. Yet he was also a founding member of the Paedophile Information Exchange (PIE), which wanted the age of consent reduced to four. Righton published essays justifying paedophilia, which he called no more mysterious than “a penchant for redheads”. Police raided his home and found hundreds of letters between him and other paedophiles
peter ri

Warren Middleton, aka John Parratt one of PIE’s first London members – Creater of the Understanding Paedophilia (UP) magazine that was eventually replaced by Magpie
Michael Dagnall – Close friend and fellow abuser with Tom O’carroll Click this , it mentions Dagnall and P.I.E involvement @ page 19
Richard Travell – Active member status – Travell was handed a three-year community order in 2006 for possessing indecent images of children.
Untitled

Alan John Doggett (1936-1978), (pictured above) conductor, composer and choir master. Leader of London Boys Choir – A letter in Magpie 10 reported and commented on the suspected suicide of Alan Doggett weeks before he was due to face child sex charges for having sex with a choir boy. Hit by train. Also has links to a certain Paul Raven aka Gary Glitter
C. J. Bradbury Robinson – American author who wrote several times for Magpie magazine – His pro-paedophile books include A crocodile of choirboys “Bare Knees, Boy Knees.” The latter offers an “unmatched” and “startling trip into the strange world of the Paederast,” says the description on Amazon, which has one used copy for sale for $500
Richard James – Writer at Magpie
Paul Green – Writer at Magpie
Peter Deathman – P.I.E member who was regulary visited in prison by Tom O’Carroll. Deathman served a 10 year sentence not for mere sexual abuse but for child stealing
Den Nichols – Author of paedophilia literature called “Towards a Better Perspective For Boy-Lovers”. Published in 1976. In its preface to ‘serious minded adult males who feel an existential attraction to young boys”. Copies were advertised and sold by P.I.E/Magpie for £1 each, including post & packaging
David Grove – AKA Robin Brabban – born 1904 – secretary and Ex treasurer of PIE
Michael Walker – London – Member level of P.I.E – He did not agree on certain issues of P.I.E but condemned hostility against P.I.E
Anthony Green – Somerset – He attended a meeting of P.I.E that was attacked by the Nation Front. He urged tolerance and understanding of paedophiles
William Thornycroft – He was disgusted at attacks on P.I.E. He was quoted “The sexual freedom of children was needed” – Member of Communist Party Gay Rights Committee in the 70’s
Robert Atkinson – Newcastle teacher was arrested for sexually abusing a 13 year old student. He was fined £200. The headmaster and staff however continued to support him after the his guilt. Member level status in P.I.E
Ian Harvey – P.I.E member – He sought to differentiate bewteen “good paedophiles” and pedarasts, but without defining his terms or explaining why
Micky Burbidge – He supported P.I.E’s proposal to abolish the age of consent laws. Also wrote a book entitled“Evidence on the law relating to and penalties for certain sexual offences involving children for the Home Office Criminal Law Revision Committee” with Kieth Hose
Frits Bernard (1920 – 2006) was a Dutch psychologist,sexologist, homosexual activist, and pro-pedophile activist.Together with the late Edward Brongersma, he laid the foundations of the emancipation movement of boylovers in the Netherlands.
Keith Spence – He applauded the “courage” of the leaders of P.I.E in the face of ; quote – Hysteria, hostility and violence, also wrote several paedophile articles for Magpie about sexual abuse of young boys
June 1983: Scoutmaster Michael Williams of Castle Bromwich. Birmingham, resigned after being exposed as a member of P.I.E
Jane Rule – Canadian Writer of lesbian-themed novels and non-fiction. Co author of Magpie: Journal of the Paedophile Information Exchange – Also supporter of NAMBLA (The North American Man-Boy Love Association (NAMBLA) was founded in December 1978 and is an activist homosexual and pedophilia coalition group. Their primary aim is stated to be the overturn of statutory rape laws and reduction of “age of consent” laws that require a child be of a certain age (which varies by state) before they can agree to sexual intercourse.
John Finnin – Co author of Magpie: Journal of the Paedophile Information Exchange
Peter Saxon – Co author of Magpie: Journal of the Paedophile Information Exchange
Derry Webster – Tom O’Carroll was named in court as a ‘customer’ for Webster’s child abuse images and video collection. Webster was jailed for his part for selling the obscene films, magazines and pictures
Kenneth Plummer – Involved with O’Carroll. He stated “Any study that can take adult-child sexuality out of the zone of shrieking horror and place it in the demystified zone of everyday experience must be welcomed”. sociologist Dr Kenneth Plummer of Essex University, sent a “warm message of support” for “Betrayal of Youth,” and, in company with Nettie Pollard and Professor Donald West (qv), also read, made suggestions and then praised “Paedophilia the Radical Case” receiving “heartfelt thanks” from its author, Paedophile Information Exchange Chairman Tom O’Carroll. Attented several P.I.E meetings
.
.Harman letter PIE http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://www.telegraph.co.uk/news/politics/labour/4949555/Harriet-Harman-under-attack-over-bid-to-water-down-child-pornography-law.html
.
http://cigpapers.wordpress.com/2013/06/05/p-i-e-paedophile-information-exchange-exposed-part-two/
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://en.m.wikipedia.org/wiki/Age_of_consent_manifestations_(UK)
.
http://labour25.com/category/age-of-consent/
.
http://en.m.wikipedia.org/wiki/Liberty_(pressure_group)
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://blogs.spectator.co.uk/nick-cohen/2014/02/when-is-a-scandal-not-a-scandal/.
.
http://ufohunterorguk.com/tag/nccl/
.
http://www.wikileaks-forum.com/united-states/479/the-truth-about-some-politicians-backing-practicing-pedophiles-and-cp/15984/
.
http://www.theguardian.com/society/2014/feb/26/lobbying-paedophile-campaign-revealed-hewitt
.
http://aangirfan.blogspot.co.uk/2013/02/nspcc-mi6.html?m=1
.
PIE’s new name
http://www.libertarian.co.uk
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-
love/p-i-e
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-love/p-i-e/
.
Tony Blair part of PIE
http://www.thedailybeast.com/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html#url=/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html
.
PIE & HMqueen
https://m.facebook.com/story.php?story_fbid=638499922852151&id=100000764465111&refid=7&_ft_=qid.5988561366331161130%3Amf_story_key.1134116637656814874
.
http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://dailybalenews.com/2014/02/08/paedophiles-plan-to-build-village-in-devon-update/
.
http://m.couriermail.com.au/news/opinion/opinion-why-does-the-left-support-this-avalanche-of-pedophile-filth/story-fnihsr9v-1226861620956
.
Liverpool (NICHE)
http://sindonax.wordpress.com/2014/03/25/paedophile-cover-ups-the-hows-and-whys/
.
PIE
http://spotlightonabuse.wordpress.com/category/pie-paedophile-information-exchange/
.
https://docs.google.com/file/d/0B4PQp1NQ39MPYzU5NDVhY2QtMWViYi00MDRkLWE4OWQtOTc2NjA5MWZiNWI3/edit
.
http://ianpace.wordpress.com/2014/03/15/pie-and-the-home-office-three-memberssupporters-on-inside-funded-magazine-printed-and-phone-line/
.
http://web.archive.org/web/20041116144121/http://home.wanadoo.nl/host/wilson_83/index.htm
.
Labour controlled BBC
http://gaiusmarcellus.blogspot.co.uk/2010/03/unacceptable-links-between-labour-and.html

Silent
http://www.silentlambs.org/
Silent
http://iamthewitness.com/listeners/Jewish.child.molesters.that.are.never.on.the.NEWS-WHY.htm
.

https://gettingreadyfor2015.wordpress.com/2014/01/18/a-bill-maloney-up-date/
.
http://www.real-whitby.co.uk/savilejaconelli-yewtreehibiscus-sborough-paedo-ring-time-line
.
http://www.nationalarchives.gov.uk/a2a/records.aspx?cat=097-hcagrey&cid=-1
.
https://m.facebook.com/story.php?story_fbid=747913618599372&id=100001422211809&refid=28&_ft_=qid.6033289562555813767%3Amf_story_key.2800040682799693877&__tn__=%2As&fbt_id=747913618599372&lul&_rdr#s_ff81768c6432b3819fe18456041bb4e6
.
http://order-order.com/2014/07/08/watch-former-tory-whip-boasts-about-paedo-mp-cover-up/

LINK

Arlo Tatum,[1] the executive secretary of the Central Committee for Conscientious Objectors, sued Melvin Laird, the Secretary of Defense. Tatum sued after Washington Monthly published an article revealing that US military intelligence units were gathering https://twitter.com/cassandracognointelligence on civilians and civil organizations in the US.[2]

8

Arlo Tatum moves to UK & joins Albany Trust after suing US army for alleged unlawful “surveillance of lawful citizen political activity.”

Tatum had composed and sung songs for Aldermaston peace marches during the 50s and had also become the Director of Peace News. [Arlo Tatum obituary, The Guardian 7 May 2014]

And Jack Straw’s autobiog reveals his MI5 file started from the Aldermaston marches

During 1975, while Paedophile Information Exchange member Roger Moody was working for Peace News he was promoting the organisation in its pages.

https://bitsofbooksblog.wordpress.com/2015/02/23/march-1977-albany-trust-arlo-tatum-peace-news-and-paedophiles/

2 female authors/contributors to PIE’s Warren Middleton’s B.O.Y were also involved with Peace News like Roger Moody

(Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from  Peace News.)

Peace/anti-nuclear campaigners heavily targeted by state surveillance since pre1970s to current day:

So how with all the surveillance were the paedophiles for peace lobbyists missed?

 

Or were they a useful control/eye on non-paedophile peace campaigners?

Were paedophiles used as informants on anti-nuclear protestors?

Perusing Peace News from 1975+ I was glad to find ONE letter to Editor saying what I was thinking….

paraphrased: “What’s with Peace News new preoccupation with paedophile rights? What’s it got to do with anti-nuclear/peace activism?”

Writer of letter was an extremely disappointed long-term subscriber who just couldn’t fathom what had changed for Peace News


Government lawyers…in a vain attempt to keep a lid on Peter Wright’s revelations, seem to be turning a blind eye toward Peace News – the paper published passages from Spycatcher.

The Guardian London, Greater London, England Wednesday,  September 2, 1987 – 36


November 29th 2006 Maidenhead council paid out £300,000 + five years legal costs to nine men who were raped as children whilst in the care of the council at the Greenfield House care home Maidenhead  Berkshire. The council immediately sued one of the men they had paid compensation claims on behalf of, for raping children in their care.

This man immediately settled out of court with a payment in excess of £1,000,000.00. Amazingly the council agreed to a gagging order, so the name of the man and the amount the man had paid the council would remain a secret. Furthermore in this corrupt deal, if the council paid out more compensation claims to anymore of this mans rape victims, the council would not pursue the unnamed man for any further financial contributions.

Due to the councils corrupt immoral dealing with this matter, this secret paedophile deal, would now forever pervert any future criminal investigation and prosecution, involving the unnamed rapist. By 2010 Maidenhead council had compensated 21 abuse victims 12 of the 21 had been compensated for being raped by the unnamed man.

In 2013 under the freedom of information act, I received the following information from David Davies representing Maidenhead Council. The total amount the council paid out was £569,750 compensation and £732,500 legal costs. (to view this document just scroll down) If the council received a payment of more than £1,302,250.00 from the unnamed man, which I very strongly suspect they did, the council have actually profited from the children in their care being raped, and abused by this unnamed man in the gagging order.

In February 2014 Christabel Shawcroft the MD of Maidenhead council in an email to Mike Thornton MP, incredibly broke the gagging order and named the unnamed man as Mr Gilbart-Smith. (to view this document just scroll down)

In May 2014 Theresa May Home Secretary addressed parliament regarding the governments position on paedophiles.

Since Mrs Mays 2014 speech, I have written to Mrs May the Maidenhead MP on numerous occasions, concerning this corrupt paedophile payment with the council in her constituency, and I have never received a reply from the Maidenhead MP.

Another of Gilbart-Smiths rape victims visited Mrs May’s Maidenhead surgery concerning this matter, and the matter was totally ignored as can be seen in Mrs May letter (to view this letter just scroll down) The MP’s of five of Gilbart-Smiths rape victims namely; Mike Thornton, Mimms Davies, Norman Baker, Nick de Bois, and John Redwood have also written to Mrs May as the Home secretary concerning this secret paedophile hush payment. However, none of the MP’s received a reply either.

The only reply I have had was from Sarah Newton at the Home Office when Mrs May became PM. Unbelievably Miss Newton advised me to complain to Maidenhead Council about the paedophile payment. (to view this letter just scroll down)

In light of Mrs Mays 2004 speech I now am seeking help from a professional to ask these three questions and get three answers from Mrs May;

Mrs May,

  1. “Is it proper for the council in your constituency to enter into a SECRET million pound plus agreement, and also agree a gagging order, with Denham Gilbart-Smith, the same man the council were suing, for raping numerous children in their care?”
  2. “Did Maidenhead council receive from Denham Gilbart-Smith more than the £1,302,250.00 they paid out in compensation and legal costs?”
  3. “If the council did receive more than the £1,302,250.00 from Denham Gilbart-Smith, is it proper for the council to profit from children in their care being raped, especially as the payment was received from the same man they were suing for raping the kids?

Below is an overview of this massive

story of blackmail corruption and three murders!

©2019 John Affleck is legally responsible for all content on this website. 

1964 – 1970 numerous children were raped and abused at Greenfield House children’s home in Ray Park Road Maidenhead Berkshire, by Donald Prescott the warden of the children’s home, and numerous other men invited to the home by Prescott.

1966 Prescott a career paedophile, met 19/20 year old Denham Gilbart-Smith at St Marys Church Maidenhead. Gilbart-Smiths wealthy parents Oliver & Doris Gilbart-Smith had recently introduced Billy Graham an American evangelist to the Uk. It was rumoured that Doris Gilbart-Smith had paid or contributed a large amount of cash for the rent of the Royal Victoria & Albert Hall in London, for some of Mr Graham’s meetings.

1967 Prescott convinced young Gilbart-Smith to register with the council as an “unpaid helper”. Wealthy Gilbart-Smith, was now forever officially connected to this nest of paedophiles within the council’s records.

1967 Tony Knott a Reading photographer photographed Willy Walters (GFH resident) raping *Eddy Allen (GFH resident). Knott also photographed Ted Burkett a paedophile friend of Prescott’s and regular visitor to Greenfield House with different boys. Knott photographed JD with MS, MM with EA, and other Greenfield House kids, being raped and abused by each other, but the identity of the adult abusers were always hidden in the photos.

*Eddy Allen committed suicide age 23.

Tony Knott  66 and boyfriends, Florida Court Bath Road Reading RG1 6NG

1967 In May 1967 Gilbart-Smith got a green MG reg KMO 124B for his 21st  birthday. Gilbart-Smith gave 17 year old Willy Walters his bubble car reg WLH 858. Walters had officially left the children’s home, but under Prescott’s control Walters stayed on and would rape and abuse the younger boys, with Gilbart-Smith and other men.

1967 Prescott groomed Gilbart-Smith with the anonymous photos and Gilbart-Smith was subsequently photographed by Tony Knott. However, in this photo set, Gilbart-Smith was fully identified sexually abusing a young boy RA, the blackmail plot was now on. Police became aware of some indecent photos and in the August of 1967, Tony Knott was arrested.

1968 Tony Knott was sent to prison for eighteen months in March 1968, for taking indecent photos of young boys at his studio 30 Minster Street Reading RG1 2JF, but the blackmail plot and the connection to Greenfield House remained undiscovered.

1970 Prescott left Greenfield House in the December of 1970 when the police began an investigation into the paedophile ring. Burkett a baggage handler at Heathrow for B.O.A.C. fled to Australia to escape the criminal investigation. Prescott confronted Gilbart-Smith senior with the photo’s saying; “If I go down I am taking your son with me!” Gilbart-Smith senior paid Prescott a large amount of cash, part of which Prescott used to bribe DC Carstairs a detective from Bracknell police station who was leading the investigation.

1971 After receiving the cash Detective Carstairs interviewed numerous boys. Carstairs’ tactic to close down the investigation was to completely overpower and intimidate the boys. One such interview with sixteen-year-old MM who had been abused for the previous five years went like this: “Are you telling me he put his cock up your arse? You expect me to believe that?” The detective concluded the interview by stating: “That’s fucking disgusting, nobody will ever believe that! Are you some sort of fucking poofter?” After this series of interviews the police investigation was wound down and eventually closed.

1970 – 1986 by 1986 Gilbart-Smith had been blackmailed for sixteen years by Prescott. When Gilbart-Smith became a Lloyd’s name, knowing the blackmail would never end he ordered a hit on Prescott. (Read the book) Upon Prescott’s demise, Burkett who had previously returned from Australia, visited Walters parents to be told that Willy was in Wandsworth prison. Burkett visited Walters in jail and when Willy was released the pair retrieved a set of the Gilbart-Smith photos from the attic of Burkett’s sisters bungalow in Virginia Waters Surrey, Burkett and Walters together blackmailed Gilbart-Smith.

With the first blackmail payment, Burkett paid cash for a substantial town house property in the King Charles area of Kingston, KT5. Gilbart-Smith put a hit on Burkett (Read the book) after Burketts demise Gilbart-Smith paid off Willy Walters. Walters an ex Greenfield House abuse victim, had played a minor role in the blackmail plot as Burkett’s errand boy.

1986 Around 1986 Walters who was 25/26 still lived in a council flat with his wife and two children. Walters had spent all of his adult life in and out of prison. However, with Gilbart-Smiths help, Walters managed to purchase 16 Clive Road Colliers Wood London (£585,592 current zoopla valuation) Walters also purchased each of his two sisters council properties in Howletts Close Eastbourne, with the government right to buy scheme. Walters also purchased a caravan that he used for family holidays and rental income. Walters also set up a scaffolding business with Gilbart-Smiths help.

1987 & 1989 For the first time in his adult life Gilbart-Smith was free from blackmailers. Then in the 1987 and 1989 stock market crashes, Gilbart-Smith was wiped out as a Lloyds name and set up IMS, Insurance Market Services. IMS insured individuals and organisations against kidnapping, acts of terrorism, industrial espionage and such like.

1990’s Gilbart-Smith was expelled from his position of elder and senior Bible teacher alongside his good friend Alistair Bullen at the River Church Maidenhead, for inappropriate sexual conduct with members of the congregation, including a five year extra marital affair with Julie B. After being disgraced, Gilbart-Smith travelled to to Africa, Portugal and Jamaica with his very close friend Peter Butt, where Gilbart-Smith taught the Bible to disadvantaged people who had problems with their home life.

Peter Butt http://www.SchoolofMinistries.org        Alistair Bullen http://www.RiverChurch.org.uk

2000 Gilbart-Smith was arrested and charged with two rapes but the charges were later dropped due to insufficient evidence. The two complainants JD and MM were advised to seek compensation from the owners of the care home Maidenhead Council, through the civil court. The two men instructed a solicitor named Alan Collins to pursue a civil claim on their behalf.

2006 November 29th Alan Collins reached an out of court settlement with Maidenhead Council and or the councils insurers for £300,000 compensation (plus five years legal costs) for nine claimants. At least four of the nine abuse victims were compensated by Maidenhead Council for being  raped by Denham Gilbart-Smith, the man unnamed  in the BBC article below.

http://news.bbc.co.uk/1/hi/england/berkshire/6195572.stm

2006 immediately after the compensation pay outs, RBWM or MMi the RBWM insurers sued Denham Gilbart-Smith to recover their loss.

2007 in the spring of 2007 Gilbart-Smith made a seven figure payment to RBWM MMi to keep his paedophile activities a secret. Included in this out of court settlement;

  1. RBWM/MMi agreed to keep the name Gilbart-Smith a secret.
  2. RBWM/MMi further agreed to keep the amount of money Gilbart-Smith paid a secret.
  3. RBWM/MMi further agreed to exclude Gilbart-Smith from being pursued financially, if RBWM/MMi paid compensation to any more of Gilbart-Smiths rape victims.

2007 early in 2007 totally unaware of this court case and compensation payout, I was asked by the publisher Verite to consider writing my autobiography. In consideration of this request, I googled all the names of my known childhood abusers. After finding a photo of Denham Gilbart-Smith on his company website, I contacted Child Abuse Lawyers and chose to contact Alan Collins from a list of solicitors Child Abuse Lawyers emailed me. I chose Alan Collins solely because he was geographically the closest, being only an eighteen minute drive from my home. I was very surprised to find out that Mr Collins had recently closed a case for nine other kids that went to Green Field House.

2007 on the 27th March 2007 Alan Collins submitted the below letter to RBWM.

2008 Verite published my book and I sent a copy to Windsor police.

RBWM denied all responsibility for my claim for the next eighteen months. The reason Alan Collins (solicitor) advised me was, RBWM were waiting for a ruling on a case the law lords were making, where Shirley Woodman was attempting to sue the the rapist Iorworth Hoare, who had won £7 million on the lottery whilst on day release from prison. Apparently until that ruling was made, RBWM would not accept any responsibility. What the lotto rapist had to do with me being abused in a Maidenhead childrens home I really have no idea, especially as RBWM had already in a secret deal been pre-paid by Gilbart-Smith for having raped me.

On 22nd September 2008 RBWM agreed to pay me £50,000 compensation for being raped by Denham Gilbart-Smith and others. Had I known RBWM had been paid upfront by Gilbart-Smith for raping me when I was a ten year old kid, I would never have settled the claim. I would have probably considered a private prosecution against Gilbart-Smith.

There is a very strong possibility that RBWM received more money from Gilbart-Smith than they actually paid out in rape claims. If that is the case then RBWM MMi have actually made money from children in their care being abused and raped by Gilbart-Smith and others.

2008 after a twelve month police investigation, Gilbart-Smith was eventually charged with seventeen counts of rape and child abuse, thirteen of which can be seen in the below charge sheet.

2010 by 2010 RBWM/MMi had paid compensation to 21 abuse victims, between 10 -13 of these claimants, had been compensated by RBWM/MMi for being raped or sexually abused by Gilbart-Smith.

The six week trial started on Monday 17th May at Reading Crown court case number T20097272.

For some reason not yet understood Tony Knott the photographer, was not involved in the police investigation or the six week trial. As a result of the secret contract RBWM MMi had entered into with Gilbart-Smith, at the 2010 trial, this out of court settlement had to be kept a secret from the jury, so the jury had ZERO chance of being told the truth from the outset.

On Wednesday 19th and Thursday 20th May 2010, Willy Walters gave evidence that he was raped and abused at Greenfield house. Walters also told the court that he would rape and abuse the younger boys as Prescott commanded. Walters then committed perjury by saying he had little to do with the posh man. (meaning Gilbart-Smith).

The following morning Friday 21st May, as Gilbart-Smith sat in the dock at Reading Crown Court, Walters was murdered! Walters died in the exact same way as Gilbart-Smiths two other blackmailers. All three blackmailers felt well enough to get out of bed to go about their daily business, all three blackmailers had a heart attack in a public place, all three blackmailers died of the heart attack immediately before reaching hospital.

With Walters now dead, Gilbart-Smiths defence challenged one of his rape victim stating that; he was confused and mistaken, as it was not Gilbart-Smith that had driven him in his green MG to the Tudor House on Wandsworth Common London, to be raped  by a group of men at a bonfire party, as the witness told the court, but rather it was Willy Walters that had driven him in the bubble car from Maidenhead to South London to be raped by this group of men. (The bubble car only had one seat) To use this ridiculous defence strategy Gilbart-Smith 100% knew Walters was dead!

If Walters was still alive he would have been EXTREMELY angry and 100% would of told the truth about what really happened concerning the police corruption and the blackmail payments etc. Walters would have 100% blown Gilbart-Smith right out of the universe with the truth of what really happened.

Nine men who live in different parts of the country and hadn’t seen each other for forty years gave compelling evidence of how they were raped and abused by Gilbart-Smith.

  • Gilbart-Smith agreed with the council’s records that he was an unpaid helper at the children’s home
  • Gilbart-Smith agreed with the prosecution that all of the other men that visited Greenfield House were paedophiles.
  • Gilbart-Smith further agreed that he went on holiday with the paedophiles and the boys to London, Kent, Sussex and Cornwall.
  • Gilbart-Smith agreed that he now understands the boys were raped in these locations, but at the time he didn’t know that his friends were paedophiles, he didn’t know that the boys were being raped and he didn’t rape any of the boys.
  • Gilbart-Smith’s only defence other than character witnesses was his personal denial which was nonsense being peppered with ridiculous lies, which can be read in the court transcripts or seen in the below video.

Based on Judge Johns instructions, the jury had to reach a verdict based on who was telling the truth, the nine men or Denham Gilbart-Smith. Below is a seventeen minute factual overview of the six week trial and its conclusion. To make complete sense of this story, watch the video before continuing.

I was totally disgusted with the trial outcome and was sent to prison for twelve months for contempt of court. I was ecstatic and feeling very pleased with myself as I got Gilbart-Smiths mugshot on the six o’clock & ten o’clock news, and in every single UK newspaper.

Before the trial in 2010 Gilbart-Smith sold his insurance business IMS, after the trial Mr & Mrs Gilbart-Smith became residents and deserted their children and grandchildren fleeing to Northern Cyprus, a Muslim country that is residency to numerous UK criminals, as Northern Cyprus have no extradition treaty with the UK. Mr & Mrs Gilbart-Smith also travel to other countries that don’t have an extradition treaty with the UK such as Vietnam.

http://www.visaforvietnam.org/Vietnam-visa-for-tourist-purpose.html

2013 in November 2013 under the F.O.I. (Freedom of  information act)  David Davies of RBWM publicly admits to entering into a gagging order made with an unnamed man who was named as an abuser. Compensation claims totalled £569,750, whilst legal costs were £732,500.

The cheque Gilbart-Smith paid RBWM MMi was seven figures. There is a strong possibility that RBWM received more money from Gilbart-Smith, than the £1,302,250 they eventually paid out in compensation and legal costs. If that is the case as I suspect it may well be, RBWM technically are paedophile pimps, as they would be guilty of making a profit from children being raped by Denham Gilbart-Smith.

2014 on 21st March 2014 DB visited his Maidenhead MP’s surgery and asked Theresa May what her policy would be, concerning the secret £1m paedophile hush payment made to RBWM with a gagging order to protect the man accused of raping a dozen or so young children. Mrs May avoided giving an answer which can clearly be seen in the below letter.

NOTE: This letter was written a few months before Mrs Mays now famous 2014 parliament speech on child abuse. Notice how in direct contradiction to Mrs May’s speech, she swerves answering DB’s concerns;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

As Home secretary and after Mrs May’s famous 2014 speech, Mrs May has been asked the same question by Mike Thornton MP (09/01/15), Mimms, Davies MP (02/03/16), Norman Baker MP (03/03/15), Nick de Bois MP (2015), and John Redwood MP (10/03/15). The MP’s letters and dates can be seen in the journalist pack. Mrs May never answered any of the above MP’s.

2015 Mike Thornton MP received the below email from Christabel Shawcross MD of the RBWM council. Christabel Shawcroft amazingly breaches RBWM’s secret million pound contract by naming Gilbart-Smith as the man RBWM was accusing of raping numerous children in their care. Shawcroft then tells us that after RBWM MMi had compensated numerous rape victims of Gilbart-Smith, Gilbart-Smith reimbursed these costs to RBWM MMi.

I can tell you with 100% confidence, the payment made by Gilbart-Smith was seven figures. I wonder if Gilbart-Smith will sue RBWM for the return of his million pound paedophile payment, as RBWM are now clearly in breach of the legal terms of their 2008 paedophile deal.

As well as breaking the secret agreement, Christabel makes some very naive statements in light of the Home secretaries 2014 speech concerning paedophiles.

As a direct result of RBWM and MMi the insurers of BCC entering into a secret agreement with Gilbart-Smith RBWM MMi;

  1. Perverted any future criminal investigation as the police were no longer allowed to use the information contained in this now secret agreement.
  2. Perverted the course of justice as in any future court case this massive paedophile payment has to be kept a secret, so the facts can no longer be used as evidence.
  3. At the 2010 trial each prosecution witness was asked if they were aware that Gilbart-Smith had settled a claim out of court with RBWM. Each witness was warned by John Price Q.C. that if they mentioned this to the jury the case would be thrown out of court.

CHRISTABEL SHAWCROFT QUOTE: “At the time of the compensation claims Mr Gilbart-Smith was not subject to any criminal prosecution”.

MY RESPONSE: Exactly Miss Shawcroft! This is precisely why RBWM MMi should have given their files to the police to assist a criminal investigation instead entering into a SECRET agreement and hindering any future police investigation…..

You really couldn’t make this stuff up, it’s taken five years for the Home Office to advise me to complain to the council for receiving a £1M hush money payment from a man they are suing for being an active paedophile in one of the council run homes. Dear Mrs Newton, Should I also complain to Mr Gilbart-Smith for raping me when I was a ten year old kid?

Mrs May, recently with the Brexit negotiations, you have had a lot of practice making deals! As the MP for Maidenhead, in the light of your 2014 speech, can you please let me understand your policy regarding the secret £1m paedophile payment, made between Denham Gilbart-Smith & Maidenhead Council.

In the anticipation of your very late response,

THANK YOU

 

more here:

http://thenobbler.com/


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.

Update on Peter Ball Establishment Cover-Up: FOI documents reveal Ball investigated in 2008 for being part of a suspected paedophile ring.

^ Prince Charles with his spiritual advisor –  paedophile Peter Ball in 1992

How Prince Charles’s reputation survived devoted friendships with – to date – three paedophiles: Laurens van der Post, Jimmy Savile and an already cautioned offender, Peter Ball.

Peter Ball: Sex offender bishop dies

June 23 2019

A retired bishop who was jailed for a string of sexual offences against teenagers and young men has died.

The Independent Inquiry into Child Sexual Abuse (IICSA) said Peter Ball “was able to sexually abuse vulnerable teenagers and young men for decades”.

He was jailed in 2015 after being found guilty of misconduct in public office and indecent assaults.

The Church of England confirmed Ball’s death and offered “prayers and thoughts” for “everyone affected”.

Bishop Peter Hancock, the Church’s safeguarding lead, said: “We have been made aware of the death of Peter Ball and our prayers and thoughts are with everyone affected by this news.”

Ball, of Langport in Somerset, was Bishop of Lewes between 1977 and 1992 and Bishop of Gloucester from 1992 until he resigned the following year.

After his trial at the Old Bailey he was sentenced to 32 months for offences against 18 teenagers and men between the 1970s and the 1990s.

https://www.bbc.com/news/uk-england-48738803

https://www.iicsa.org.uk/key-documents/6067/view/Public%20Hearing%20Transcript%2025%20July%202018.pdf

dr

Peter Ball: the sinful bishop and a very English cover-up

Times 27/7/18

Paedophile Peter Ball also claimed to be a friend of the Duchess of York.

http://www.twitlonger.com/show/n_1sqjvmh

The Duchess of York was also good friends with convicted paedophile Jeffrey Epstein

Cash-strapped Fergie took £15,000 from paedophile billionaire at centre of claims Prince Andrew slept with under-age ‘sex slave’

  • Duchess of York struck deal with disgraced tycoon in December 2010
  • Came within days of Duke of York flying out to visit Epstein in New York

http://www.dailymail.co.uk/news/article-2897086/Cash-strapped-Fergie-took-15-000-paedophile-billionaire-centre-claims-Prince-Andrew-slept-age-sex-slave.html

Pervert Bishop Peter Ball was friends with Jimmy Savile, Prince Charles, Queen Elizabeth, Queen’s chaplain, Rev John Robson, Margaret Thatcher, Ian Gow, Chief Justice Lord Berwick, George Pell, Fergie, Duchess of York…

Enoch Powell was friends with Ian Gow

May 1988: Ian Gow, who brought along his friends, Enoch Powell and his wife.

Ian Gow, PPS to Thatcher, was also friends with Enoch Powell. Gow was good friends with Peter Ball who spoke at Gow’s memorial.

Enoch Powell at Gow’s funeral

Northern Ireland was Gow’s political passion. He knew and understood the province as few Englishmen do. From his days of military service he developed a feel for the people of Ulster, and after long years of study at the feet of Airey Neave, John Biggs Davison and Enoch Powell all of whom were romantic heroes to him he became the inheritor of their political mantle in Northern Ireland.

https://www.theguardian.com/politics/1990/jul/31/obituaries.jonathanaitken

 


 

Christ’s Hospital School where 5 teachers have been jailed for CSA:

http://www.itv.com/news/2018-07-05/two-more-christs-hospital-teachers-found-guilty-of-sex-attacks-on-pupils/

Image result for "tom lawson" + "nigel lawson"

Nigella, Lord Nigel Lawson, Tom Lawson

http://aangirfan.blogspot.com/2005/06/dominic-lawson.html

Tom Lawson

5 May 2015

Tom Lawson, son of Lord Lawson and half-brother of Nigella, was educated at Eton before going to Oxford, and is now deputy head of Christ’s Hospital school in Horsham, West Sussex.

https://www.independent.co.uk/news/uk/politics/generalelection/general-election-2015-photographic-history-of-bullingdon-club-tracked-down-including-new-picture-of-10224679.html

Lord Lawson say Police should stop funding investigations into historical abuse.

22/11/2015

alun;

The current headmaster (since 2016) at Eastbourne College is Tom Lawson, half-brother of Nigela and son of the Tory grandee Nigel who argued that no funds should be ploughed into historical child sex allegations.

Tom Lawson came to Eastbourne College from Christ’s Hospital where no fewer than 5 teachers have been convicted for CSA and where a common punishment used to be to send pupils down to Peter Ball’s house!

  • Some students were sent from Christ Hospital School to paedophile Bishop Peter Ball for punishment.

Image result for Some students were sent from Christ Hospital School to paedophile Bishop Peter Ball for punishment.

Image result for Some students were sent from Christ Hospital School to paedophile Bishop Peter Ball for punishment.

http://www.chforum.info/php/viewtopic.php?t=4549&start=45

 

 

Another director of Eastbourne College was Alison ‘Butterfingers’ Saunders (2008 – 2014). Despite the collapse of an unprecedented number of abuse cases during her watch as DPP, she still insists she has done a good job:

http://www.dailymail.co.uk/news/article-5568129/Under-fire-CPS-boss-Alison-Saunders-NOT-contract-renewed.html

Aleister Crowley attended Eastbourne College

10 Dec 1991 – Letter from Peter Ball to Enoch Powell

alun:

The address on that note from Bishop Ball to Enoch Powell is significant: It is the postal address for Eastbourne College, where Peter Ball was on the BOD between 1991 and 1992, a school ravaged by cases of child sexual abuse.

 

 

http://www.dailymail.co.uk/news/article-4406562/Two-ex-Eastbourne-College-teachers-sexually-assaulted-boy.html

 

Two retired teachers who sexually assaulted a boy while they taught at his college are jailed for a total of 17 years

  • Ex-history teacher Andrew Boxer, 67, was sentenced to 15 years in jail
  • Ex-music teacher Graham Jones, 63, was jailed for two years 
  • Both taught at Eastbourne College, East Sussex, at the time of the abuse, while the victim was a pupil there

Andrew Boxer and Graham Jones were both convicted of several counts of indecently assaulting the same boy between 1988 and 1993, following a week-long trial.

Former history teacher Boxer, 67, was sentenced to 15 years behind bars for seven counts of indecent assault – six at the same address in Eastbourne, East Sussex and another in Cambridge.

http://www.dailymail.co.uk/news/article-4406562/Two-ex-Eastbourne-College-teachers-sexually-assaulted-boy.html

 

The current headmaster (since 2016) at Eastbourne College is Tom Lawson, half-brother of Nigela and son of the Tory grandee Nigel who argued that no funds should be ploughed into historical child sex allegations.

Yet another director of Eastbourne College (1991 – 2004) was the Duke Of Devonshire Andrew Robert Buxton Cavendish, another close friend of Savile, BigEars and Bishop Ball, seen here giving Savile a silly handshake:

Prince Charles, Camilla Parker-Bowles and the Duke were close friends.

Dame Alun Roberts ‏ @ciabaudo

A punishment at Christ’s Hospital School was to be sent down for a few nights at Peter Ball’s house. I wonder whether those sending them down knew what their fate might be? And who were his ‘special friends’?

It would appear Tom Lawson was what is referred to as a ‘safe pair of hands’, stumbling from one paedo school to the next. He also worked at Winchester College for 15 years, where John Smyth QC abused boys:



Charles and the pervert: Prince tells child sex abuse inquiry he was ‘deceived’ by bishop Peter Ball but says he cannot remember who he was referring to when he said ‘I will see off this horrid man’ in letter to disgraced clergyman 21 years ago

 

Peter Ball would pray naked with them at the altar and encourage them to submit to beatings. At least five more victims were schoolchildren.
Mr Hughes has now indicated that new complainants came forward following the media coverage of Peter Ball’s sentencing. It was considered that it was not in the public interest to pursue these cases, as Peter Ball has recently been incarcerated.

 

EXCLUSIVE: Bullingdon Club 1996- Tom Lawson, the arms dealer's son and the 'mayhem' that took 30 cops to shut down
The former Chancellor’s son was part of a Bullingdon set that caused ‘mayhem’ at a party in Kingston Blount that required 30 police officers to clear up.

EXCLUSIVE: Bullingdon Club 1996- Tom Lawson, the arms dealer’s son and the ‘mayhem’ that took 30 cops to shut down

https://www.byline.com/project/30/article/700


Jimmy Savile acted as a kind of marriage counsellor between Charles and Princess Diana.

Whitehall is ‘covering up the past’: File on Prince Charles and Princess Diana’s marriage, Lockerbie records and MI5 ‘link’ to Belfast lawyer death among documents blocked by government

  • The Advisory Council on National Records and Archives released its latest report
  • Whitehall is supposed to send files to the National Archives after 20 years
  • Officials can block the release of files if they compromise National security
  • The number of blocked files has jumped from 4,300 to 5,900 in a year

http://www.dailymail.co.uk/news/article-6001919/Whitehall-blocks-release-embarrassing-government-files.html

Image result for "jimmy savile" + "princess diana"

Jimmy Savile acted as a kind of marriage counsellor between Charles and Princess Diana.

Jimmy Savile caused concern with behaviour on visits to Prince Charles

Former royal aide says TV presenter would greet young female assistants at St James’s Palace by ‘rubbing lips up their arms’
Savile is understood to have visited Prince Charles’s official London residence several times in the late 1980s when he was acting as a kind of marriage counsellor between Charles and Princess Diana.

 

Not the VSCP‏@NottheVSCP

Incredibly naive and unwise letters from Prince Charles to Peter Ball. Completely biased and one-sided. Showing only sympathy for the perpetrator. This is 2 yrs after Ball had accepted caution, admitting his guilt!

#iicsa #CSA #CSE #cofe #PrinceCharles


Astonishingly, here Prince Charles refers to the VICTIM, Neil Todd as a “ghastly & horrid man” and threatens to “see him off”, 4 yrs after Ball had admitted abusing him. HRH then buys Ball a substantial house. NEIL LATER TAKES HIS OWN LIFE

Camille Davis Russo‏@CDavisRusso

Wouldn’t you think with the sort of emotion he displays here he has inordinate affection for this sado-peado?



Peter Ball would pray naked with them at the altar and encourage them to submit to beatings. At least five more victims were school children.

Charles and the pervert: Prince tells child sex abuse inquiry he was ‘deceived’ by bishop Peter Ball but says he cannot remember who he was referring to when he said ‘I will see off this horrid man’ in letter to disgraced clergyman 21 years ago

  • Prince Charles denied he tried to influence an investigation into Peter Ball
  • The royal gave written evidence at a sex child abuse inquiry on Friday 
  • Ball, the former Bishop of Lewes, sexually abused 18 men during ’80s and ’90s

The Prince of Wales has told a public inquiry he was ‘deceived’ by disgraced bishop Peter Ball and said he ‘cannot shed any light’ on the ‘horrid man’ he referred to in a letter to the paedophile.

Prince Charles was friends with the ex-Bishop of Lewes for over two decades after he accepted a caution for gross indecency.  

He only cut ties with him after he was convicted of sexually abusing 18 young men aged 17 to 25 over 30 years in 2015.

The convicted Bishop, 86, was released last year after serving half his sentence behind bars.

In written evidence today, Prince Charles refused to elaborate on a letter he wrote to Ball at the time of sexual misconduct claims, telling him: ‘I will see off this horrid man if he tries anything again.’ 

Ball had told the Prince a single accuser was behind allegations that led to him having to quit as the Bishop of Gloucester.

In a letter to the Independent Inquiry into Child Sex Abuse, the Prince said Ball had told him the complaint against him was false and had arisen from someone who had a grudge against him and was ‘persecuting’ him.

In extracts from one letter between the Prince and Ball, Charles says: ‘I can’t bear it that the frightful and terrifying man is on the loose and doing his worst.’

But in his letter to the inquiry on Friday, the Prince, who said he regrets having been ‘deceived’ by Ball, said: ‘I regret that I am unable to shed any light on references made in a letter dated 23rd March 1997 to a ‘horrid man’ or a ‘frightful and terrifying man’.

‘This seems to be a manner of speaking in the midst of a long letter written more than twenty years ago.

‘I do recall that Peter Ball felt that numerous individuals, including his critics in the media, were doing all in their power to disadvantage him unfairly.

‘I suspect, but cannot be certain, that the reference is to this issue in some way.’

The Prince says he did not know about the nature of the complaint against Ball and had not appreciated the meaning of a caution – the acceptance of guilt.

A lawyer for some of the former bishop’s victims has said it was difficult to see that ‘as anything other than willful blindness’.

Ball had previously boasted of being a confidant of Charles, and his court case heard that a member of the royal family was among a host of public figures who supported him when he avoided charges in 1993.

In a statement the Prince of Wales denied he tried to influence the police probe into Ball, as he also revealed the bishop told him he had quit his job over an ‘indiscretion’.

He is not giving evidence in person, and it is instead being read out from a prepared statement.

Today he was pictured meeting the UK’s first F-35 Lightening Squadron at the RAF base in Kings Lynn, Norfolk.

In another letter from the Prince to Ball in 1995 – two years after Ball’s caution – the future king said he wished he could ‘do more’.

He said: ‘I feel so desperately strongly about the monstrous wrongs that have been done to you and the way you have been treated.’

Charles also said he had been told by the then Archbishop of Canterbury George Carey the church was looking at bringing Ball back into public ministry.

In the 1995 letter he said it was ‘appalling’ that the Archbishop, now Lord Carey, had ‘gone back on what he told me’.

He said it was clear the Archbishop was ‘frightened of the press – what he calls ‘public perception’.’

Another letter from Charles the following year referred to the process of getting a Duchy of Cornwall property for Ball and his brother Michael, Bishop of Truro.

It said: ‘I long to see you both settled somewhere that suits you and gives you peace and tranquility – and not too far from here so you can come over more easily.’

The pair rented a Duchy property between 1997 and 2011.

Charles’s letter to the inquiry added: ‘My heart goes out to the victims of abuse and I applaud their courage as they rebuild their lives and, so often, offer invaluable support to others who have suffered.

‘I wish I could do more’: What the prince wrote to his friend the bishop as allegations swirled around

Sept 1993, Ball to Charles

Life continues to be pretty nasty for me for, it seems that my accusers still want to continue their malicious campaign. Luckily they are beginning to show some of their fraudulent plans.

Dec 1994, Charles to Ball

I saw the Archbishop the other day and he told me he is trying to bring you back to a public ministry. I do hope this will be all right and suit you, if and when it happens….

Feb 1995, Charles to Ball

I wish I could do more. I feel so desperately strongly about the monstrous wrongs that have been done to you and the way you have been treated. It’s appalling that the Archbishop has gone back on what he told me, before Xmas, that he was hoping to restore you to some form of Ministry in the Church.

I suspect you are absolutely right – it is due to fear of the media….If it is any consolation, the Archbishop has written me a letter (between you and me) in which it is also clear that he is frightened of the press – what he calls ‘public perception’, which in fact, perception of events and characters based entirely on lies, invention, speculation and sensation.

Dec 1995, Ball to Charles

The young man who accused me keeps on harassing. The last was a few weeks back with a fax, threatening to say more, when he has agreed not to and ending with the words ‘Your never forgiving rnbbrother in Christ’. That is both vile and blasphemous and oh that the police and CPS had seen and known from the beginning the nature of the young man. How I wish the Archbishop or someone would tell them.

April 1996, Ball to Charles

And I can honestly share the pain of it all having tried to break the crippling and unchristian powers of the ecclesiastical set up, and then being deserted in my hour of need.

June 1996, Charles to Ball

…I am so glad that [X] has been in touch as I requested. I pray the Duchy will be able to find something suitable for you both in due course, but it may take a little time to locate it! I long to see you both settled somewhere that suits you and gives you peace and tranquility – and not too far from here so you can come over more easily…

March 1997, Charles to Ball

[X] tells me that your house has been bought successfully – it looks rather nice – and I only hope the rent won’t be too bad!

I can’t bear it that the frightful, terrifying man is on the loose again and doing his worst… I was visiting the vicar… and we were enthusing about you and your brother and he then told me that he had heard that this ghastly man was up to his dastardly tricks again…. I’ll see off this horrid man if he tries anything again.

Aug 2001, Charles to Ball

I do however firmly believe that one day people will be forced to signing your resignation deed but, as you have been advised, I daresay that the establishment will close ranks and you will get nowhere. But how outrageous that now these people say sorry – and only in private….

Dec 2001, Charles to Ball

I saw [ ] the other day…he mentioned that you were thinking of going to the Archbishop and seemed a bit anxious about it… I daresay by now you will have approached the Archbishop but in your letter you so kindly asked me whether I had any objections – something which you certainly didn’t need to do.

The only thing I would say is that unless you really need to go to the Archbishop of Canterbury – for financial reasons particularly – I would have thought it might be better to let sleeping dogs lie…

Oct 2009, Ball to Charles

I am now nearly a broken man, because of what the Church has put me through after seventeen years of serving in retirement. They have smashed me with the bully of an assessor -…from a Child Protection Officer and no pastoral care, except two nice letters from the Archbishop. Suddenly, I am not allowed to baptise, or go to any parish without informing the Church Warden that I had a caution all those years back…

Ball included a letter that set out he was being risk assessed.

May 2010, Ball to Charles

…the horror that has come to me from the Bishop of Chichester with the Archbishop’s obvious hand in it. I have been told that I may not minister at all when we move, nor may I worship anywhere without signing a Declaration for the Protection of Children.

May 2012, Ball to Charles

Writes to say that the police are re-opening the investigation and are to question him. He says: ‘I thought it had been fully examined twenty years ago.’

July 2012, Ball to Charles

Life is ‘almost unbearable. I am being pursued and persecuted. In ways which it would not be discreet to enlarge on, though I am sure that you can guess their source and virulence’.

Dec 2012, Ball to Charles

Ball wrote to thank the Prince of Wales for phoning him, writing in the letter that the affair of twenty years ago had been ‘stirred up’ again by Lambeth.

‘It remains a source of deep personal regret that I was one of many who were deceived over a long period of time about the true nature of Mr Ball’s activities.’

He also said, in the six-page statement read by counsel to the inquiry Fiona Scolding, that he had not appreciated the meaning of the caution and that at the time the word of a bishop was generally seen as trustworthy.

He said he did not realise the truth of what had gone on until Ball’s conviction, adding that his main source of information until then had been the bishop himself.

Dismissing any suggestion he had ever tried to interfere in the police investigation into Ball, Charles said it was possible his name had been taken ‘in vain’.

In his statement, dated July 10 this year, Charles said: ‘At no stage did I ever seek to influence the outcome of either of the police investigations into Peter Ball and nor did I instruct or encourage my staff to do so.’

Ball, the former bishop of Lewes and Gloucester, is too ill to give evidence in person, the inquiry has heard.

But in a statement he referred to his relationship as having been one of ‘support and respect’.

Ball said: ‘I would strongly resist any suggestion that in some way I could bring pressure to bear on him to act on my behalf and have certainly never made a request for him to do so.’

On Monday the inquiry heard there had been lengthy discussions between Charles’s lawyers and the inquiry in which his legal team initially argued that the future king could not be compelled to produce a statement.

Clarence House has since said Charles was willing to help the inquiry and had voluntarily answered all questions asked of him.

Richard Scorer, a specialist abuse lawyer at Slater and Gordon who represents a number of Ball’s victims, said Charles’s explanation that he was not aware of the meaning of a caution left his clients ‘dissatisfied’.

He said: ‘Prince Charles had access to the best legal advice that money can buy and, as a man in his position, a particular responsibility to check the facts.

‘It is difficult to see his failure to do so as anything other than wilful blindness.

‘His evidence, together with that of Lord Carey, the then archbishop of Canterbury, and other establishment figures who have given evidence this week, will do little to dissuade survivors from the conclusion that the British establishment aided and protected Ball and even now have failed to give a transparent account of their actions.’

Charles said in the six-page letter dated July 10 this year that it was his ‘deep regret’ that he and others had been ‘misled’ by Ball.

Elsewhere in his evidence, Charles said Ball had been invited to his home to give holy communion a number of times, from 1993.

He said: ‘Peter Ball occasionally wrote to me in respect of private, often spiritual, matters.’

Referring to his knowledge of the complaint against Ball, he added that in the 1980s and 1990s there was ‘a presumption that people such as Bishops could be taken at their word and, as a result of the high office they held, were worthy of trust and confidence’.

He said at the time ‘there was on my part a presumption of good faith’.

The inquiry is examining how the Church of England handled allegations of sexual abuse and has previously focused on the Diocese of Chichester – where Ball and several other convicted paedophile priests once officiated.

Ball accepted a caution for one count of gross indecency in 1993 and resigned due to ill health.

Prince Charles’ full statement to the Independent Inquiry into Child Sexual Abuse

Dear Professor Jay

1. Thank you for inviting me to offer context on how I came to know former Bishop Peter Ball and on my dealings with him over the years, to assist your important Inquiry. I want to begin by applauding your work to ensure that the abuse of children is properly investigated and appropriate measures are taken to ensure they are fully protected. That is why I am pleased, on this occasion, to offer the following information, which I have set out to the best of my recollection after the passage of 25 years.

2. Over the years I have had, and continue to have, many interactions with the Clergy of the Church of England and of other Faiths, often on a daily basis. Set in that context, I first became aware of Peter Ball sometime during the 1980s, when I heard him preach. At that time, he came across as an interesting and engaging person. He was later appointed Bishop of Gloucester, in 1992. Since he had become my local Diocesan Bishop, near my home in Gloucestershire, I attended his Installation. He gave an impressive Address, which brought him to my attention again. At the same time I recall becoming aware of Michael Ball (Peter Ball’s brother) who was later appointed Bishop of Truro, to which I am also closely connected through the Duchy of Cornwall. Over the whole of my life, I have met countless senior Clergy who have been invited to preach and, on various occasions, I have myself invited them to give Holy Communion at my home. I extended such invitations to Peter Ball from time to time, starting in 1993.

3. As is well known, I maintain correspondence relationships with a great number of individuals. Peter Ball occasionally wrote to me in respect of private, often spiritual, matters. On each occasion I naturally replied as I believe that to be the polite thing to do, although there was often a significant delay on my part given other priorities which demanded my attention. My recollection is that these exchanges were normally instigated and driven by Peter Ball, in addition to a handful of telephone calls during the decades of our correspondence. Having refreshed my memory of our correspondence to try to help your Inquiry, I note this is borne out by the contents and dates of the letters in question.

4. With the significant passage of time, I cannot now recall with sufficient certainty when the following exchange took place and whether there was one particular conversation that concerned the reflections I offer below or more than one.

5. Peter Ball told me that he had been involved in some form of ‘indiscretion’, which prompted his resignation as my local Bishop at Gloucester. He emphasised that one individual, who I now understand to be Mr Neil Todd, had made a complaint to the Police; that the Police had investigated the matter; and that the Police and the Crown Prosecution Service had decided to take no action. This sequence of events seemed to support Mr Ball’s claim that the complaint emanated from a single individual; that the individual bore a grudge against him and was ‘persecuting’ him; that the complaint was false; but that the individual had nonetheless profited from the complaint by selling his story to the newspapers. The matter was described by him as ‘closed’. Peter Ball added that various people within the Church did not like him and had themselves used the complaint to curtail his ministry and force his resignation. When this exchange took place, I did not know about the nature of the complaint.

6. The true context and details of this complaint, and I now understand many others, against Peter Ball did not come to my attention until the time of Mr Ball’s trial and conviction in 2015. My main source of information before this was Mr Ball himself, though I should add that I was so fully occupied by my public role that Mr Ball’s situation was rarely at the front of my mind. As context, it seems important to say that in the 1980’s and 1990’s there was a presumption that people such as Bishops could be taken at their word and, as a result of the high office they held, were worthy of trust and confidence. That has changed over the years, as evidence has caused us all to be more challenging of what we hear and what we are told. But, at the time, there was on my part a presumption of good faith. I believe I was far from alone in taking this view.

7. I was certainly not aware at the time of the significance or impact of the caution that Peter Ball has accepted, or indeed sure if I was even told about it. Whilst I note that Peter Ball mentioned the word in a letter to me in October 2009, I was not aware until recently that a caution in fact carries an acceptance of guilt. I was aware that the Crown Prosecution Service had decided not to pursue a case against Mr Ball. This seemed to support Mr Ball’s defence of his position set out in his letter.

8. I recall that Peter Ball told me that following his resignation as Bishop of Gloucester he would lose the house in which he lived and that, as a consequence, both he and his brother Michael would become homeless. He told me that their monastic vows meant they had very little money. In this context, I occasionally sent the brothers small gifts of money, as I do for many people in need, and Pete Ball’s interest in becoming a tenant of a Duchy of Cornwall property then arose. A significant part of the Duchy’s business is in arranging and managing leases for properties and I mentioned the situation of the Ball brothers to the Duchy, as I do for others from time to time. The details of the eventual rental were handled, as usual, by Duchy staff. I was aware of the transaction but did not assist with the selection of the house. Some time later, in 1997, Peter and Michael Ball became tenants of a Duchy property until early in 2011, when they moved on.

Police investigations

9. At no stage did I ever seek to influence the outcome of either of the Police investigations into Peter Ball and nor did I instruct or encourage my staff to do so.

10. I understand from document ANG000021 that a member of Gloucestershire Police seems to recall that he ‘came under pressure’ in 1992 or 1993 which related in some way to some form of interest from myself and my staff in Peter Ball. This is untrue. Indeed, at the time of this Police investigation I had no knowledge of these particular matters. It follows, therefore, that I did not authorise – and could not have authorised – any such action. And nor would I have done.

11. Likewise, I have no recollection of any contact by one of my Personal Protection Officers or indeed any member of my staff with Gloucestershire Police. I was clear at the time, as I have remained clear, that the Police must be able to carry out their investigation in the proper manner without external pressure or influence. We have looked at our files and can find no record of any of these matters. It is always possible that my name was taken in vain, as can unfortunately happen from time to time. As I make clear elsewhere in this Statement, there is a gap between rumour and fact.

12. In a similar vein, I do not recall receiving a letter from Michael Ball in April 2013 as described by Detective Superintendent Carwyn Hughes (OHY000203). Having looked at our files we cannot find any record of such a letter. The occasional letters that I did receive from Michael Ball were of private and social nature and I am not aware of any interest from Sussex Police in this correspondence. Nevertheless, I have made available to you copies of the private correspondence received from Michael Ball, in case that could help your Inquiry in any way. I understand that a conversation took place between Sussex Police and the Metropolitan Police Royalty Protection team in 2013, and that Sussex Police informed the Metropolitan Police that they visited Peter Ball’s home and removed items which included a letter sent from me. I believe the Metropolitan Police asked whether or not this letter was relevant to the inquiry. I further understand that the Metropolitan Police emphasised clearly that they were not enquiring about the investigation itself and specifically wished to avoid any appearance of influence over it. They wished only to establish the facts about the property that had been removed and its correct ownership. The Metropolitan Police were told that the letter in question was not relevant and that it was to be returned by Sussex Police to Peter Ball.

The Church of England

13. Probably late in 1994 (although I cannot now be certain of the date) I recall seeing the then-Archbishop of Canterbury at an event and taking that opportunity to ask, among other issues, about Peter Ball as he had lately been my local Bishop. I remember the Archbishop was supportive of Peter Ball and thought him a good man and priest. I do not think we discussed any detail, though I recall that the Archbishop was perhaps thinking of ‘trying to bring [Peter Ball] back to a public ministry’ at some stage. I understood there were some complications, but these were not described. As this was clearly a matter for Church authorities, I took no personal position on it.

14. Other than this conversation with the then-Archbishop, I do not recall any specific conversations regarding Peter Ball, although I was aware that Mr Ball was himself keen to persuade the Church to ‘restore [him] to some form of Ministry in the Church’. The general view of members of the Clergy who occasionally mentioned him to me was that he was a capable and well-liked priest.

15. The Inquiry has asked about a note made by Andrew Purkis, of Lambeth Palace, following a lunch he had with my then-Private Secretary, Richard Aylard, on 30th August 1994 (ACE003034). My Private Secretary meets regularly with members of the Archbishop of Canterbury’s Office to discuss a range of matters. Having reviewed the document it is clear that the meeting took place in the normal course of business and was for the purpose of discussing matters other than Mr Ball. I cannot shed any light on what appears to be a brief mention of Mr Ball at the end of the meeting. I have no recollection of discussing the matter. I have also been shown a copy of my letter of 14th December 2001 addressed to Peter Ball. As far as I can recall, this letter conveyed that I could not assist Peter Ball in any approach he was thinking of making to the Archbishop to seek a return to public ministry. I recall Peter Ball repeating this request around this time and again some time later and my declining to assist. It follows therefore that I was not involved in ‘any discussion with Lambeth Palace’ on this matter.

Contact with Institutions

16. You have asked about contact between myself and institutions in respect of Peter Ball between 1993 and 2015. To the best of my knowledge and belief I have dealt with these contacts in the information I have volunteered above, and I can only hope this will be of some assistance to you.

17. I have been shown an extract from an interview conducted by the Chair of the Church of England’s Inquiry into Peter Ball last year, Dame Moira Gibb, with Elizabeth Hall of the Church of England, suggested there were some rumours of an interest from me in Peter Ball being given some alternative employment (INQ000682). I can confirm that this is untrue: not for the first time, and as the Gibb Inquiry concluded in respect of my contacts with Peter Ball over the years, there is a gap between rumour and fact. I did not seek any such roles for Mr Ball and did not ask others to do so on my behalf.

18. I regret that I am unable to shed any light on references made in a letter dated 23rd March 1997 to a ‘horrid man’ or a ‘frightful and terrifying man’. This seems to be a manner of speaking in the midst of a long letter written more than twenty years ago. I do recall that Peter Ball felt that numerous individuals, including his critics in the media, were doing all in their power to disadvantage him unfairly. I suspect, but cannot be certain, that the reference is to this issue in some way. It of course needs to be read in the context of my understanding at the time, namely that Peter Ball had been falsely accused of a single offence (the nature of which was unknown to me) by an individual whom the relevant judicial authorities and many others had themselves not believed. Events later demonstrated beyond any doubt, to my deep regret, that I, along with many others, had been misled and the reverse was true. At the time, however, it would have followed that people seeking to disadvantage Peter Ball, including from gaining employment, were behaving unfairly. What I can say with certainty is that I did not express this view to anyone else or take any action associated with it.

19. In conclusion, I would like to state that, throughout my life, my position has occasionally brought me into contact with prominent people who have subsequently been accused of serious wrong-doing. Rather than rushing to private judgement, I have always taken the view that the judicial process should take its course. I am then able to ground my opinions in facts tested by law, rather than hearsay. In many cases, including two very prominent cases of false accusation last year, this has proved a sensible course. It follows that I ceased contact with Mr Ball once the judicial process had concluded and he was found guilty of serious offences against young people. My heart goes out to the victims of abuse and I applaud their courage as they rebuild their lives and, so often, offer invaluable support to others who have suffered. It remains a source of deep personal regret that I was one of many who were deceived over a long period of time about the true nature of Mr Ball’s activities. That is why I wanted to volunteer the facts in this letter, which I believe to be true, in the hope that they might be able to help your important work.

Yours sincerely

DPA

Prayers at Highgrove and a friendship that lasted decades

By Sam Greenhill for The Daily Mail  

Peter Ball, who made his young victims roll in the snow naked before beating them until they bled, once described Prince Charles as a loyal friend.

The pair had prayed together at Highgrove and exchanged more than 50 letters, many of them deeply spiritual.

And even after his ‘indiscretion’ with a boy of 17, the bishop was given a Duchy of Cornwall house to live in, for which he thanked the ‘wonderfully kind’ prince.

Yesterday Charles expressed deep regret that he had ever put his faith in Ball, saying he had been horribly deceived by the paedophile bishop.

Charles said that in the 1980s, when he first knew him, and the 1990s, there was ‘a presumption that people such as bishops could be taken at their word’

It is now believed that sadistic Ball preyed on more than 100 boys and men in a 20-year reign of abuse.

Born in 1932, he went to Lancing College public school in West Sussex and Cambridge University before establishing a monastery in Gloucestershire with his twin brother, Michael.

Ball showed ‘favouritism’ to novice monks, and targeted schools to deliver sermons.

He was made Bishop of Lewes in 1977 and Bishop of Gloucester from 1992, during which time he handpicked 18 vulnerable victims to commit acts of ‘debasement’ in the name of religion.

He would pray naked with them at the altar and encourage them to submit to beatings. At least five more victims were schoolchildren.

As Bishop of Gloucester, Ball’s diocese covered Charles’s country home Highgrove, and the prince was among the guests at his enthronement.

By now, he was one of the church’s best known characters, refusing to wear the ceremonial purple of a bishop in favour of simple, monastic robes, sleeping on the floor and taking vows of celibacy.

Eight months after the enthronement, Ball was arrested. Yesterday the prince recalled: ‘Peter Ball told me he had been involved in some sort of “indiscretion” which prompted his resignation as my local bishop.’

In fact he had been horrifically abusing 16-year-old trainee monk Neil Todd, forcing him to perform sex acts as they lay naked in bed together, take ice-cold, early-morning showers while reading the Bible and stand side by side naked reciting psalms in front of a figure of Christ.

Mr Todd was so tormented he eventually committed suicide aged 38 in 2012.

In his letter to the Independent Inquiry into Child Sex Abuse, Charles said he was unaware of the true nature of the clergyman’s behaviour until more than 20 years after allegations first surfaced.

Ball got away with a police caution in March 1993 despite confessing his guilt. For his part, Charles said he had accepted Ball’s claim that Mr Todd had borne a grudge and made false allegations.

So Ball resumed his ministry, even officiating over communion at Highgrove.

He was also provided with Manor Lodge, a pretty cottage on Charles’s Duchy of Cornwall estate in the village of Aller, Somerset.

Clarence House has been at great pains to say it was the Duchy of Cornwall, the private estate which funds the heir to the throne, and not Charles himself that had purchased the lodge that Ball rented.

It subsequently emerged that police went easy on Ball in 1993 and cited his royal connections.

In documents unearthed by the BBC, retired police detective Wayne Murdock is said to have discussed with Ball’s legal team ‘the need to prevent a scandal, especially as Peter was a frequent visitor to Sandringham and is friendly with Prince Charles’.

It also emerged that the bishop’s lawyers had claimed to have a ‘letter of support from a member of the Royal Family’, who was not named. It is unclear whether this could be the same letter as the one that emerged yesterday.

Either way, no such letter was ever produced in any court hearings, and an official report found there was no evidence any royal had sought to intervene in the judicial process.

But the mother of the trainee monk was scathing about Prince Charles allowing Ball to live on his Duchy estate. Speaking in 1998, she said of the bishop: ‘He is pure evil, a beast, and he’s hiding behind God.

This is quite unbelievable. I don’t know what Prince Charles thinks he is doing.’

Yesterday Charles said he had always believed in allowing the judicial process to take its course ‘rather than rushing to private judgement’.

In 2006 Ball’s status in royal circles was confirmed in spectacular style when he was invited to read the homily at the funeral of the father of Camilla Parker Bowles.

He continued as a Church of England priest until 2010.

But justice was slowly catching up with him. Police re-opened their investigation in 2012 after new allegations, and this time a flood of Ball’s victims came forward.

If Charles was anxious, that might explain why in 2013 a royal aide contacted the chief constable of Sussex Police to ask whether information gathered during its investigation could ‘be embarrassing to Prince Charles or the monarchy in general’. Apparently they were reassured.

In 2015, Ball’s crimes were finally laid bare at the Old Bailey which heard shocking details of his reign of abuse. His trial heard he had been protected by ‘Cabinet ministers, the Royal Family, MPs, JPs and a lord’, not to mention the Church of England.

The Church has since expressed its ‘true sorrow’ at its shocking failures.

Ball, now 86, was released in February last year and lives a free man back in Aller, Somerset.

Clarence House was quick to insist last night that he is definitely not living in any of Charles’s properties.

http://www.dailymail.co.uk/news/article-5999031/Prince-Charles-reveals-Bishop-Ball-told-quit-job-indiscretion.html


Extracts from correspondence between Prince Charles and Peter Ball

Peter Ball to Prince Charles

8/12/95 “The young man who accused me keeps on harassing. The last few weeks back

Prince  Charles to Peter Ball

16/02/95 “I wish I could do more. I feel so desperately strongly about the monstrous wrongs that have been done to you and the way you have been treated. It’s appalling that the Archbishop has gone back on what he told me, before Xmas, that he was hoping to restore you to some form of Ministry in the Church. I suspect you are absolutely right- it is due to fear of the media…If it is any consolation, the Archbishop has written me a letter (between you and me) in which it is also clear that he is frightened of the press – what he calls “public perception” of events and characters based entirely on lies, invention, speculation and sensation.”

Prince Charles to Peter Ball

11/12/94  “I saw the Archbishop the other day and he told me he is trying to bring you back to a public ministry. I do hope this will be all right and suit you, if and when it happens…”

Peter Ball to Prince Charles

16/11/93 “Life continues to be pretty nasty for me for it seems that my accusers still want to continue their malicious campaign. Luckily they are beginning to show some of their fraudulent plans.”

https://www.iicsa.org.uk/key-documents/6147/view/ANG000334.pdf

In extracts of letters published today by the inquiry, the Prince told Ball his accuser was a “frightful, terrifying man” who was “up to his dastardly tricks again.”

The Prince adds in the letter to Ball in 1997: “I’ll see off this horrid man if he tries anything again.”

The Prince also accuses Lambeth Palace – the office of the Archbishop of Canterbury – of being “frightened of the press” for forcing Ball to resign his ministry.

In fact, it was clear it was Peter Ball – not his accuser – who was lying to the Prince.

No charges were brought, and he took his own life shortly before an investigation into sexual abuse allegations spanning some 30 years was reopened in 2012.

http://www.itv.com/news/2018-07-27/prince-charles-has-deep-personal-regret-for-contact-with-former-bishop-convicted-of-sex-offences-peter-ball/

Charles denies trying to influence inquiry into sex abuse bishop

27 July 2018

Prince Charles has denied that he tried to influence a police investigation into disgraced bishop Peter Ball.

In written evidence to a child sex abuse inquiry, the heir to the throne said claims by a former police officer that he “came under pressure” as a result of interest from himself were “untrue” and argued there was “a gap between rumour and fact”.

The Prince of Wales also revealed that following his resignation as bishop of Gloucester, he had sent Ball’s and his brother “small gifts of money” and also assisted them in getting one of his Duchy of Cornwall property’s.

He said: “It remains a source of deep personal regret that I was one of many who were deceived over a long period of time about the true nature of Mr Ball’s activities.”

The written statement from Charles was read out during the Independent Inquiry into Child Sexual Abuse (IICSA) investigation as it examines how allegations against the former Church of England bishop were handled.

Now 86, the former bishop of Lewes and then Gloucester was jailed for 32 months in October 2015 for sexually abusing 18 young men over 30 years. He was released in February last year after serving half his sentence behind bars.

https://news.sky.com/story/charles-denies-trying-to-influence-inquiry-into-sex-abuse-bishop-11451079

Lauren Alder Ⓥ‏@LaurenAlder

Imagine the fear and loathing at @ClarenceHouse – what happened to Butler-Sloss? Le Ponce was promised this would never happen…first Savile, now this..we need a D notice now….

Image result for "bishop ball" + "prince charles"

InquiryCSA ‏Verified account @InquiryCSA

Mr O’Donnell, from Slater and Gordon is making a final submission:

“Here is an abuser (Peter Ball) at the very heart of the establishment, he was selected by the executive and he had the judiciary, the legislature and the monarchy behind him.”

 

Mr. Nigel Giggin QC closing submission to the from the Archbishops Council:

“No one on the facts that were known at the time should have thought that Peter Ball could be described as, and I quote “a wonderful priest and bishop.”



We are now hearing a read statement from HRH The Prince of Wales.

 

I want to begin by applauding the your work to ensure the abuse of children is properly investigated and appropriate measures are taken to ensure they are protected.

Over the years I have had, and continue to have, many interactions with the clergy of the Church of England, and of other faiths, often on a daily basis.

I first became aware of Peter Ball in the 1980’s when I heard him preach. At that time, he came across as an interesting and engaging person

Peter Ball occasionally wrote to me in respect of private, often spiritual matters. On each occasion I naturally replied as I believe that to be the polite thing to do.

Peter Ball told me he had been involved in some form of ‘indiscretion’ which prompted his resignation as the Bishop of Gloucester. The matter was described by him as ‘closed’. When this exchange took place I did not know the nature of the complaint.

I was certainly not aware at the time of the significance or impact of the caution Peter Ball had accepted, or indeed sure if I was even told about it.

I occasionally send the brothers small gifts of money, as I do for many people in need, and Peter Ball’s interest in becoming a tenant of a Duchy of Cornwall property then arose.

Probably late in 1994, I recall seeing the then Archbishop and of Canterbury at an event, and taking the opportunity to ask, among other issues, about Peter Ball as he had lately been my local Bishop.

Other than this conversation, I do not recall any specific conversations regarding Peter Ball, although I was aware that Peter Ball himself was keen to persuade the church to restore him to some form of ministry in the church.

I remember the Archbishop was supportive of Peter Ball and thought him a good man and priest.

“In conclusion, I would like to state that, throughout my life, my position has occasionally brought me into contact with prominent people that have subsequently been accused of wrongdoing.

“Rather than rushing to public judgement I have always taken the view that the judicial process should take its course.

“It follows that I ceased contact with Peter Ball once the judicial process was completed and he was found guilty of serious offences against young people.”

“My heart goes out to the victims of abuse, and I applaud their courage as they rebuild their lives and, so often, offer invaluable support to others who have suffered.

“It remains a source of deep personal regret that I was one of the many who were deceived over a long period of time as to the true nature of Peter Ball’s activities.”

We are now hearing extracts from letters between HRH The Prince of Wales and Peter Ball. These extracts are available on our website.

InquiryCSA ‏Verified account @InquiryCSA

A letter is now being read which was sent from Lord Lloyd of Berwick to Mr Murdock: “He (Peter Ball) is the most upright, gentle and saintly man, I find it difficult to accept such an awful fate has befallen such a man.”

We are now hearing from Lord Berwick regarding a telephone call he made to Wayne Murdock, SIO in the Peter Ball case from Gloucestershire police.



Judge phoned officer during bishop Ball inquiry

A senior judge and close friend of a bishop accused of sex offences telephoned the detective handling the case in the middle of the police investigation, a public inquiry was told yesterday.

Lord Justice Lloyd, now Lord Lloyd of Berwick, an appeal court judge who became a law lord, called Wayne Murdock, then a detective inspector. “I said to him, ‘You do realise that I’m the investigating officer’,” Mr Murdock told the Independent Inquiry into Child Sexual Abuse (IICSA).

Mr Murdock also criticised Lord Carey of Clifton, the former Archbishop of Canterbury, for not passing letters from Peter Ball’s victims to the police and said a private investigator hired by the church came close to perverting the course of justice.

https://www.thetimes.co.uk/article/judge-phoned-officer-during-bishop-ball-inquiry-jxrkd9gd8


Ms Scolding is now discussing with Lord Berwick his support of Peter Ball returning to the church ministry. He thought it acceptable to go back to the ministry as he had resigned as a bishop and could not be left with nothing to do for the rest of his life.

Lord Berwick: 

“I got to know Ball Peter Ball very soon after he became Bishop of Lewes, because I wast hen the chairman of the Chichester Diocesan Board of Finance, and, accordingly, I would meet Peter Ball at meetings of the Bishops’ Council. But I got to know him well when he became our nearest neighbour in Berwick. He was a very remarkable – he had very remarkable gifts, spiritual gifts….I liked him very much. We then became very good friends, and we still are.”




If you were trying to provide a character reference…, why didn’t you simply write to Peter Ball’s solicitors and provide this information…Why did you think it was appropriate for you to directly write to the Chief Constable of Gloucestershire? …Because obviously it as written from you in your –saying …”I am Lord Justice Lloyd”, wasn’t it?

 The Archbishop of Canterbury agreed that Peter Ball should be given names letters of complaint about him. (Peter Ball)
It was very bad practice wasn’t it?

Nobody’s Friends

In 2018 the club was subject of a question in the IICSA hearing into abuse in the Church of England. Lord Lloyd had sent a letter of influence in the Peter Ball case to Archbishop Carey prefaced with the phrase “May I presume on a brief acquaintanceship at dinners of Nobody’s Friends?”[17] When asked about the club in his evidence to the Inquiry, Lord Lloyd described Nobody’s Friends as “simply a club, half consisting of the clergy, members of the clergy, and half consisting of members of the laity, which dine together probably twice a year, very often in Lambeth Palace.”

The IICSA counsel pointed out that the Daily Mail had once described it as “centred on a strong core of bishops, ex-Tory ministers and former military top brass, a highly secretive, all-male group representing Britain’s most entrenched professions and institutions.” Lord Lloyd replied, “That’s a typical Daily Mail description of something they don’t particularly like, but I can assure you that Nobody’s Friends is a perfectly ordinary dining club…” The same article that IICSA drew upon in the hearing indicated that Prime Minister Tony Blair had been keen to join the club in 2003.[18][19][20]

Stephen Parsons commented in an influential blog, following the IICSA hearing, that the forum Nobody’s Friends provided for influence in the Peter Ball case suggested a “toxic masculinity” in the Church of England. He went on to say:

A men-only dining club that meets regularly at Lambeth Palace, known as Nobody’s Friends, appears to be a gathering for socially very well-connected Anglicans. Although originally high church in its origins, the club provides an opportunity for a privileged church group to network and sometimes lobby those in authority in the Church …… The Nobody’s Friends dining group has been described as ‘private’ rather than a secret group, but it still represents an exclusive world of male privilege within the heart of the Anglican establishment. When Bishop John Bickersteth once revealed that his appointment to Bath and Wells followed his being ‘spotted’ at a Nobody’s dinner, we began to get the feeling that the values of our church may incline towards corporate and institutional interests rather than a personal morality based on the Sermon on the Mount.[21]

https://en.wikipedia.org/wiki/Nobody%27s_Friends



Tom Young‏@FULLY_BADASS
Looking back at his history, it appears Lord Lloyd of Berwick was Prince Charles’ attorney general at the same time Nicholas Soames was his equerry… Would they have worked together in any capacity?
Nicholas Soames:
I knew Harvey Proctor slightly. He had been in the House for four years when I was first elected in 1983. We were not political soulmates, but I was one of those Members of Parliament proud to rally around to help him to set up his shop in Richmond following his conviction in 1987, which resulted in his leaving the House.
The Aegis connection? Oh, and here’s the Wardrobe with the Little Key out canvassing in 1983 with Ted Heath, the man who would have been questioned under caution for the abuse of children.
Image result for "harvey proctor" + convicted

The Aegis connection? Nicholas Soames was always on hand to give the paedophile Harvey Proctor a leg-up in times of need:

Bud McFarlane relevant here… not only a director of Aegis Defence (like Soames & Boateng) also involved with Iran Contra (and it’s ties to ). Le Cercle Member too…
Dame Alun Roberts ‏ @ciabaudo

7/ Another Western Goals man, Robert McFarlane was involved in ContraGate and on the board of Aegis, Soames’ defence company. Soames (Wardrobe with Little Key) is of course a close friend of Denby mate Proctor and likely facilitated his St. (V)Ermin’s PR conference.


The Aegis connection? Chairman Soames and Princess Diana:

The Aegis connection? Another non-executive director of Aegis is Paul Boateng, a man with connections to paedophile John Carroll and the Angel Rd. children’s home.

 photo lloyd berwick_zps4696auao.jpg

Anthony John Leslie Lloyd, Baron Lloyd of Berwick, Kt, PC, DL (left) with Sir John Birch Director of Aegis

Image result for "prince charles" + "nicholas soames"

One of Prince Charles closest friends, Nicholas Soames is chairman of Aegis

Charles later admitted his adultery and Soames apologised. When questioned by the inquest into the death of Diana, Soames said that he saw his job as “to speak up for the Prince of Wales”, he denied threatening Diana, and warning her, “accidents happen” in the months before she died.[6]

The Aegis connection? Despite Bishop Ball’s seriously perverted character, Lloyd of Berwick still fawns over him:


In 1969 Lloyd was appointed Attorney-General to the Prince of Wales, serving until 1977.

He was made a Privy Counsellor

He held the office of Deputy Lieutenant (D.L.) of East Sussex in 1983.

He is a former member of the Court of Ecclesiastical Causes Reserved.[10] In 2005 he became chairman of the parliamentary Ecclesiastical Committee which examines draft measures presented to it by the Legislative Committee of the General Synod of the Church of England.[11]

https://en.wikipedia.org/wiki/Tony_Lloyd,_Baron_Lloyd_of_Berwick

 


InquiryCSA ‏Verified account @InquiryCSA
We are now hearing from Ms Kate Wood, the Safeguarding Consultant for the Diocese of Chichester and retired detective inspector looking at child sexual abuse and domestic abuse. She contacted the Church of England in 2007 to support investigations into child sexual abuse

In 2008/09 Ms Wood notes that Peter Ball did not have a risk assessment while he was working in Bath & Wells. She conducted a past cases review in 2009. She described a “disturbing pattern of behaviour” from Peter Ball.

Ms Wood raised concerns in 2008/09 that a 17 year old who was attending school, who Peter Ball to masturbate in front of him. The file notes said it was no offence, but it was an offence of gross indecency.

Ms Wood recalls asking Peter Ball what indecent assault is. He replied “oh yes, I did do that.” She then explained what gross indecency was. He again replied: “I did have an emmission.” Ms Wood was surprised that Peter Ball had admitted behaviour after years of denial.
The Inquiry is now hearing from Dame Moira Gibb. Last year, Ms Gibb published a report into the Church’s handling of the Peter Ball case:
Ms Scolding has asked Ms Gibb about the limits of her report into Peter Ball. She confirms that she had no difficulties in accessing information from the Church of England, however had difficulties with Northamptonshire Constabulary and Gloucestershire Constabulary.
Ms Scolding notes that former Archbishop of Canterbury, Lord Carey raised a number of concerns in his witness statement about conclusions in Dame GIbb’s report. In the report Ms Gibb noted degrees of cover up and collusion in relation to Peter Ball.
“Failure to pass the letters to the police (detailing allegations in relation to Peter Ball) must give rise to a perception of deliberate concealment.” Dame Moira Gibb tells the #AnglicanHearing
Dame Moira Gibb is now explaining why she used the word “careless” in her report. She notes carelessness in the attitude of the Church towards the victims of Peter Ball.

IICSA Day 4 Transcript

https://www.iicsa.org.uk/key-documents/6142/view/Public%20Hearing%20Transcript%2026%20July%202018.pdf

Rev Peter Ball and Prince Charles, in 1992

Prince Charles aide asked police if anything could ’embarrass’ him during inquiry into paedophile bishop

25 July 2018

An aide to the Prince of Wales contacted police in 2013 to ask about “embarrassing” material it may have collected during an investigation into a paedophile bishop, the independent child sex abuse inquiry has heard.

A member of the Prince’s staff contacted the chief constable of Sussex Police to ask whether information gathered during its investigation into Peter Ball, the former bishop of Lewes and of Gloucester, could “be embarassing to Prince Charles or the monarchy in general”.

Ball, now 86, was convicted in 2015 of misconduct in public office after admitting the sexual abuse of 18 young men.

According to the evidence of Detective Chief Inspector Carwyn Hughes, who worked on the investigation, the disgraced bishop had a “long-lasting friendship” with the Prince of Wales and the pair had exchanged several letters.

The contact was made after Peter Ball’s brother Michael Ball sent a letter to the Prince.

On Wednesday the officer told the inquiry he examined the police’s records to see if they had collected any material which could “damage the reputation of Prince Charles”, and did not find any.

Calling the contact “highly unusual” on account of the prince’s status, he said it prompted him to consider whether the prince could be a witness in the inquiry.

He insisted that Prince Charles was not treated differently from “the man on the street”, and that while he would have been notified if there was any relevant information, this would also have been the case for a member of the public.

“If there was evidence in the investigation that was of relevance to the person on the street, they would also be a potential witness,” he said, adding that he felt “no pressure” and did not feel the investigation had been influenced as a result of the contact.

The inquiry also heard that pre-charge publicity around Bishop Ball encouraged 12 victims to come forward to police.

The Inquiry is due to hear read evidence on Friday from the Prince of Wales, who maintained contact with the bishop after Ball was cautioned in 1993 for gross indecency.

He is expected to say in his statement that he did not know the caution involved an admission of guilt. 

On Wednesday morning the inquiry heard from Wayne Murdock, formerly of Gloucestershire Police, who had presided over the earlier inquiry, which ended with the caution.

Mr Murdock said that he believed the outcome of his investigation could have been different had then-Archbishop of Canterbury George Carey handed over letters sent to Lambeth Palace by victims and their families.

“He knew we were carrying out an investigation, and for some reason he withheld them,” he said.

On Tuesday Lord Carey admitted that the letters should have been handed over, but added that he had “assumed the police were investigating this thoroughly”. The inquiry continues.

https://www.telegraph.co.uk/news/2018/07/25/prince-charles-aide-asked-police-anything-could-embarrass-inquiry/

Donna Birrell‏@BBCDonnaB

Another extraordinary day @InquiryCSA we hear a former Bishop @DioTruro may have perverted the course of justice and that Prince Charles’ staff officer asked Sussex Police in 2013 if they had any embarrassing information about the Prince of Wales.(They said No.) @churchofengland

Peter Ball’s defence solicitor wrote to the Crown Prosecution Service saying he had received 1284 letters in support and to consider the impact of a prosecution on @churchofengland @InquiryCSA

Cassandra Cogno‏@CassandraCogno

Just like Dame Butler “we don’t want to give the press a bishop” Sloss

https://www.telegraph.co.uk/news/uknews/crime/10963332/Baroness-Butler-Sloss-hid-claims-of-bishops-sex-abuse.html

 

Wonder if Prince Charles had anything to do with these Butler Sloss appointments?
Butler Sloss- Cleveland Child Abuse Inquiry... Prince Charles’ friend & mentor, Sir Jimmy Savile had an interest in the Cleveland Inquiry
Butler Sloss – coroner for Diana Inquest
Butler Sloss – Bishop Ball investigation
Butler Sloss – first chair to IICSA

Janet Cope, Jimmy Savile’s secretary, showing his files – letter from Prince Charles next to a clipping about the Cleveland Inquiry



Dame Alun Roberts ‏ @ciabaudo
Now here’s a thought: Is the Sloshed Butler Royalty’s safe pair of hands when embarrassing material may emerge and a coverup is needed?
Given her past failures and her closeness to paedophiles, it was the incredible and shameful choice of Butler Sloss as first chair of which really took the biscuit though:
Butler Sloss was commissioned to look into abuse in the Diocese of Chicester. During that review she uttered the infamous words she didn’t want to ‘give the press a Bishop.’ The Bishop was Peter Ball.

According to the BBC, investigating officer Detective Inspector Wayne Murdock is said to have discussed with Ball’s legal team in the documents “the need to prevent a scandal in the press, especially as Peter was a frequent visitor to Sandringham and is friendly with Prince Charles”.

In a separate document released by Gloucestershire Police in response to an Freedom of Information request, Mr Murdock writes that after a meeting at Lambeth Palace, it was suggested that “any form of Church investigation instigated by the Archbishop of Canterbury would be ‘fairly low key and private’.”

He said the Church had displayed a “considerable amount of naivety” over the case as it took no action when advised in early September 1992 of “irregularities” concerning Ball.

Gloucestershire Police received messages of support for the former clergyman from MPs, former public school heads, JPs and a Lord Chief Justice, and Mr Murdock said: “According to defence sources they claim to have in excess of two thousand letters of support for Bishop Peter Ball, including letters from Cabinet ministers and Royal Family.”

https://www.telegraph.co.uk/news/religion/12171283/Cover-up-let-sex-abuse-bishop-escape-justice-victim-claims.html

InquiryCSA‏Verified account @InquiryCSA

InquiryCSA‏Verified account @InquiryCSA

Mr Hughes carried out an investigation into Lord Carey following the Peter Ball sentencing considering whether any legal action was to be taken as there were letters not disclosed to the police from Carey.

craftymuvva@craftymuvva

This should have made headline news this evening. I bet it didn’t:

 

Ms McNeill is now asking whether it was unusual to receive a call from the Prince of Wales office regarding Operation Dunhill. Mr Hughes has confirmed that it was indeed unusual for this call to have been made.


Operation Dunhill began as a direct result of the safeguarding officer at Lambeth Palace raising concerns about Peter Ball following a church initiated review of files.

https://www.thinkinganglicans.org.uk/7087-2/

A man who was 12 when he alleges he was abused by the former bishop of Lewes was among those who came forward, according to a spokesman for Sussex police’s Operation Dunhill

https://www.theguardian.com/uk/2012/nov/15/police-further-complaints-retired-bishop

Mr Hughes on the delay of the CPS decision on charges of Peter Ball: “There was a growing theory that there had been some sort of establishment cover up.”

We are now looking at a case conference with the CPS, where Mr Hughes was made aware of a letter sent to Peter Ball regarding his police cautions.

Mr Hughes: “As far as I was concerned, this was highly unusual.”
It gave Mr Hughes little time to speak to complainants before a press conference was to be held. Mr Hughes confirms it would be useful for the CPS to give more time to notify victims before issuing details to the press.
Mr Hughes on discussing two complainants in the Peter Ball case. “I can see from their prospective that they did not get justice in this case.”
Mr Hughes has now indicated that new complainants came forward following the media coverage of Peter Ball’s sentencing. It was considered that it was not in the public interest to pursue these cases, as Peter Ball has recently been incarcerated.
Sean O’Neill‏ @TimesONeil
In the light of Cliff Richard judgment: senior detective says pre-charge publicity around Bishop Peter Ball encouraged 12 victims to come forward to police
InquiryCSA‏Verified account @InquiryCSA
Mr Hughes carried out an investigation into Lord Carey following the Peter Ball sentencing considering whether any legal action was to be taken as there were letters not disclosed to the police from Carey.
Mr Hughes concluded that there was no legal action to take against Lord Carey. He found that there was gross misconduct at that time at Lambeth Palace but considered that it did not cross any threshold for criminal proceedings.
We are now hearing read evidence on behalf of Ian David Stafford Beer CBE.
Mr Beer: “He first met Peter Ball through his mother in law. The Ball twins created the society of the Glorious Ascension.”
Peter Ball claimed to Mr Beer that he had been given a letter by the then Archbishop of Canterbury giving permission to officiate anywhere in the UK, however, the Bishop of Gloucestershire declined to give permission for Peter Ball to officiate the wedding of his son

 Inquiry counsel Fiona Scolding QC is hearing evidence from Mr Wayne Murdock, formerly of Gloucestershire Police

Mr Murdock states that it’s not true to say that he would cease the investigation if Peter Ball would accept a caution. These matters needed proper investigation. ‘I wouldn’t cut corners’

Mr Murdock, when showed notes from PB’s solicitors on meeting – that he would supply them with notes of the investigation – said ‘Rubbish … I would be knocking on the door of perverting the course of justice, and I would not do that’ – watch live:

Mr Murdoch: ‘I made it clear [at the meeting with PB’s legal team] that I would report back to the DPP, the offer of the caution, and I clearly made no promises… I certainly did not recommend a caution.

Mr Murdock wrote a 633 page report to the Crown Prosecution Service which contained all witness statements and at the end, Mr Murdock, as SIO could give his views, opinions and summarise what he believed what offences should be charged.

Mr Murdock’s report recommended the DPP considers charges of gross indecency and indecent assault. and also wish to consider additional offences which resulted from the police investigation – Offences under section 18 of offences against the person ACT (sec 18 is GBH)

FSQC – You say in your report that you invite the CPS to consider that Peter Ball has been less than truthful [in his evidence] – and has been quite calculating in the manner in which he presents himself.

FSQC: You also flag to the CPS that the reputation of the Church would suffer if PB was prosecuted-that didn’t really matter did it? Mr Murdock: It’s my job to point out the risks to the CPS the decision lies with them whether or not to prosecute.


Credne’s Cod Peace ‏ @CrednesCodPeace

It’s quite strange that one of the best mate’s with many paedophiles including Jimmy Saville is allowed to get away without giving verbal evidence or being cross examined. Long live the monarchy, we like our feudal lords & masters.

 

Prince Charles tried to keep links to paedophile bishop Peter Ball private

July 24 2018

Prince Charles argued that information about his connection with Bishop Peter Ball was “private and confidential”

Prince Charles argued that information about his connection with Bishop Peter Ball was “private and confidential”

The Prince of Wales staged a lengthy legal fight against demands from a public inquiry for him to provide evidence about his long friendship with a paedophile Anglican bishop, it has emerged.

Lawyers for Prince Charles protested that requests for evidence from the child abuse inquiry about his connection with Bishop Peter Ball were beyond its powers, unfair and a breach of the prince’s human rights by seeking to obtain “intensely private and confidential” material.

Alexis Jay, chairwoman of the Independent Inquiry into Child Sexual Abuse (IICSA), issued a statutory notice requiring the prince to provide evidence but met continued resistance from Clarence House.

When the prince’s evidence was submitted last week the inquiry was surprised that it came in the form of a letter to Professor Jay rather than a formal witness statement “finalised with a statement of truth and signed”.

Richard Scorer, solicitor for six of Ball’s victims, told an inquiry hearing that the prince’s refusal to provide a statement in the usual way “will feed concerns that the letter is less than entirely frank about his relationship with Peter Ball”.

The Times revealed last week that the prince’s draft evidence admitted that he maintained a friendship with Ball, 86, former Anglican Bishop of Gloucester, for more than 20 years after the cleric accepted a police caution for gross indecency in 1993.

The prince invited Ball to his Highgrove home and to royal occasions, gave him “small gifts of money” after he was forced to resign his ministry and helped to arrange a Duchy of Cornwall house for him to live in.

His evidence said he did not understand that a criminal caution involved an admission of guilt and did not cut contact with Ball until he was convicted and jailed at the Old Bailey in 2015. The prince expressed “deep personal regret” that he had been deceived by the bishop.

The investigation of the Ball case is part of the IICSA’s wider inquiry into the handling of child abuse cases by the Church of England.

The inquiry counsel Fiona Scolding, QC, said the IICSA had heard from 32 men who were victims of grooming, abuse and sexual exploitation by the bishop when they were teenage boys or young adults.

At the time of the initial police inquiry into Ball in 1992-93, police and prosecutors received 24 letters from prominent figures — including senior clergy, MPs, an appeal court judge and public school headmasters — lobbying on his behalf.

Ball exploited his royal and establishment connections in a voluminous letter-writing campaign in which he pressed, with success, for his return to Church duties. He was given permission to officiate at services and between 1996 and 2002 preached at 25 schools.

William Chapman, counsel for some of Ball’s victims, said the cleric had been able to “call upon the willing assistance of the establishment — including the heir to the throne”.

He told Professor Jay and the inquiry panel: “These establishment helpers claim they were duped by Peter Ball. You will have to consider whether that is credible — given what they must have known or could easily have found out about Peter Ball. Prince Charles has many advisers, he only had to ask what a ‘caution’ meant.”

Mr Scorer also argued that the prince could have inquired about the accurate legal position concerning Ball. “Prince Charles apparently decided not to seek clarification of the legal position. To my clients, this extraordinary lack of curiosity looks like wilful blindness,” he said.

Ms Scolding said that the format of the prince’s eventual evidence “was not what had been requested” but the IICSA was satisfied that it did answer the questions put to Prince Charles.

She said: “The last sentence of the letter does make clear that the material set out within it is true. The inquiry considered that this complies with the requirements of a statement of truth and that the letter received contained all the evidence required.”

Ms Scolding said the inquiry had withdrawn the statutory demand for the prince to provide evidence and had “adjusted its requests in some respects”. She added, however, that the IICSA “did not resile from its demands the need to obtain this evidence or accept the contention that the prince should be treated in a way that was different from any other witness”.

The prince’s evidence will be read at the inquiry on Friday but he will not be called to answer questions.

A Clarence House spokesman said: “The prince made it clear that he was willing to help the inquiry and voluntarily answered all the questions asked in the form of ‘free flowing text’ as requested by the inquiry itself. The final submission includes a statement of truth in common with all witness statements.

“The legal exchanges, which have been extensively referred to by the inquiry’s solicitors, were necessary to ensure clarity regarding both the structure, relevance and content of the statement. Once resolved, the inquiry raised no objection to the format of the prince’s submission.”

Lord Carey to face questions
Lord Carey of Clifton, the former Archbishop of Canterbury, faces intensive public questioning today about his handling of the case of the disgraced bishop Peter Ball.

Lord Carey, 82, will appear at the child abuse public inquiry to explain why he wrote to senior police and prosecutors in support of Ball when the Bishop of Gloucester as he was then was under criminal investigation in 1993. When he was lobbying on Ball’s behalf, the former archbishop was aware that Lambeth Palace had received further allegations of sexual misconduct against Ball. Only one letter was passed to the police.

The peer will also be asked to explain why he tried to rehabilitate Ball after his criminal caution by giving him permission to conduct church services.

The inquiry was told yesterday that in 2014 Lord Carey again wrote to officers claiming that the bishop had “served the church with great distinction”.

https://www.thetimes.co.uk/article/prince-charles-tried-to-keep-links-to-paedophile-bishop-peter-ball-private-q78xhscnr

InquiryCSA‏Verified account @InquiryCSA

Ms Scolding QC asks do you think it was appropriate to give a bishop who had been found guilty of gross indecency discretionary funds? At the time we felt that Peter Ball needed help, after careful scrutiny of his finances Lord Carey responds.

A letter from Peter Ball to Lord Carey in 1994 he asks for £10,000 to help with legal funds. In the letter, Peter Ball describes allegations as a “little nuisance”.

Ms Scolding QC asks do you think it was appropriate to give a bishop who had been found guilty of gross indecency discretionary funds? At the time we felt that Peter Ball needed help, after careful scrutiny of his finances Lord Carey responds.

Ms Scolding QC asks Lord Carey why Peter Ball was allowed to attend Stowe School and Radley College in 1996/97. He says he thought there would be proper supervision. Ms Scolding also notes there is no evidence schools were warned about Ball’s previous behaviour.

Daisy Law‏@theDaisyLaw

What, like the supervision which the church undertook by their conspiracy to cover up his crimes against children? Carey is looking like a fellow poacher rather than a gamekeeper trying to protect the flock. Corruption & shady networking are phrases which come to mind.

alun:

Surely I-Don’t-Carey must have been aware of this:

@craftymuvva

For a man that wrote numerous letters proffering his opinions on political matters to the PM (this proving his continued interest and knowledge of current affairs), Charlie is certainly very selective about what he knew…

 

Linda Woodhead‏ @LindaWoodhead

IICSA … on the Peter Ball scandal: hears of the extraordinary lengths to which Prince Charles’s lawyers went to wiggle out of complying with IICSA’s request that the Prince give a witness statement to the Inquiry like everyone else. Even invoking European convention HRights!

William Chapman, counsel for survivors : “Were they really as ignorant as they claimed about the nature of Peter Ball’s activities? Prince Charles has many advisers, he only had to ask. So did the Archbishop of Canterbury.”

Under current procedures Peter Ball is still able to call himself, Bishop, with the title, Right Reverend”


Prince Charles refused to give formal statement to sex abuse inquiry

23 July 2018

Prince Charles refused to provide a formal witness statement to the child sex abuse inquiry, lawyers told a hearing on Monday.

The inquiry is currently hearing evidence relating to abuse carried out by Peter Ball, the former bishop of Lewes and of Gloucester, who knew the prince and exchanged letters with him.

Lawyers for the Prince of Wales used human rights law to object to block efforts to compel him to send a witness statement in the format used by the inquiry, instead sending a signed letter.

Fiona Scolding, lead counsel to the investigation into the Anglican church, said that his lawyers had previously argued that compelling him to give evidence was outside its powers.

Ball was convicted in 2015 of misconduct in public office after admitting abusing 18 teenagers and young men between the 1970s and 1990s.

His abuse had first been reported to the church in 1992, but police and CPS decided to give him a caution, and he was stripped of his role as bishop.

He was later allowed to officiate at events including at schools and confirmations.

Ms Scolding said there would have been “no doubt” about what the inquiry’s lawyers were asking for, as they sent a template for the document and used the word “statement” five times in one letter asking for the document to be signed.

“Despite lengthy correspondence, including assertions from the Prince’s solicitors that the Inquiry’s requests for evidence were outside its powers, i.e. ‘ultra vires’, there was never any suggestion at any point that the statement would be provided by letter,” she said.

The inquiry made several attempts to compel the lawyers to provide a witness statement with a formal statement of truth, which is essentially equivalent to swearing on oath.

The prince’s law firm Harbottle & Lewis also tried to argue that asking for a witness statement was “unfair”, and constituted a request for “intensely private and confidential” personal data.

Following “lengthy and extensive correspondence” an agreement was reached and the inquiry has decided to treat the letter, which ends with a sentence saying that its contents are true, as equivalent to a witness statement, she said.

The Prince will not give evidence in person but will have the statement read out at the hearing on Friday.

Earlier in the hearing Richard Scorer, of law firm Slater and Gordon, who is representing victims and survivors, expressed “surprise and concern” at the decision.

“This will inevitably raise concerns that the letter may be less than entirely frank about his relationship with Peter Ball and that it contains matters to which he s reluctant to attach a formal statement of truth,” he said.

The prince’s statement is expected to say that he was “not aware at the time of the significance or impact of the caution that Peter Ball had accepted”, including the fact that a caution involves admission of guilt.

On Tuesday the Inquiry is expected to hear evidence in person from former Archbishop of Canterbury Lord Carey, who was found in an independent inquiry last year to be among senior church figures who “colluded” with Peter Ball.

Earlier in the day the inquiry heard that the church was dealing with a “turbulent” period in 1992, with Lord Carey raising the “constitutional crisis” caused by the Prince’s split with Diana, Princess of Wales, as well as the decision to allow women to be priests.

William Chapman, a lawyer from Switalskis, also representing victims and survivors, told the inquiry that there had been concern that gay clergymen would be outed by a full criminal investigation, ending their career in the church.

A Clarence House spokesman said: “The prince made it clear that he was willing to help the Inquiry and voluntarily answered all the questions asked in the form of ‘free flowing text’ as requested by the Inquiry itself.

“The final submission includes a statement of truth in common with all witness statements.  The legal exchanges, which have been extensively referred to by the Inquiry’s solicitors, were necessary to ensure clarity regarding both the structure, relevance and content of the statement.

“Once resolved, the Inquiry raised no objection to the format of the prince’s submission.”

https://www.telegraph.co.uk/news/2018/07/23/prince-charles-refused-give-formal-statement-sex-abuse-inquiry/

Elizabeth Butler Sloss, 1st IICSA chair, member of the establishment protected Bishop Peter Ball

Image result for "butler sloss" + "prince andrew"

Image result for "butler sloss" + "prince andrew"

Establishment ‘rallied to help ex-bishop later jailed for abuse’

Prince Charles and Lord Carey among powerful backers of Peter Ball, abuse inquiry told

23 July 2018

Members of the establishment, including the heir to the throne, the then archbishop of Canterbury and a senior member of the judiciary, rallied to the support of Peter Ball, a Church of England bishop accused of sexual abuse, an independent inquiry has heard.

“The story of Peter Ball is the story of the establishment at work in modern times,” said William Chapman, representing survivors. “It is the story of how the establishment minimised the nature of Peter Ball’s misdeeds … and silenced and harassed those who tried to complain.”

One survivor told the inquiry the C of E’s response to his disclosure of abuse amounted to “enduringly cruel and sadistic treatment”.

The independent inquiry into child sexual abuse is examining how the church handled allegations. A five-day hearing this week is scrutinising the church’s response to claims of sexual abuse against Ball, a former bishop of Lewes and then Gloucester, who was jailed in 2015.

Ball was able to call upon the “willing assistance of members of the establishment”, said Chapman. “It included the heir to the throne, the archbishop and a senior member of the judiciary, to name only the most prominent.”

Between them, they provided Ball with money and accommodation, legal advice, a private detective, references and approaches to the police and the prosecuting authorities.

“The alacrity and the extent of the response by Peter Ball’s friends to one of their own in trouble was impressive. It makes a horrible contrast to the way Peter Ball’s victims were treated,” Chapman said.

He told the inquiry: “These establishment helpers claim they were duped by Peter Ball … But you will have to consider if it is credible, given what they must have known or could easily have found out about Peter Ball, whether they were really as ignorant as they claimed they were about the nature of Peter Ball’s activities.

“Some claimed they did not know what a caution meant. Well, Prince Charles has many advisers; he only had to ask. So does the archbishop of Canterbury.”

Ball’s friends were willing to “add their weight” against the due criminal process. “They went far beyond the normal obligations of friendship.”

Allegations were first made against Ball in 1992, but he accepted a police caution and resigned his position as bishop. An independent review of the case commissioned by the C of E and published last year found evidence of collusion and a cover-up at the highest levels.

Richard Scorer, also representing survivors, said that Ball found in his fellow bishops the “perfect accomplices, prepared to turn a blind eye to his abuse over many decades”.

None bore greater responsibility than Lord Carey, the former archbishop of Canterbury, Scorer said. “We fear that when we hear from him this week, the usual litany of excuses will be trotted out,” he said, adding that Carey must give a “transparent account of his actions”.

Prince Charles’s assertion that he did not understand the significance of a caution was “frankly astonishing”, he said. The prince has access to “the best legal advice that money can buy,” Scorer added.

The prince chose not to clarify the legal position. “To my clients, this extraordinary lack of curiosity looks like wilful blindness,” he said.

In her opening statement, Fiona Scolding, senior counsel to the inquiry, said that Ball’s “fall from grace was a huge shock to the church”.

She added: “He was a very senior clergyman with enormous spiritual authority. He also had power and charm.”

People inside and outside the church had attested to Ball’s charisma and oratorical brilliance. She said that power had been “further enhanced by his cultivation of influential friends both within and outside the church”.

As an example, Ball had told people after his arrest that four cabinet ministers had offered him a “bolthole from the press”.

“He did not stint from mentioning those friends in prominent places when he thought it would assist his cause,” Scolding added.

She told the hearing of a scheme set up by Ball for young men interested in religious life that gave him the opportunity to groom them for sexual abuse and exploitation. The men were encouraged to pray naked, and engage in massage and spanking. One, Neil Todd, who first made allegations against Ball, killed himself in 2012.

Scolding said that Ball, now 86, was too unwell to give evidence either at the inquiry or by video link. But in one of two statements he had submitted he made an apology and said he had “neither been open nor shown penitence in the past”.

The hearing heard from three survivors who described their abuse by Ball. One, the Rev Graham Sawyer, who has waived his right to anonymity, said: “The sexual abuse that was perpetrated on me by bishop Peter Ball pales into insignificance when compared to the enduringly cruel and sadistic treatment that has been meted out to me by officials, both lay and ordained, in the Church of England.”

He described the culture within Anglicanism as an “ecclesiastic protection racket – and anyone who seeks in any way to threaten the reputation of the church and institution has to be destroyed”.

Safeguarding should be taken out of the church’s hands he said, as “it cannot police itself with any credibility”.

At the start of proceedings, Alexis Jay, the chair of the inquiry, said she had ordered an investigation into the leaking to the media of the Prince of Wales’s letter.

She said the leak was a “very serious breach of confidence by someone with direct access to information in this investigation” and promised “firm action” should the source be uncovered.

Scolding said a suggestion reported by the Times that the timing of the statement, to be read on the final day of this week’s hearings, was to prevent the prince being called for cross-examination “could not be further from the truth”.

She said: “There is no requirement for him to attend in person as his evidence, whilst important, is not of central relevance to many of the issues raised by this case study.”

The hearing continues.

https://www.theguardian.com/uk-news/2018/jul/23/establishment-rallied-to-help-ex-bishop-later-jailed-for-abuse

Former Archbishop of Canterbury Lord Carey admits ‘fobbing off’ sex abuse victims

July 24 2018

A former Archbishop of Canterbury has admitted “fobbing off” victims of sex abuse who complained about a paedophile bishop.

Lord Carey of Clifton said Lambeth Palace failed to deal properly with letters sent by victims and their families after the arrest of Peter Ball in December 1992.

Ball, then the bishop of Gloucester, was arrested following disclosures by Neil Todd, who had been a pupil on his scheme for young men considering a monastic life, that Ball had sexually abused him.

Lord Carey also admitted that the church had “mishandled” the case, after the inquiry heard evidence that many of the letters had received holding responses and victims had been forced to follow up to gain a proper reply.

“We have been fobbing people off. They should have had direct replies. We should have carried on our enquiries and dealt with it in a much more serious and adult manner than we did,” he admitted.

The inquiry also heard that a “personal message” from the former Archbishop had been sent to the diocese of Gloucester in January 1993, several weeks after the allegations had been received, expressing a hope that the ongoing police enquiry would “clear his [Ball’s] name”.

He also wrote to the chief constable of Gloucestershire and the director of public prosecutions in 1993 on Ball’s behalf after the bishop’s psychiatrist told him that he was suicidal, and wrote to Ball himself telling him “you are in my prayers”.

Lord Carey, who was Archbishop of Canterbury between 1991 and 2002, oversaw Ball’s return to ministry and the payment of thousands of pounds to the bishop, including money for holidays, which came from his own discretionary funds, used to support church leaders in need.

The inquiry also heard that Ball was given the role as Bishop of Gloucester in 1992 after then-appointments secretary to the Prime Minister Sir Robin Catford wrote a glowing letter recommending him, including mentioning that he was a “squash blue” at Cambridge and that he had a “quite extraordinary sparkling personality” and was “loved and revered by everyone who crossed his path”.

https://www.telegraph.co.uk/news/2018/07/24/former-archbishop-admits-fobbing-sex-abuse-victims/?WT.mc_id=tmg_share_tw


Donna Birrell‏ @BBCDonnaB

Powerful evidence by Rev Graham Sawyer, victim of Peter Ball : “ It is an ecclesiastical protection racket… anyone who threatens the reputation of the Church has to be destroyed. That is the culture within Anglicanism.”


Ball was able to call upon the “willing assistance of members of the establishment”… it included Prince Charles, the archbishop and a senior member of the judiciary…they provided Ball with money and accommodation, legal advice, a private detective, references and approaches to the police and the prosecuting authorities.


Peter Ball (right) and his twin brother Michael Ball, pictured in 1989

Bishops were ‘perfect accomplices’ for ‘nauseating’ Peter Ball, IICSA hears

23 July 2018

PETER BALL found the “perfect cover” for his sex-offending in the Church of England, and the “perfect accomplices” in fellow bishops who turned a blind eye to his actions, the Independent Inquiry into Child Sex Abuse (IICSA) has heard.

The details of the abuse carried out against vulnerable adults by Mr Ball, the disgraced former Bishop of Gloucester, during his ministry were heard on Monday at the start of a week-long hearing being conducted by IICSA, as part of its investigation into the extent to which the Anglican Church failed to protect children from child sex abuse.

The first hearing, in March, used the diocese of Chichester as a case study (News, 9 March). This week is to focus on the repeated failures of the police, Crown Prosecution Service, and the Church to identify, prevent, and prosecute abuse carried out by Ball over several decades, the lead counsel to the Anglican investigation, Fiona Scolding QC explained.

Ball received a three-year sentence in 2015, having admitted to a series of indecent assaults and the abuse of 18 young men aged 17-25 (News, 7 October 2015).

The offences included praying naked with vulnerable young people who had joined the monastic-community scheme Give a Year to God, which Ball had founded and run in Littlington, East Sussex, in the 1980s, when he was Bishop of Lewes.

Summarising the evidence received by the Inquiry, which included more than 100,000 documents, Ms Scolding said that Ball had admitted to being naked with, caressing, anointing, and physically assaulting young men, who would sleep in his house, sometimes in his bed, and with whom he would prayer naked, embrace, and masturbate. The victims were told that these practices were an expression of humiliation, penitence, and devotion to Christ.

One of his victims was the late Neil Todd, who was repeatedly abused during the 1980s and ’90s, and who later took his own life. His allegations brought about the police investigation in 1993, which resulted in Ball accepting a police caution, thereby admitting his guilt.

Ms Scolding also quoted several senior clerics who had held Ball in high esteem, most of whom had “flooded to defend him” after the police investigation and, latterly, his conviction. It had become clear in the Chichester hearing that abusers were required to “manipulate and charm” everyone around them, not just their victims, she said.

Among his defenders was Michael Ball, his twin brother and a former Bishop of Truro, who repeatedly urged Lambeth Palace to restore Peter Ball to ministry during the 2000s in what has been described in evidence as “manipulative” campaign which drew on connections with senior figures, including the Prince of Wales.

A lawyer representing six survivors of Ball, Richard Scorer QC, said that in the Church Ball had found the “perfect cover” for his offending.

“If a charlatan with an insatiable appetite for abuse wanted to secure a continuous supply of vulnerable young victims, there was no better way of achieving this than by founding a religious order not subject to any external supervision, and by making his victims participation in the abuse a religious duty obligated by their oath of absolute obedience.

“Not for the first time, theology and religious ritual provided the ideal mask for abuse, with the evil of what Peter Ball did being compounded by his nauseating claim that the abuse was spiritually uplifting.

“Most of all, however, Peter Ball found in his fellow bishops in the Church of England the perfect accomplices, prepared to turn a blind eye to his abuse over many decades, to collude in the lie that the abuse of Neil Todd was an uncharacteristic aberration, to cast doubt on his guilt, to smear his victims, and to rehabilitate him.”

Mr Scorer also criticised Prince Charles for not making efforts to check the position of Ball in 1993, after the bishop accepted a caution. “This extraordinary lack of curiosity looks like wilful blindness. . . He failed in that responsibility and therefore failed the victims.”

At the start of the hearing, the chair of the Inquiry, Professor Alexis Jay, expressed her disappointment at the “serious breach of confidence” after the content of a draft witness statement of Prince Charles was leaked to the press last week (News, 13 July).

The statement from Prince Charles had been disclosed to core participants on 9 July, Professor Jay said. “The panel is disappointed by the leaking of the draft statement. Deliberate leaking of information to the media before evidence is made public by the Inquiry not only undermines the ability of the Inquiry to get to the truth, but can also erode confidence in the Inquiry at all levels.”

https://www.churchtimes.co.uk/articles/2018/27-july/news/uk/bishops-were-perfect-accomplices-for-nauseating-peter-ball-iicsa-hears

Peter Ball preached at over 25 schools between 1996 and 2002.

https://www.iicsa.org.uk/key-documents/5977/view/23%20July%202018%20Anglican%20Public%20Hearing%20Transcript.pdf

Sussex police documents, released under an Freedom of Information (FOI) request, indicate Ball associated with other sex offenders in the clergy and that he was investigated in 2008 for being part of a suspected paedophile ring.

https://www.bbc.com/news/uk-england-sussex-36767415

The police files also suggest Ball covered for and helped other priests accused of sex abuse, including:

http://www.bbc.com/news/uk-england-sussex-36767415

 


Norma Moore‏ @Mousehole1

According to evidence given to iiCSA today, Peter Ball would spend an hour each day praying in the nude… next to an open window. He also watched young clergy take cold showers each morning.
InquiryCSA@InquiryCSA
Rev’d Graham Sawyer: Let me make this clear – the sexual abuse that I suffered at the hands of Peter Ball, pales into insignificance when compared to the cruel/sadistic nature metered out to me

Esther Baker‏ @Esther9982

I do wonder if the lawyers acting for the CP’s ought to challenge the lawyers running the on the basis that they are now accepting the accused (and their reps) words rather than truth seeking as their powers allow?

Recent examples of this would be a) allowing royalty to not give pertinent evidence because he’s royalty. B) inaccurately issuing a statement that I am under investigation for PCJ, and only removing it at the insistence of the police – because an ex-MP said it so it must be true

Peter Ball was a governor of both Lancing College but also the wider Woodard Group, which is a group of Anglican boarding schools

Peter Ball appointed to the Anglican Scouting Fellowship

In January 1996 Lord Carey agreed that Ball should be permitted to preach at a public school, provided that the school were made aware of possible hostile press interest. He further agreed in March that Ball could conduct confirmations and preach at two more schools. Ball was still the President of the Anglican Fellowship in Scouting and Guiding 17 and the Archbishop agreed that he could attend their Annual General Meeting and celebrate the Eucharist at their headquarters in Gilwell

In the late 1970s and early 1980s, Peter Ball developed a scheme called “Give a year to God”. He set this up informally with the approval of Bishop Kemp.

https://www.iicsa.org.uk/key-documents/5977/view/23%20July%202018%20Anglican%20Public%20Hearing%20Transcript.pdf

The Anglican Fellowship in Scouting and Guiding was formed in 1983. It is not clear when Ball’s involvement with the Fellowship came to an end. The Scout Association has advised that Ball was also
appointed to a subcommittee of the Association’s Board in 1983.

Archbishop George Carey had Robert Alston on his staff from 1999-2002.

Image result for "robert alston" + "richard alston"

Richard Alston (left) and brother Robert Alston

Robert Alston’s brother is Richard Alston  (convicted child rapist)

Image result for "robert alston" + "richard alston"

Richard Alston’s partner was PIE leader Peter Righton

1992

At the time of eter Ball’s caution:

1990-94 Peter Ball Chaplain at Ardingly College

https://youtu.be/RUPX9N6H4P8?t=229

 

Robert John Alston, (right) retired British diplomat. Alston was educated at Ardingly College and New College, Oxford. He is Chairman of Governors at Ardingly College (2005 – 2010). He served as British Ambassador to Oman between (1986–1990)

 

 

 

Paul Righton attended Ardingly College from 1940 to 1944

 

 

Righton’s Ardingly College obituary – with mention of Richard D Alston (G1953-63)

Dame Alun Roberts‏@ciabaudo

If he didn’t know, he’s hardly fit to be King …

2006 Prince Charles and Camilla with evil Bishop Ball

Richard Scorer: My clients accept the Prince of Wales (Prince Charles)  has many interactions with Church of England clergy. However our clients do not accept that he claims he was not aware that a caution means an acceptance of guilt.

Scorer claims senior leaders in the Church knew of Peter Ball’s offending but Lambeth Palace did not hand over letters to police:

Mr William Chapman: There’s a reluctance to trust the secular authorities to handle the matter and a willingness to forgive and reintegrate Peter Ball, no matter what he’d done

Elizabeth Hall, Nat Safeguarding Advisor, recommending a further review of Peter Ball information which should involve trying to find all files/documents

Both Michael Ball and brother Peter Ball were not shy about using the name of the Prince of Wales to seek to influence others. Bishop Michael Ball wrote to Lord Carey in Dec 1992 saying that his brother was receiving support from 2 Cabinet Ministers and Prince Charles Peter Ball often mention their friendship.

On 8 March 1993 Peter Ball received a caution for one count of gross indecency against Neil Todd. He resigned immediately. Peter Ball alleged to the Church of England shortly that he either did not wish to resign, and accepted a caution to avoid a trial.

“This Inquiry has been provided with details of allegations made by a total of 32 individuals. These all relate to an alleged abuse of power by Peter Ball for the purposes of his sexual gratification.”

The former Bishop of Lewes, Peter Ball was convicted of two offences of indecent assault, and an offence of misconduct

Peter Ball admitted when pleading guilty that he received sexual gratification from the deliberate manipulation of vulnerable young men, that the contact was consistent with grooming and that he abused his position as a Bishop in the Church of England

 In January 1996, Ball was permitted by Archbishop Carey to preach at a particular public school and, to conduct confirmations at other specific schools later on in that year

(1) Why he was permitted to return to ministry in this fashion? (2) Why did no-one think to carry out some kind of risk assessment? (3) Whether or not senior clergy simply thought that Peter Ball’s pleas of innocence should be believed?

 “I really appreciate your sympathetic understanding in preventing a scandal with a trial which would have affected the Royal family and establishments in this crucial time of turmoil within the Church of England.” Bishop Kemp comments on a 1990s investigation into Peter Ball

2006 Peter Ball former Bishop of Lewes with his good friends Prince Charles and Camilla at a memorial for her father Bruce Shand

Paedophile Peter Ball  remained a confidant of Prince Charles  right up until 2012

Although it took him time to accept the facts, the Prince has now cut the cleric out of his life. It was a difficult decision because Ball had become a spiritual advisor to the Prince

https://www.bbc.com/news/uk-england-sussex-36767415

http://www.dailymail.co.uk/news/article-3265742/Jimmy-Savile-Prince-Charles-close-friendship-sex-abuse-bishop-Peter-Ball.html

 

The Aegis connection? What a constellation! A paedophile bishop advising BigEars after Diana’s death, Jimmy Savile, Britain’s most prolific paedophile, pulling strings, and Nicholas Soames with his crystal ball, warning of Diana’s pending death!


A risk assessment carried out by the Church in 2009 identified that Peter Ball could be identified as a sexual predator given the length and scale of his offending

Watch:

ball at wedding

2005 The wedding of Prince Charles and Camilla Shand attended by evil Bishop Peter Ball

Peter Ball ‘preached at the funeral of Camilla’s father’s in 2006, which indicates his standing in their household.’

If Prince Charles didn’t know, he’s hardly fit to be King …

similarly…

http://www.dailymail.co.uk/news/article-3265742/Jimmy-Savile-Prince-Charles-close-friendship-sex-abuse-bishop-Peter-Ball.html

Daily Telegraph March 1993

Sunday Telegraph P Ball 14.3.93

ball 1 article 1993

and this

InquiryCSA‏Verified account@InquiryCSA

Both Michael + Peter Ball were not shy about using the name of the Prince of Wales to seek to influence others. Bishop Michael Ball wrote to Lord Carey in Dec 1992 saying that his brother was receiving support from 2 Cabinet Ministers + the PoW. PB often mention their friendship.

Cassandra Cogno‏ @CassandraCogno

Will we be told the 2 cabinet ministers didn’t understand a caution as an admission of guilt too? Or will they never be mentioned again

Gilo‏ @seaofcomplicity:

That tiny handful of letters (I believe there were 2000+) shows the extent to which the great and the good brought undue influence to bear. Why write such letters … unless intending to influence judicial proceedings? There cannot be any other reason.

And Carey quietly sat on 6 letters from parents and victims – letters which had they gone to police in mid 90’s would almost certainly have led to prosecution. This was a cover-up involving lambeth palace archbishops, bishops, and other assorted figures.

Gibb Report said Lord Carey “set the tone for the Church’s response to Ball’s crimes and gave the steer which allowed Ball’s assertions that he was innocent to gain credence”. But will IICSA find anything more than this? In 5 days and with so few witnesses.


 

Prince Charles assumed bishops did not lie “There are questions about why he provided a sex offender with a Duchy of Cornwall house…whether Charles really didn’t understand the gravity of Ball’s conduct, which had been front-page news when he resigned”

I didn’t know bishop was a paedophile, Prince Charles protests (he did not understand that the clergyman’s caution for gross indecency involved an admission of guilt)…. Yeah, right.

 

Image result for "bishop peter ball"

During his time in Lewes, Ball got to know Savile well and he was the bishop’s principal entree into the Waleses’ household

Peter Ball  was propelled into the royal circle by two people, I understand. One was prebendary Willie Booth, a former chaplain at Westminster School, who’d taken over from Caesar. The other was Jimmy Savile.

During his time in Lewes, Ball got to know Savile well and he was the bishop’s principal entree into the Waleses’ household. After his appointment to Gloucester was announced, Ball became a regular visitor to Highgrove and was held in such high regard that Charles attended his enthronement.

Charles, meanwhile, must surely have been advised to keep Ball at arm’s length — just as he had been advised to distance himself from Jimmy Savile.

‘The Prince did receive letters from the public complaining about Savile,’ says a senior aide. ‘But the writers were dismissed [by him] as jealous or mad.’

http://www.dailymail.co.uk/news/article-3265742/Jimmy-Savile-Prince-Charles-close-friendship-sex-abuse-bishop-Peter-Ball.html


Prince Charles kept in touch with ex-bishop later jailed for abuse

Prince told inquiry he was deceived by Peter Ball, who called him a ‘loyal friend’

20 July 2018

Prince Charles maintained contact with a former bishop who was later jailed for abusing young men and occasionally gave him money because he was deceived over the man’s crimes, he has told the independent inquiry into child sexual abuse.

In a written submission to be read at the inquiry next week, the Prince of Wales has said he did not understand that Peter Ball’s caution for gross indecency in 1993 involved an admission of guilt, according to a report in the Times.

In the statement, described as a draft, Charles said he had “decades of correspondence” with Ball and occasionally sent him “small gifts of money, as I do for many people in need”.

The former bishop has described the prince as a “loyal friend”.

Ball was invited to give Communion at Highgrove, the prince’s home, preached at the funeral of Bruce Shand, the Duchess of Cornwall’s father, in 2006 and lived in a Duchy of Cornwall property from 1997 to 2011.

Charles said the bishop told him he had been involved in an “indiscretion” and that an individual with a grudge had been persecuting him.

The prince added: “I was certainly not aware at the time of the significance or impact of the caution … Whilst I note that Peter Ball mentioned the word in a letter to me in October 2009, I was not aware until recently that a caution in fact carries an acceptance of guilt.”

He expressed “deep personal regret” that he had been deceived by Ball.

Next week’s hearings at the inquiry are to investigate “whether there were inappropriate attempts by people of prominence to interfere in the criminal justice process after [Ball] was first accused of child sexual offences”.

Ball, 86, the former bishop of Gloucester, was sentenced to 32 months for charges relating to 18 teenagers and young men between the 1970s and 1990s when he was bishop of Lewes. He admitted one count of misconduct in public office and two counts of indecent assault relating to two young men.

Ball was first accused in 1993 by Neil Todd, who tried to kill himself three times as a result of his abuse, and went on to do so in 2012.

Sussex police investigated Todd’s claims, and six other victims came forward. But support flooded in for Ball from within the establishment and he was never charged. Instead he received a caution for gross indecency, resigned his post as bishop and was allowed by Carey to continue officiating at church services.

Last year, an independent review of the C of E’s handling of the Ball case, conducted by Dame Moira Gibb, found senior church figures colluded with the accused bishop over a 20-year period. The report said: “The church appears to have been most interested in protecting itself.”

George Carey, the former archbishop of Canterbury, will also give evidence to the inquiry, in person and including cross-examination. He resigned his position as an honorary assistant bishop after being criticised in the Gibb report. His “permission to officiate” was reinstated earlier this year.

A Clarence House spokesperson said on Thursday: “IICSA has asked the Prince of Wales if he could help the part of their inquiry that deals with Mr Peter Ball. Whilst the prince made it clear that he was unaware of Mr Ball’s behaviour, he indicated that he was happy to volunteer context on his contact with Mr Ball if that would help.”

The spokesperson also referred to findings in the Gibb report, which said it had found no evidence “that the Prince of Wales or any other member of the royal family sought to intervene at any point in order to protect or promote Ball”.

https://www.theguardian.com/uk-news/2018/jul/20/prince-charles-kept-in-touch-with-ex-bishop-jailed-for-abuse-peter-ball

 

 

 

@ciabaudo

The Rev Barry Kinsman or ‘Mr. Padstow’ as he was known locally was found dead in the sea off Padstow. Now why would a man of the cloth be worried about the coverage given to the Savile inquiry and of it spreading to Cornwall?

Obituary: KINSMEN. – On 31 December, the Revd Barry Kinsmen:

Truro Diocesan Adviser in Religious Education (1979-95);

Priest-in-Charge of Little Petherick (1980-81); St Issey (1980-81); Rector of St Issey with St Petroc Minor (1981-95); 72.

https://webcache.googleusercontent.com/search?q=cache:_rBEpBTEE0oJ:https://www.churchtimes.co.uk/articles/2013/1-february/gazette/deaths/deaths+&cd=8&hl=en&ct=clnk&gl=us&client=firefox-b-1

Barry Kinsmen may have known Jimmy Savile through the Ball brothers.

Kinsmen (Truro Diocesan Adviser in Religious Education (1979-95) would have known Bishop Michael Ball as Truro Bishop (and Peter Ball who was friends with Jimmy Savile) Peter Ball resigned as Bishop of Gloucester in 1993 after he received a police caution for gross indecency.

It has now emerged he replaced his identical twin Michael, then Bishop of Truro, at services and official duties on an unknown number occasions in the 1990s.

The Diocese of Truro has appealed for information from churchgoers to investigate what happened when the two men were together in Cornwall between 1993 and 1997.

https://www.christiantoday.com/article/paedophile-bishop-peter-ball-impersonated-twin-brother-at-services/82418.htm

Of course, affordable housing is always an important issue, but what did Kinsman know about abuse in Cornwall, after all he was a leading light at the Padstow Echo and a former head teacher.

Let’s stay in Padstow for a while because it’s such a nice place and home to eccentrics such as Ed Prynn and his ladyfriend Glynis, whose spiritual mentors were Billy Graham (friend of croaker Cliff Richard) and Jimmy Savile:

On March 5th, 1993, the paedophile Bishop Ball was notified by the Crown Prosecution Service (CPS) that despite “sufficient admissible, substantial and reliable evidence”, it was prepared to deal with the matter out of court.

Bishop Bollox wasn’t the only nonce being protected down Cornwall way: It took 40 years for ex-copper Daniel Bryant, who was closely associated with the Azimuth Trust which in turn links to many other paedophiles, to be brought to justice.

 Image result for "devon" + "daniel bryant"

In October 1985 Daniel Bryant was pictured in the North Devon Journal receiving the British Empire Medal for services to youth from the Lord Lieutenant of Devon, the Earl of Morley, at a ceremony in Exeter.

Paedophile police officer Daniel Bryant brought to book FORTY years after abusing boys

He now faces jail after admitting abusing a string of boys in the 1960s, 70s and 80s

6 OCT 2013

Daniel Bryant served as a constable over three decades and was honoured for his youth work – but led a secret double life as a predatory pervert.

Russel first reported Bryant in 1987 but was told the allegations were uncorroborated, even though a ­second lad had also alleged abuse.

Bryant continued as a PC in Devon and Cornwall Police’s juvenile bureau for another five years until he was suspended when a third victim came forward in 1993.

Just a year later, aged 44, he ­retired on a medical pension on the grounds of ill health. He avoided prosecution until this year when he was finally charged.

Danny Bryant

Police surf club coach Danny Bryant took advantage of weekends away to commit abuse

On leaving the force Bryant ­became a leading figure in a club for the ­competitive sport of surf ­lifesaving, where he worked with many more children.

Bryant admitted ten indecent ­assaults, against five boys between 1969 and 1985, at Taunton Crown Court in August.

Russel was preyed on by Bryant after joining a police lifesaving club run by the pervert. Following one vile assault he quit the club but was tormented by flashbacks.

Gallingly, the following year Bryant was awarded the British Empire Medal for his youth work.

Daniel Bryant – a director of Surf Life Saving Great Britain.

His family took out a private prosecution but police refused to reinvestigate until eventually a probe was launched in February. Bryant pleaded guilty.

https://www.mirror.co.uk/news/uk-news/paedophile-police-officer-daniel-bryant-2341683

Bryant helped run a Surf Life Saving GB club affiliated at Saunton Sands in the 1980s when Russel Dawson said he was abused a number of times.

Esther Pearson, chief executive of Surf Life Saving GB (SLSGB), said the organisation had been unaware of the allegations until it received a letter from Mr Dawson on 19 October last year.

https://www.bbc.com/news/uk-england-devon-24851195

A police officer continued to work with children at a force lifesaving club following accusations of child abuse, a BBC investigation has found.

Danny Bryant was jailed last November for abusing boys between 1974 and 1985, including at Devon and Cornwall Police Surf Life Saving Club.

 

Derek Fisher, the former police boss of Bryant and the then secretary of the Devon and Cornwall Police Surf Life Saving Club, told BBC Inside Out South West that he took action to remove Bryant immediately from the club in 1988 after an accusation was brought to his attention.

He said Bryant “took no further part in that club from that time on”.

However, BBC Inside Out has found evidence that Bryant was part of the club until 1993:

  • Devon and Cornwall Police correspondence in October 1989 showed Mr Fisher inviting Bryant to an award ceremony at the club
  • Further correspondence shows Bryant retained an organisational role in 1991
  • Minutes from 1992 show Bryant was listed as club captain
  • In the same year when Diana Princess of Wales opened the clubhouse, Bryant was part of the reception committee
  • In 1993, Bryant became the new chairman of Saunton Sands Surf Lifesaving Club after the original club was disbanded

Bryant also held a senior role with Surf Lifesaving GB until 2012 and in the previous year was awarded one of the sport’s highest accolades: Knight in the Order of Lifesaving.

Surf Lifesaving GB was aware of an accusation of assault in 1993, but said it was only told of another case in October 2012.

The case has been referred to the Independent Police Complaints Commission.

https://www.bbc.com/news/uk-england-devon-26286940

Many of the offences took place at the now-defunct Devon and Cornwall Police Surf Life-saving Club which he was a founder member of.

Jailing Bryant, of Bideford, North Devon, Judge David Ticehurst said it was ‘a matter of regret that the force did not bring him to justice before’.

https://www.dailymail.co.uk/news/article-2492545/Why-did-long-justice-Paedophile-policeman-honoured-Queen-finally-jailed-25-YEARS-abuse-reported.html

BLUE EARTH TRAINING LTD

BRYANT, Daniel Harold

BRYANT, Jennifer

https://beta.companieshouse.gov.uk/company/07318516/officers

https://beta.companieshouse.gov.uk/officers/ZKd8zWCdAy6kzC_9eefOa-Dwieg/appointments


Cornwall:
chess‏@jackarania

The Azimuth Trust and Dr Morris Fraser, PIE member and his band of cronies

https://spotlightonabuse.wordpress.com/2013/04/17/azimuth-trust-was-linked-to-french-boat-schools-paedophile-ring/


Image result for "Nigel Havers" + "clare bronfman"

Nxivm: Nigel Havers’ step-daughter arrested over claims she funded secret ‘sex cult’ that branded women with symbol

Seagram heiress Clare Bronfman has been arrested on charges of racketeering conspiracy after allegedly using her fortune to help finance the group

25 July 2018

The step-daughter of actor Nigel Havers has been arrested over claims she funded a suspected US sex cult.

Investigators in America allege Seagram liquor heiress Clare Bronfman used her fortune to help finance the operations of Nxivm.

The 39-year-old is the daughter of Georgiana Bronfman, who is the Chariots of Fire star’s third wife.

Bronfman was arrested on Tuesday along with three others on charges of racketeering conspiracy.

She later appeared in a Brooklyn federal courtroom pleading not guilty to charges of running a criminal enterprise.

A judge ordered she be held under house arrest as the judge considered the prosecutor’s request for a $100 million bond.

Bronfman’s lawyer said her client “did nothing wrong”.

Her attorney, Susan Necheles, said in a statement that Nxivm was “not a criminal enterprise” but “an organisation that helped thousands of people”.

“The charges against Clare are the result of government overreaching and charging an individual with crimes just because the government disagrees with some beliefs taught by Nxivm and held by Clare,” Necheles said.

Nxivm co-founder Nancy Salzman, 64, her daughter, Lauren Salzman, 42, and the group’s 60-year-old bookkeeper, Kathy Russell, were also charged with racketeering conspiracy.

Six people have now been charged in the Nxivm inquiry, including 35-year-old actress Allison Mack, who starred in the TV show Smallville.

The US Department of Justice says all six committed “an array of crimes, including identity theft, extortion, forced labour, sex trafficking money laundering, wire fraud and obstruction of justice”.

They included Nicki Clyne, an actress who appeared on Battlestar Galactica, Bronfman’s sister Sara, a son of former Mexican president Carlos Salinas de Gortari, and India Oxenberg, a daughter of Dynasty actress Catherine Oxenberg.

In an indictment, prosecutors said Mack, who played a teenage friend of Superman in the CW network’s Smallville, helped Raniere recruit women to a secret sub-society within NXIVM whose members were branded with a surgical tool with a symbol that resembled his initials.

Women were expected to be subservient to “masters”, prosecutors said, including giving in to demands for sex.

In February, Havers credited his wife for saving him from grief following the death of his second wife, Polly Williams.

The actor was happily married to Polly Williams for many years before her death from ovarian cancer in 2004 at the age of 54.

Despite criticism for years by ex-followers who called NXIVM a cult and a pyramid scheme, the organisation’s intense self-improvement classes had, at one point, earned it thousands of adherents, including some with Hollywood ties.

They included Nicki Clyne, an actress who appeared on Battlestar Galactica, Bronfman’s sister Sara, a son of former Mexican president Carlos Salinas de Gortari, and India Oxenberg, a daughter of Dynasty actress Catherine Oxenberg.

In an indictment, prosecutors said Mack, who played a teenage friend of Superman in the CW network’s Smallville, helped Raniere recruit women to a secret sub-society within NXIVM whose members were branded with a surgical tool with a symbol that resembled his initials.

Women were expected to be subservient to “masters”, prosecutors said, including giving in to demands for sex.

In February, Havers credited his wife for saving him from grief following the death of his second wife, Polly Williams.

The actor was happily married to Polly Williams for many years before her death from ovarian cancer in 2004 at the age of 54.

https://www.mirror.co.uk/news/us-news/nigel-havers-step-daughter-arrested-12975257

Edgar Bronfman Jr., half-brother of Sara and Clare, is a member of Queen Elizabeth’s Committee of 300, and the chairman of Warner Music Group.

Charles Bronfman is also a member of the Committee of 300, and the owner of Seagram liquor, net worth $2 billion.

https://www.bibliotecapleyades.net/sociopolitica/esp_sociopol_committee300_14.htm

Image result for "edgar bronfman jr" + "clare bronfman"

And Edgar Bronfman Jr is on the Council on Foreign Relations

https://www.cfr.org/membership/membership-roster-a-f

Image result for "Nigel Havers" + "clare bronfman"

The Bronfman family has very close ties to the Rothschild banking dynasty, with members of both families belonging to many of the same companies, including their joint financial firm, Bronfman & Rothschild.

At Bronfman & Rothschild, Donald Trump’s, the Clinton’s and Jeffrey Epstein’s friend, “Lady” Lynn Forester de Rothschild, is on the Board of Directors:

https://thefreethoughtproject.com/al…-slavery-ring/

 

Edgar Bronfman Jr. is also in the “little black book” of paedo billionaire Jeffrey Epstein

Nigel Havers’ step-daughter, Clare Bronfman – her brother Edgar Bronfman Jr is in convicted billionaire paedophile Jeffrey Epstein’s black book

The Havers family has a long history with paedophiles:

Nigel Havers’ father Lord Michael Havers tried to stop Geoffrey Dickens from naming Sir Peter Hayman

Related image

Brother of child abuse inquiry judge Elizabeth Butler-Sloss was accused of ‘cover up’

Image result for butler sloss and peter ball

Late brother of Baroness Butler-Sloss, judge formerly in charge of Westminster child abuse inquiry, was attorney general who refused to prosecute paedophile spy Peter Hayman

Sir Michael Havers, the late brother of Baroness Butler-Sloss, was accused of a “white-wash” after he backed a decision not to prosecute Sir Peter Hayman.

Baroness Butler-Sloss, a former president of the Family Division of the High Court who led the inquest into the death of Princess Diana, has been appointed by Theresa May to lead an independent inquiry into allegations that child sex abuse was covered up by state bodies, the church, political parties and the BBC. The Home Office said she had “impeccable credentials”.

https://www.telegraph.co.uk/news/politics/10955726/Brother-of-paedophile-inquiry-judge-was-accused-of-cover-up.html

Elizabeth Butler Sloss covered up for Bishop Peter Ball

Image result for butler sloss and peter ball cover up

Elizabeth Butler Sloss, 1st IICSA chair, member of the establishment protected Bishop Peter Ball

Image result for "butler sloss" + "prince andrew"

Image result for "butler sloss" + "prince andrew"

Establishment ‘rallied to help ex-bishop later jailed for abuse’

Prince Charles and Lord Carey among powerful backers of Peter Ball, abuse inquiry told

23 July 2018

Members of the establishment, including the heir to the throne, the then archbishop of Canterbury and a senior member of the judiciary, rallied to the support of Peter Ball, a Church of England bishop accused of sexual abuse, an independent inquiry has heard.

“The story of Peter Ball is the story of the establishment at work in modern times,” said William Chapman, representing survivors. “It is the story of how the establishment minimised the nature of Peter Ball’s misdeeds … and silenced and harassed those who tried to complain.”

One survivor told the inquiry the C of E’s response to his disclosure of abuse amounted to “enduringly cruel and sadistic treatment”.

The independent inquiry into child sexual abuse is examining how the church handled allegations. A five-day hearing this week is scrutinising the church’s response to claims of sexual abuse against Ball, a former bishop of Lewes and then Gloucester, who was jailed in 2015.

Ball was able to call upon the “willing assistance of members of the establishment”, said Chapman. “It included the heir to the throne, the archbishop and a senior member of the judiciary, to name only the most prominent.”

Between them, they provided Ball with money and accommodation, legal advice, a private detective, references and approaches to the police and the prosecuting authorities.

“The alacrity and the extent of the response by Peter Ball’s friends to one of their own in trouble was impressive. It makes a horrible contrast to the way Peter Ball’s victims were treated,” Chapman said.

He told the inquiry: “These establishment helpers claim they were duped by Peter Ball … But you will have to consider if it is credible, given what they must have known or could easily have found out about Peter Ball, whether they were really as ignorant as they claimed they were about the nature of Peter Ball’s activities.

“Some claimed they did not know what a caution meant. Well, Prince Charles has many advisers; he only had to ask. So does the archbishop of Canterbury.”

Ball’s friends were willing to “add their weight” against the due criminal process. “They went far beyond the normal obligations of friendship.”

Allegations were first made against Ball in 1992, but he accepted a police caution and resigned his position as bishop. An independent review of the case commissioned by the C of E and published last year found evidence of collusion and a cover-up at the highest levels.

Richard Scorer, also representing survivors, said that Ball found in his fellow bishops the “perfect accomplices, prepared to turn a blind eye to his abuse over many decades”.

None bore greater responsibility than Lord Carey, the former archbishop of Canterbury, Scorer said. “We fear that when we hear from him this week, the usual litany of excuses will be trotted out,” he said, adding that Carey must give a “transparent account of his actions”.

Prince Charles’s assertion that he did not understand the significance of a caution was “frankly astonishing”, he said. The prince has access to “the best legal advice that money can buy,” Scorer added.

The prince chose not to clarify the legal position. “To my clients, this extraordinary lack of curiosity looks like wilful blindness,” he said.

In her opening statement, Fiona Scolding, senior counsel to the inquiry, said that Ball’s “fall from grace was a huge shock to the church”.

She added: “He was a very senior clergyman with enormous spiritual authority. He also had power and charm.”

People inside and outside the church had attested to Ball’s charisma and oratorical brilliance. She said that power had been “further enhanced by his cultivation of influential friends both within and outside the church”.

As an example, Ball had told people after his arrest that four cabinet ministers had offered him a “bolthole from the press”.

“He did not stint from mentioning those friends in prominent places when he thought it would assist his cause,” Scolding added.

She told the hearing of a scheme set up by Ball for young men interested in religious life that gave him the opportunity to groom them for sexual abuse and exploitation. The men were encouraged to pray naked, and engage in massage and spanking. One, Neil Todd, who first made allegations against Ball, killed himself in 2012.

Scolding said that Ball, now 86, was too unwell to give evidence either at the inquiry or by video link. But in one of two statements he had submitted he made an apology and said he had “neither been open nor shown penitence in the past”.

The hearing heard from three survivors who described their abuse by Ball. One, the Rev Graham Sawyer, who has waived his right to anonymity, said: “The sexual abuse that was perpetrated on me by bishop Peter Ball pales into insignificance when compared to the enduringly cruel and sadistic treatment that has been meted out to me by officials, both lay and ordained, in the Church of England.”

He described the culture within Anglicanism as an “ecclesiastic protection racket – and anyone who seeks in any way to threaten the reputation of the church and institution has to be destroyed”.

Safeguarding should be taken out of the church’s hands he said, as “it cannot police itself with any credibility”.

At the start of proceedings, Alexis Jay, the chair of the inquiry, said she had ordered an investigation into the leaking to the media of the Prince of Wales’s letter.

She said the leak was a “very serious breach of confidence by someone with direct access to information in this investigation” and promised “firm action” should the source be uncovered.

Scolding said a suggestion reported by the Times that the timing of the statement, to be read on the final day of this week’s hearings, was to prevent the prince being called for cross-examination “could not be further from the truth”.

She said: “There is no requirement for him to attend in person as his evidence, whilst important, is not of central relevance to many of the issues raised by this case study.”

The hearing continues.

https://www.theguardian.com/uk-news/2018/jul/23/establishment-rallied-to-help-ex-bishop-later-jailed-for-abuse

“within the records of the 1992 investigation…there are both oblique and direct references noting that Prince Charles or the royal family were interested inthe matter…there was also internal correspondence

Dame Alun Roberts‏ @ciabaudo

If he didn’t know, he’s hardly fit to be King …

Richard Scorer: My clients accept the PoW has many interactions with Church of England clergy. However our clients do not accept that he claims he was not aware that a caution means an acceptance of guilt.

Scorer claims senior leaders in the Church knew of Peter Ball’s offending but Lambeth Palace did not hand over letters to police:

Mr William Chapman: There’s a reluctance to trust the secular authorities to handle the matter and a willingness to forgive and reintegrate Peter Ball, no matter what he’d done

Elizabeth Hall, Nat Safeguarding Advisor, recommending a further review of Peter Ball information which should involve trying to find all files/documents

Both Michael Ball and brother Peter Ball were not shy about using the name of the Prince of Wales to seek to influence others. Bishop Michael Ball wrote to Lord Carey in Dec 1992 saying that his brother was receiving support from 2 Cabinet Ministers and Prince Charles Peter Ball often mention their friendship.

On 8 March 1993 Peter Ball received a caution for one count of gross indecency against Neil Todd. He resigned immediately. Peter Ball alleged to the Church of England shortly that he either did not wish to resign, and accepted a caution to avoid a trial.

“This Inquiry has been provided with details of allegations made by a total of 32 individuals. These all relate to an alleged abuse of power by Peter Ball for the purposes of his sexual gratification.”

The former Bishop of Lewes, Peter Ball was convicted of two offences of indecent assault, and an offence of misconduct

Peter Ball admitted when pleading guilty that he received sexual gratification from the deliberate manipulation of vulnerable young men, that the contact was consistent with grooming and that he abused his position as a Bishop in the Church of England

 In January 1996, Ball was permitted by Archbishop Carey to preach at a particular public school and, to conduct confirmations at other specific schools later on in that year

(1) Why he was permitted to return to ministry in this fashion? (2) Why did no-one think to carry out some kind of risk assessment? (3) Whether or not senior clergy simply thought that Peter Ball’s pleas of innocence should be believed?

 “I really appreciate your sympathetic understanding in preventing a scandal with a trial which would have affected the Royal family and establishments in this crucial time of turmoil within the Church of England.” Bishop Kemp comments on a 1990s investigation into Peter Ball
A risk assessment carried out by the Church in 2009 identified that Peter Ball could be identified as a sexual predator given the length and scale of his offending

Watch:

Peter Ball preached at over 25 schools between 1996 and 2002.

Lady Renton, wife of the chief whip, was friends with Peter Ball and wrote a letter of support to the DPP on HOC headed notepaper

https://www.iicsa.org.uk/key-documents/5977/view/23%20July%202018%20Anglican%20Public%20Hearing%20Transcript.pdf


 

Prince Charles gives evidence to inquiry into Peter Ball

The Prince of Wales says he was aware that Peter Ball, who lived in Aller, near Langport, had been given a police caution, but claims he did not realise it amounted to an admission of guilt.

Details of Prince Charles’s relationship with Ball will be revealed at an inquiry into the case on Friday.

The next in line to the throne had “decades of correspondence” with Ball and occasionally sent him “small gifts of money”, according to the draft copy of his statement to the inquiry, The Times has reported.

The statement will add that Ball confided in him in 2009 that he had been involved in an “indiscretion” years previously, which he blamed on a person with a grudge.

http://www.somersetcountygazette.co.uk/news/16371173.prince-charles-gives-evidence-to-peter-ball-inquiry/

Image result for "peter ball" + "prince charles"

Peter Ball abuse inquiry requests statement from Prince Charles

Wed 06 Jun 2018

By Press Association

The Prince of Wales has been asked to give a witness statement to a public inquiry about a paedophile bishop who was jailed after abusing young men.

Peter Ball was sentenced to 32 months in 2015 for a string of offences between the 1970s and 1990s, and the handling of allegations against him is now being examined by the Independent Inquiry into Child Sexual Abuse (IICSA).

At a hearing on Wednesday, counsel to the inquiry Fiona Scolding QC said that statements had been requested from the prince and his principal private secretary.

According to a transcript posted on the inquiry website, she said: “We have also requested a witness statement from both His Royal Highness the Prince of Wales and his principal private secretary.

“The Prince’s solicitors have indicated their client’s willingness to assist us and have raised a number of important issues for us to consider.

“This has led to lengthy and complex discussions and we are currently considering the latest points they have raised. We hope to be able to provide an update to core participants on this in the next couple of weeks.”

Charles had exchanged a series of letters with Ball, the former Bishop of Gloucester, whose diocese covers Highgrove, the prince’s country home.

A spokesman for the prince told the Daily Mail last year that the correspondence contained nothing of relevance to the clergyman’s offending.

Lawyer Richard Scorer from Slater and Gordon, who is representing complainants at the IICSA, said: “It is imperative that the inquiry leaves no stone unturned in its efforts to establish how Peter Ball was able to evade justice for two decades.

“If this means calling Prince Charles and other prominent establishment figures as witnesses then the inquiry should do so without fear or favour.”

https://www.premier.org.uk/News/UK/Peter-Ball-abuse-inquiry-requests-statement-from-Prince-Charles

 

George Bell was ‘fond’ of paeodophile bishop Peter Ball and sponsored him for ordination, an inquiry has heard.

As former bishop of Chichester, Bell is considered one of Anglicanism’s heroes. However, it emerged in 2015 the Church of England paid £16,800 to the woman, known as Carol, in a legal settlement after she accused Bell of sexually abusing her as a child.

Now it can be revealed Peter Ball, who was jailed for a string of sex offences against teenagers and young men in 2015, was close friends with Bell.

Peter Ball
Bishop Ball sentenced to 32 months in prison but served only 16 months.

Ball was initially rejected in his attempt to become a priest in 1951 but Bell wrote to the selection panel in support of Ball’s application.

When Ball applied for ordination a second time it was Bell who sponsored him through the process.

In his witness statement to an inquiry investigating child sex abuse within the Church of England, Ball denied that Bell had ‘overruled’ the selection board allowing him to be ordained.

However he said that after his ordination Bell would visit his parish to take services, adding he was ‘aware that he was “fond” of me’.

In response to a question about Bell’s involvement in his ordination, Ball told the inquiry: ‘It is not right therefore to say that Bishop Bell “overruled” the selection board in order for me to be ordained.

Bishop George Bell
Courtesy of Jimmy JamesBishop George Bell is an iconic figure for the Church of England and was bishop of Chichester from 1929 to 1958.

‘Although Bishop Bell had indicated in 1951 in a letter to the first Selection Board who did not recommend me for ministry that he would be “prepared to accept me for ordination” even though the Selection Board had not recommend me for training at that time, that is not how matters proceeded.’

He went on: ‘After theological college, it was Bishop Bell ultimately who did sponsored [sic] me for ordination, but with the approval of the Selection Board. Bishop Bell then placed me in the parish of Rottingdean where I undertook my first curacy.

‘He would visit my curacy on occasion to carry out confirmations and to take services.

‘We had a good working relationship; I was aware that he was “fond” of me. He was someone who I looked up to when I was a young curate starting out in the Church.’

Bell, who died in 1958, was revered by Anglicans before the abuse allegations against him emerged. However a report earlier this year heavily criticised the Church’s handling of the accusations and found it ‘rushed to judgement’ and failed to give proper consideration to Bell’s rights.

But the archbishop of Canterbury refused to back down and said a ‘significant cloud is left over his name’.

Ball went on to become bishop of Lewes in the diocese of Chichester and then bishop of Gloucester. He was accused of gross indecency against a 16-year-old in 1992 but escaped with a police caution after he received backing from a member of the Royal Family and a number of other establishment figures. He was told to step down from his role as a bishop. However he continued to minister in churches and schools until 2010 before he was eventually arrested.

At the age of 83 he was sentenced to 32 months for misconduct in public office and 15 months for indecent assaults in 2015. He was released after serving 16 months.

The independent inquiry into child sexual abuse has been investigation how the diocese of Chichester handled allegations of child sexual abuse as a case study for the wider Church of England.

In his concluding remarks today solicitor David Greenwood said the CofE was more ‘malign’ than the Catholic Church in its response to abuse and accused it of ‘a conscious effort to treat survivors badly’.

The archbishop of Canterbury in his evidence said he had ‘learnt to be ashamed again of the Church’ and warned child sexual abuse would ‘destroy the Church’ if not addressed.

Image result for rev carey and bishop ball

Ex-Archbishop ‘faces probe into Church sex abuse cover-up’: George Carey accused of ‘colluding’ with senior clergy to protect jailed bishop

05 Mar 2018

The former Archbishop of Canterbury could face a police probe over claims the Church covered up the activities of a sex abuse bishop, it was reported last night.

George Carey was last year accused in a report of ‘colluding’ with senior clergy to protect Bishop Peter Ball.

Ball, who groomed and abused 18 vulnerable men from 1977 and 1992, was allegedly not added to a list of questionable ministers in 1993 that enabled him to carry on working.

Bishop Peter Ball, who groomed and abused 18 vulnerable men from 1977 and 1992, was allegedly not added to a list of questionable ministers in 1993 that enabled him to carry on working

Even though the Metropolitan Police has not started a criminal investigation, the Crown Prosecution Service (CPS) is discussing whether to press charges against Lord Carey, according to the Daily Telegraph.

Prosecutors are said to be reading a 70-page report by Dame Moira Gibb, which was released last summer, in order to decide whether to prosecute.

A spokesman for Operation Hydrant – the investigation into historical allegations of child abuse – said: ‘The matters under consideration are complex, and advice is currently being sought from CPS to understand whether anything contained within the report suggests criminal offences have been committed.

‘This does not equate to a criminal investigation being underway.’ Solicitor David Greenwood, who has represented several of Ball’s victims, criticised the length of time prosecutors were taking.

He said: ‘What’s taking the CPS so long? It’s a 70-page report which was published nine months ago.’ Ball, a former suffragan bishop of Lewes, was let off with a caution for molesting a teenage novice monk in 1993. Although the Church knew of other allegations against him, it was not until 2015 that Ball was finally prosecuted and jailed.

He admitted abusing 18 teenagers and young men who had sought spiritual guidance from him between 1977 and 1992. Last summer the report into the scandal by Dame Moira, titled Abuse of Faith, described the Church’s handling of the scandal as ‘lamentable’.

It found Mr Carey ‘colluded’ with senior clergy to protect Ball. The independent inquiry into the scandal found that the Church of England knew of a string of allegations against Ball, then bishop of Gloucester, but failed to alert the police.

Justin Welby, the current Archbishop of Canterbury, urged his predecessor to step down from his role as an assistant bishop after the report covering his time as head of the Church of England.

Image result for rev carey and bishop ball

Some of Ball’s victims called for a criminal investigation into senior clergy after the report found that the Church was ‘more interested in protecting itself’ than helping those he had abused, and that at least nine bishops knew allegations had been made against him.

In a Christmas letter last year, Lord Carey attacked his successor Mr Welby for commenting on his handling of allegations against Ball. The 82-year-old lashed out at the ‘unjust’ request for him to step down over his supposed failings 24 years ago.

The news comes as the Independent Inquiry into Child Sexual Abuse prepares to begin today. The inquiry will spend three weeks analysing the actions of the Anglican Church, and is expected to hear from Mr Welby. A spokesman for the Church of England said it would always cooperate with police, but declined to comment.

A spokesman for the Carey family also declined to comment.

http://www.dailymail.co.uk/news/article-5461945/amp/Ex-Archbishop-faces-probe-Church-sex-abuse-cover-up.html?__twitter_impression=true

George Carey allowed church role despite part in abuse cover-up

Former archbishop of Canterbury was criticised in report into abuse by Peter Ball

13 July 2018

George Carey, the former archbishop of Canterbury who was heavily criticised in an independent report for his part in the cover-up of sexual abuse carried out by a bishop, has been allowed to resume an official role in the Church of England.

Lord Carey stepped down last year as an honorary assistant bishop at the unprecedented request of Justin Welby, the archbishop of Canterbury, after a damning report which found the church had colluded over the abuse.

But it emerged this week that Carey has been granted “permission to officiate” (PTO) by Steven Croft, the bishop of Oxford, allowing him to preach and preside at churches in the diocese. Croft is reportedly under police investigation for allegedly failing to respond properly to a separate report of clerical sexual abuse.

The decision to grant the PTO was made in February despite expectations of further revelations this month about Carey’s role in the case of Peter Ball, a former bishop of Gloucester, at the independent inquiry into child sexual abuse (IICSA).

The inquiry will spend a week scrutinising the C of E’s handling of the Ball case, starting on 23 July. Ball was jailed in 2015 for the grooming, sexual exploitation and abuse of 18 vulnerable young men between 1977 and 1992. Prince Charles has been asked to give a witness statement to the inquiry about his correspondence with Ball.

Carey, who was archbishop of Canterbury from 1991 to 2002, resigned his honorary post after the publication of an independent report on the Ball case by Dame Moira Gibb.

She concluded that senior figures in the church had “colluded [with the abuser] rather than seeking to help those he had harmed”. She said: “The church appears to have been most interested in protecting itself.”

Carey had “set the tone for the church’s response to Ball’s crimes, and gave the steer which allowed Ball’s assertions that he was innocent to gain credence”, said Gibb.

The former archbishop responded to the report, saying it made “uncomfortable reading” and that he accepted its criticisms of him.

In February this year, Carey contacted the diocese of Oxford to request a PTO, which was granted by Croft. It followed letters from members of the congregation where Carey worships that requested he be allowed to resume ministry at their church.

A spokesperson for the diocese of Oxford said: “The granting of PTO enabled Lord Carey to preach and preside in the church where he worships, a church where his ministry is much valued. The granting of a PTO does not indicate a planned return to the role of assistant bishop.”

It is understood that Carey underwent fresh checks on his criminal record and C of E safeguarding training.

The church’s national safeguarding team was not consulted on whether the PTO should be granted.

A survivor of abuse by Ball said he was extremely concerned to learn that Carey had been granted a PTO. “It’s a real stab in the back for Ball survivors,” he said, adding that it would have been prudent to wait until further evidence had been heard by IICSA.

Croft is one of several senior church figures, including John Sentamu, the archbishop of York, who are reportedly being investigated by South Yorkshire police over alleged failures to act on disclosures of an alleged rape of a teenage boy by a clergyman in the 1980s. The force declined to confirm or deny an investigation was under way.

Matthew Ineson claims he was raped by the Rev Trevor Devamanikkam, and in 2012 and 2013 reported the crime to senior figures in the church, including Croft. He alleges they failed to follow proper procedures and did not advise him to tell police.

Devamanikkam was later charged with indecent assault and buggery without consent, but killed himself in 2017 before coming to trial.

A spokesperson for the diocese of Oxford said: “Written records and notes taken at the time give a different picture to the one Mr Ineson is presenting about how his case has been handled.”

An independent review had been commissioned by the C of E’s national safeguarding team, the spokesperson said.

Ineson told the Guardian: “Steven Croft may disagree about the wording of my disclosures, but nonetheless accepts I did tell him of my abuse. No word of apology has ever been forthcoming for what I have been put through.

“Given the circumstances it is incredible that Croft is still in a position to decide whether PTO should be given to George Carey or anybody else who has been so involved in the dreadful case of Peter Ball or any other safeguarding case.”

PTOs are mostly granted to retired priests who wish to continue their ministry by preaching, taking communion and providing holiday or sickness cover to serving clergy. PTOs are granted at the discretion of the local bishop.

https://amp.theguardian.com/uk-news/2018/jul/13/former-archbishop-of-canterbury-allowed-to-resume-a-church-role?CMP=share_btn_tw&__twitter_impression=true

Matthew Ineson‏ @InesonMatthew

And he didnt even consult the National Safeguarding Team.

NST deal with all high profile cases. didn’t even consult them. Another failure. Bishop under investigation for safeguarding failures gives PTO to a bishop under investigation for safeguarding failures etc

If anyone has doubts about poor safeguarding record, have a look at the independent Scie safeguarding audit on Sheffield diocese covering Crofts time-scary reading. Add to that my case & now he gives PTO back to Carey who had to resign cos of the Peter Ball cover up

Image result for Canon John Rees

Revd Canon John Rees with Archbishop Welby

Gilo ‏ @seaofcomplicity

This is just plain weird that Archbishop Welby’s provincial registrar kept such conflict-of-interest hidden. Not good. Whole structure needs reform if CofE legal officers can do this?

Legal advisor to the worldwide Anglican Consultative Council is Canon John Rees – chaplain to the Queen.  His first curacy was in a  parish in Yorkshire where he was trianied by parish priest Rev Trevor Devamanikkam – Ineson’s abuser.  Small world!

Canon Rees said he was “deeply honoured” to become a Chaplain to Queen Elizabeth II

England: Anglican legal advisor named Queen’s Chaplain

March 17, 2014

The legal adviser to the Anglican Consultative Council (ACC) and Provincial Registrar for the Archbishop of Canterbury has been appointed as a Chaplain to Queen Elizabeth II.

Canon Rees is currently Registrar for the Archbishop of Canterbury, Diocesan Registrar for Oxford, Legal Adviser to the ACC (since 1995) and Senior Partner of Winckworth Sherwood – Vice-Chair of the Legal Advisory Commission of the C of E, an honorary Provincial Canon of Canterbury Cathedral.
His primary employer Winckworth Sherwood –  described as a lawyer who, “specialises in ecclesiastical, educational and charity law and has a wealth of experience in advising on charity constitutions for national and international bodies; financial structures; disciplinary issues, subsidiary companies and asset management; press handling issues. As well as the full range of freehold and leasehold, registered and unregistered matters; and all types of ancillary issues e.g. rights of way; complicated redevelopment schemes, title investigations, contaminated land remediation issues, boundary disputes, unusual property matters such as dealing with consecrated land, burials and exhumation.”

Police and prosecutors are considering a criminal investigation into a former Archbishop of Canterbury over an alleged cover-up of sexual abuse.

George Carey stepped down as an honorary bishop last year after a report found the Church had “colluded” with convicted sex abuser Bishop Peter Ball under his leadership.

Now the Crown Prosecution Service (CPS) is discussing with Scotland Yard detectives whether to pursue criminal charges against Lord Carey, the Telegraph understands.

The Metropolitan Police said it had not launched an official criminal investigation into Lord Carey. A spokesman for the Carey family declined to comment.

It comes as the Independent Inquiry into Child Sexual Abuse (IICSA)…

Princess Diana, in intimate confessions recorded on video by her voice coach,   described her sex life with Prince Charles as “odd, very odd”. 

http://www.independent.co.uk/news/uk/home-news/princess-diana-parents-earl-spencer-never-loved-her-sex-tapes-channel-4-remarriage-countess-footage-a7870856.html

Sex abuse bishop Peter Ball and brother seek Catholic switch

06 December 2017

A former bishop jailed for sex offences and his twin brother have said they are looking to join the Catholic Church to “live and worship in anonymity”.

Peter Ball, who is now 85, was jailed for 32 months in October 2015 for offences against 18 teenagers and men.

The former Bishop of Lewes and of Gloucester carried out the abuse between the 1970s and 1990s.

Ball’s identical twin and former bishop Michael Ball said in an email events had “wearied and reduced us”.

Email from Michael Ball

In the email, mistakenly sent from Michael Ball to BBC South East’s Colin Campbell among others, the brothers said having been “battered by the Church” they would be looking to join the Roman Catholic Church.

They said they would like to “end our days in a church where we can live and worship in anonymity and without constant fear”.

The BBC contacted Michael Ball about the email and he said a move to the Catholic Church was “a possibility”.

The Roman Catholic Diocese of Arundel and Brighton said in a statement: “We confirm that Peter Ball has been in contact with the Roman Catholic Diocese of Clifton, in which diocese he now lives, expressing an interest in becoming a member of the Catholic Church.

“This matter is subject to discussions between Clifton Diocese and the statutory authorities, who are the lead with regards to Peter Ball’s risk management in the community.”

‘Manipulative’ campaign

An independent review of Ball’s case by Dame Moira Gibb criticised the former Archbishop of Canterbury Lord Carey.

Dame Moira said he had received seven letters from families and individuals following the arrest and cautioning of Ball in 1992 for gross indecency – when he stood down as Bishop of Gloucester – but failed to pass six of them to the police.

Lord Carey had also failed to put Ball on the the “Lambeth List” which names clergymen whose suitability for ministry had been questioned.

Dame Moira also heard Bishop Michael Ball allowed his brother to attend functions in his place, even after his resignation, and on one occasion Peter Ball had introduced himself as his brother.

In 1994 Michael Ball campaigned to Lord Carey to return his brother to the ministry, with one bishop calling the brothers’ activities “manipulative”, Dame Moira reported .

Between 1995 and 1997, with Lord Carey’s backing. Peter Ball returned to church ministry, eventually undertaking duties such as confirmations.

After a series of investigations Balls’ ministry ceased in 2011, Dame Moira reported.

He was released from jail in February after serving 16 months.

https://www.bbc.co.uk/news/amp/uk-england-42257380

Former Bishop of Truro Michael Ball and his paedophile ex-bishop twin Peter want to become Catholics so they can live in anonymity

8 DEC 2017

Peter Ball, the former Bishop of Lewes and Gloucester who boasted of links to royalty, has asked to join the Roman Catholic Diocese of Clifton in Bristol, a spokesman for the Church confirmed.

His identical twin brother Michael Ball, who was Bishop of Truro from 1990 to 1997, also sent an email to friends telling them of the idea.

From the email…”The events of the last years and rightly or wrongly the battering by the Church have totally wearied and reduced us.

“We will probably be joining the Roman Catholic Church soon.

…Michael Ball’s complaint of taking a “battering” from the Church was “flippant” and it was “disgusting” the pair were acting as though they were the victims.

A spokesman for the Roman Catholic diocese of Arundel and Brighton said: “We confirm that Peter Ball has been in contact with the Roman Catholic diocese of Clifton, in which diocese he now lives, expressing an interest in becoming a member of the Catholic Church.

“This matter is subject to discussions between Clifton diocese and the statutory authorities, who are the lead with regards to Peter Ball’s risk management in the community.

Disgraced paedophile former bishop Peter Ball with close friend Prince Charles

Disgraced paedophile former bishop Peter Ball with close friend Prince Charles

Peter Ball’s sentence came 22 years after the abuse first surfaced. He eventually admitted misconduct in a public office and two counts of indecent assault.

The court heard how Peter Ball had convinced some of his victims to strip naked to pray and even suggested they submit to beatings between 1977 and 1992.

The first of his victims to come forward took his own life in 2012 after hearing Sussex Police had reopened the case.

Former Archbishop of Canterbury George Carey resigned as honorary assistant bishop in the Diocese of Oxford after the public inquiry into child sex abuse last year heard he delayed a “proper investigation” into Peter Ball’s crimes for two decades by failing to pass information to police.

There were fears Peter Ball may have taken the place of his twin, who was Bishop of Truro in the Nineties, and therefore duped congregations in other parts of the UK.

The Diocese of Truro was understood to be looking into the evidence that Peter Ball conducted services in Cornwall.

Now it has emerged the Archbishop of Canterbury’s headquarters received at least six letters from other alleged victims detailing “potentially criminal” and “totally inappropriate behaviour” by Peter Ball in the early 1990s but did not pass them on to police until years later.

“The Church appears to have resorted to staggering levels of deceit in order to prevent the true extent of Ball’s offending coming to light,” said Richard Scorer, a solicitor who is representing victims of Peter Ball.

Details of the letters, all sent to the Church between December 1992 and February 1993, reveal that Peter Ball encouraged victims to pray naked, perform sex acts in front of him and share his bed.

Anglican officials who reviewed the letters in 2009 suggested that, had such evidence been given to detectives in 1993, Peter Ball may have been convicted of serious sexual offences rather than merely cautioned.

But instead of being made public, the letters were kept in confidential files at Lambeth Palace.

It was not until 2012, after several internal inquiries, that the Church finally released documents to police.

An independent review is also currently under way into the way the Church of England responded to the case involving Peter Ball.

https://www.cornwalllive.com/news/cornwall-news/former-bishop-truro-michael-ball-895920#ICID=sharebar_twitter

Church knew about allegations before Cornish preacher went on to abuse boys, investigation reveals

The diocese failed to investigate the accusations against Jeremy Dowling

25 MAY 2018

Dowling became such an important and valued worker and volunteer during a 40-year association with the diocese that a special service of thanks was given in his honour when he retired in 2009

A leading figure in the Church of England in Cornwall went on to commit child sex offences for several years after allegations about his behaviour with young boys were raised with the diocese and not acted upon, an official investigation has revealed.

The diocese failed to investigate the accusations against Jeremy Dowling, a lay preacher, allowing him to rise to influential positions including communications officer to the bishop, an independent review for the church concludes.

The report, released today, says there were “historic failings” within the diocese in dealing with the allegations, first raised in 1972. There was “ongoing knowledge” of the situation among senior figures in the diocese “well into the 1980s” with references to “a big fat file” on Dowling.

After the first allegations of Dowling abusing boys at a North Cornwall school where he taught were dropped by the Director of Public Prosecutions – because of a lack of corroborative evidence – the then Bishop of Truro Maurice Key wrote: “I suppose the problem will now be to find him some other work”.

Dowling became such an important and valued worker and volunteer during a 40-year association with the diocese that a special service of thanks was given in his honour when he retired in 2009.

In 2015 he was jailed for seven years after pleading guilty at Truro Crown Court to 15 charges of sexually abusing boys under 16.

In 2016 he was jailed for an additional eight years after being found guilty of six further charges of indecently assaulting a boy between 1973 and 1977. Those offences happened when he befriended the boy while a lay preacher at a church in Budehaven – and took place after concerns were first raised with the diocese.

The report’s author said the lack of action by the diocese allowed Dowling to gain credibility and authority.

“Because they didn’t take it any further it enabled Jeremy Dowling to reach a position where he made up his own rules, and his position within the church lent him credibility and authority,” said Dr Andy Thompson, an academic, magistrate and member of the Diocesan Council.

The Bishop of St Germans, Rt Revd Dr Chris Goldsmith, apologised for the lack of action and the suffering that resulted.

https://www.cornwalllive.com/news/cornwall-news/church-knew-allegations-before-cornish-1606727#ICID=sharebar_twitter

Bishop who ignored warnings about preacher Jeremy Dowling who went on to abuse boys is identical twin of paedophile ex-bishop

Former Bishop of Truro Michael Ball’s twin Peter Ball, the former Bishop of Lewes and Gloucester, was convicted of abusing young boys

25 May 2018

One of the bishops who ignored warnings about a preacher who went on to sexaully abuse boys is the identical twin of a paedophile ex-bishop.

It emerged this week that a leading figure in the Church of England in Cornwall went on to commit child sex offences for several years after allegations about his behaviour with young boys were raised with the diocese and not acted upon, an official investigation has revealed.

The diocese failed to investigate the accusations against Jeremy Dowling, a lay preacher, allowing him to rise to influential positions including communications officer to the bishop, an independent review for the church concludes.

The report, released on Friday (May 25), says there were “historic failings” within the diocese in dealing with the allegations, first raised in 1972. There was “ongoing knowledge” of the situation among senior figures in the diocese “well into the 1980s” with references to “a big fat file” on Dowling.

Dowling became such an important and valued worker and volunteer during a 40-year association with the diocese that a special service of thanks was given in his honour when he retired in 2009.

Cornwall mum made homeless with Down’s Syndrome son after mouldy flat sees child hospitalised

In 2015 he was jailed for seven years after pleading guilty at Truro Crown Court to 15 charges of sexually abusing boys under 16.

In 2016 he was jailed for an additional eight years after being found guilty of six further charges of indecently assaulting a boy between 1973 and 1977. Those offences happened when he befriended the boy while a lay preacher at a church in Budehaven – and took place after concerns were first raised with the diocese.

One of the leaders who was named in the report was Michael Ball, 86, who was Bishop of Truro from 1990 to 1997. The Right Reverend Ball told the diocese he had been informed of the allegations about Dowling but had not seen any need to take action as there had not been a prosecution.

His identical twin, Peter Ball, the former Bishop of Lewes and Gloucester who boasted of links to royalty, was jailed for 32 months in October 2015 for offences dating back to the 1970s against 18 young men at his home in East Sussex.

His sentence came 22 years after the abuse first surfaced. He eventually admitted misconduct in a public office and two counts of indecent assault. The court heard how Peter Ball had convinced some of his victims to strip naked to pray and even suggested they submit to beatings between 1977 and 1992.

The first of his victims to come forward took his own life in 2012 after hearing Sussex Police had reopened the case.

There were fears Peter Ball may have taken the place of his twin, who was Bishop of Truro in the Nineties, and therefore duped congregations in other parts of the UK.

The Diocese of Truro was understood to be looking into the evidence that Peter Ball conducted services in Cornwall.

Last year the brothers decided they wanted to become Catholics so they could live in anonimity. Peter Ball asked to join the Roman Catholic Diocese of Clifton in Bristol and both said they wanted to switch faith from the Church of England so they could “live and worship in anonymity” within the Catholic Church.

https://www.cornwalllive.com/news/cornwall-news/bishop-who-ignored-warnings-preacher-1608976

Image result for "jeremy dowling" + "bishop ball"

Former Bishop of Truro was Michael Ball, twin brother of convicted paedophile/friend of the royal family and Jimmy Savile – Bishop Peter Ball.


Jeremy Dowling

The Right Reverend Michael Ball – Bishop of Truro from 1990-97 – told the diocese he had been informed of the allegations but had not seen any need to take action as there had not been a prosecution.

His identical twin, former bishop Peter Ball, was jailed in 2015 for a string of indecent assaults on teenagers and young men.

A file found “in an unusual place” at the Bishop of Truro’s residence in 2013 was passed to police and led to Dowling’s prosecution.

http://www.bbc.com/news/uk-england-cornwall-44240688

A RECENT service at Truro Cathedral paid tribute to the work of Jeremy Dowling, the Diocese of Truro’s Communications Officer, who steps down at the end of December after more than 25 years in post. He has lived in the Bude area for more than 40 years.

On a wet and windswept evening, a congregation made up from clergy and people from across the diocese enjoyed a service that included readings, hymns and a sermon given by the former Bishop of Truro, Bishop Bill Ind. Also present were the current Bishop of Truro, The Rt Rev Tim Thornton, the Dean of Truro, The Very Rev Dr Christopher Hardwick, both Archdeacons and Mr Martin Follett, the Diocesan Registrar.

During his sermon, Bishop Bill paid tribute not only to the work that Jeremy undertook as Communications Officer but also his very substantial other work for the Diocese including nearly 40 years as a Reader,

seventeen years as Chairman of the House of Laity of the Diocesan Synod, one of the first people to be made Lay Canons of the Cathedral, a member of the General Synod for 27 years, as well as sitting at one time or another on virtually every Board and Committee of the Diocese.

He said, “Jeremy’s media and broadcasting skills are second to none.”

His experience and expertise in the television broadcast area was particularly noted, especially the background work he was able to do which led to programmes such as the very successful and popular BBC series ’Seaside Parish’ featuring Boscastle and the surrounding parishes, which enjoyed weekly audiences if over three million, ’Island Parish’ featuring the Isles of Scilly and ’The Monastery.’

Summing up, Bishop Bill said: “He has been a critical friend, someone who has told me the truth as he sees it. He has made me and indeed others both laugh and think and for both these things and much else I remain profoundly grateful. The Diocese owes him an enormous amount and so indeed do I and a host of others.”

Jeremy Dowling has lived in the Bude area of North Cornwall for more than forty years, with thirty years spent in the parish of St Gennys, and he is Chair of Governors of Budehaven Community School.

In his thanks and response to Bishop Bill, Jeremy noted how the communications role had changed greatly with much more emphasis today on electronic media. He acknowledged with gratitude the work of the local press and media, recognising its essential vitality and the key role it played in championing issues which were important for the church and for society.

“We have enjoyed excellent relations with the westcountry media” he said “and it has been a privilege to work with local journalists and broadcasters.”

He concluded by saying: “In my view, the strength of the Church remains in the local community. There is a lot going on. And the thread which runs through most of the stories is undeniably positive. They chronicle a vigorous, interesting, dynamic, eccentric and imaginative life in the church in Cornwall. Long may it

continue.”

After refreshments, a large bouquet was presented by Bishop Tim to Daphne Dowling in recognition of her support for her husband, and Jeremy was presented with a substantial cheque from parishes and individuals in the Diocese

Prime Minister lauds accomplishments of Bude organisation as he presents Big Society Award

BIG SOCIETY: Pictured above, with Prime Minister David Cameron and North Cornwall MP Dan Rogerson, are Co-founder of Community Action Through Sport (CATS) and volunteer Denise Jane May, CATS trustee and volunteer Jeremy Dowling, CATS Project Development Manager Karen Hemmings, CATS Project Development Assistant Louise Anne Harris and CATS trustee and volunteer Sharon Caroline Marshall.

 

Ex Truro Diocese worker Jeremy Dowling sexually abused boys

5 June 2015

An ex-Diocese of Truro press officer has admitted sexually abusing boys over a period of more than 10 years.

Jeremy Dowling, 76, carried out the assaults on five children, aged between 12 and 15, from 1959 to 1971.

Truro Crown Court heard Dowling abused the boys at sporting events and in toilets while working as a teacher in Devon.

The Bishop of Truro described Dowling’s offences as “deeply shocking” and said his thoughts were with the victims.

Sentencing was adjourned until July 10 for a pre-sentence report to be prepared.

Dowling, of Church Path, Bude, retired from the Diocese of Truro in 2009 after 25 years of service.

‘Damaging impact’

He pleaded guilty to 13 counts of indecent assault on boys aged 12 to 15 and two counts of indecency with a child.

The court heard one assault was carried out on a boy at a cricket match. Others took place in an attic, in storage rooms at a sporting pavilion and in outside toilets.

The Right Reverend Tim Thornton, Bishop of Truro, said many people would have known Dowling as a reader at St Michael’s Church and St Genny’s Church in Bude and as a member of the Diocesan and General Synods.

Bishop Thornton said: “Offences like this will have a damaging and lasting impact on people’s lives.

http://www.bbc.com/news/uk-england-cornwall-33025742

Former Cornwall preacher Jeremy Dowling ‘assaulted boy’

The assaults happened when Jeremy Dowling was a lay preacher at two churches in the Bude area of Cornwall, Truro Crown Court was told.

Mr Dowling met the boy when he was 10 through church activities and “took him under his wing”.

He has denied six counts of indecent assault on a child and two counts of gross indecency with a child.

The assaults happened in the 1970s before Mr Dowling became a press spokesman for the Diocese of Truro, the court heard.

‘Long time ago’

Jo Martin, prosecuting, said some of the assaults took place at Mr Dowling’s house after the boy had been invited for dinner and on one occasion he was taken to a church on the north coast.

She said Mr Dowling took him up a tower and showed him the view, then took him to a room and assaulted him.

The alleged victim did not tell anyone when he was a child but later, when he was married, told his wife about the assaults.

He said when his wife rang up Mr Dowling, accusing him of being a paedophile, Mr Dowling replied “that was a long time ago”.

He said he eventually went to the police after reading in news reports that Mr Dowling had admitted abusing five boys when he was a teacher at a private school in the 1960s.

Mr Dowling is currently serving a jail term for those offences.

http://www.bbc.com/news/uk-england-cornwall-37225234

Tributes paid as Bude man retires as diocesan communications officer after 25 years

A RECENT service at Truro Cathedral paid tribute to the work of Jeremy Dowling, the Diocese of Truro’s Communications Officer, who steps down at the end of December after more than 25 years in post. He has lived in the Bude area for more than 40 years.

On a wet and windswept evening, a congregation made up from clergy and people from across the diocese enjoyed a service that included readings, hymns and a sermon given by the former Bishop of Truro, Bishop Bill Ind. Also present were the current Bishop of Truro, The Rt Rev Tim Thornton, the Dean of Truro, The Very Rev Dr Christopher Hardwick, both Archdeacons and Mr Martin Follett, the Diocesan Registrar.

During his sermon, Bishop Bill paid tribute not only to the work that Jeremy undertook as Communications Officer but also his very substantial other work for the Diocese including nearly 40 years as a Reader,

seventeen years as Chairman of the House of Laity of the Diocesan Synod, one of the first people to be made Lay Canons of the Cathedral, a member of the General Synod for 27 years, as well as sitting at one time or another on virtually every Board and Committee of the Diocese.

He said, “Jeremy’s media and broadcasting skills are second to none.”

His experience and expertise in the television broadcast area was particularly noted, especially the background work he was able to do which led to programmes such as the very successful and popular BBC series ’Seaside Parish’ featuring Boscastle and the surrounding parishes, which enjoyed weekly audiences if over three million, ’Island Parish’ featuring the Isles of Scilly and ’The Monastery.’

Summing up, Bishop Bill said: “He has been a critical friend, someone who has told me the truth as he sees it. He has made me and indeed others both laugh and think and for both these things and much else I remain profoundly grateful. The Diocese owes him an enormous amount and so indeed do I and a host of others.”

Jeremy Dowling has lived in the Bude area of North Cornwall for more than forty years, with thirty years spent in the parish of St Gennys, and he is Chair of Governors of Budehaven Community School.

In his thanks and response to Bishop Bill, Jeremy noted how the communications role had changed greatly with much more emphasis today on electronic media. He acknowledged with gratitude the work of the local press and media, recognising its essential vitality and the key role it played in championing issues which were important for the church and for society.

“We have enjoyed excellent relations with the westcountry media” he said “and it has been a privilege to work with local journalists and broadcasters.”

He concluded by saying: “In my view, the strength of the Church remains in the local community. There is a lot going on. And the thread which runs through most of the stories is undeniably positive. They chronicle a vigorous, interesting, dynamic, eccentric and imaginative life in the church in Cornwall. Long may it

continue.”

After refreshments, a large bouquet was presented by Bishop Tim to Daphne Dowling in recognition of her support for her husband, and Jeremy was presented with a substantial cheque from parishes and individuals in the Diocese




Former Archbishop of Canterbury could face police probe into whether he broke the law by covering up for a paedophile bishop

  • Police are considering a formal inquiry into Church of England’s former leader
  • Lord Carey, 82, could face being interviewed under caution in investigation
  • Rev Peter Ball indecently assaulted 18 boys and young men from 1977 to 1992 
  • Former leaders could face criminal charges for not passing on abuse complaints 

The former Archbishop of Canterbury, Lord Carey, could face a police investigation into whether he broke the law by covering up for a paedophile bishop.

Officers are understood to be considering a formal inquiry to determine whether the former leader of the Church of England and other senior church officials should face criminal charges over their failure to pass on sex abuse complaints made against ex-bishop Peter Ball.

Such an investigation would be highly controversial and may involve 82-year-old Lord Carey being interviewed under caution.

Sources say police are collecting evidence and scrutinising a scathing Church of England report commissioned by the current Archbishop of Canterbury, Justin Welby.

It concludes that senior church figures ‘colluded’ to protect Ball and says the decision by Lambeth Palace not to pass the complaints to police ‘must give rise to a perception of deliberate concealment’.

Lawyers representing victims of Ball, who have called for a police investigation, believe the former Archbishop could face a charge of misconduct in a public office, for which the maximum penalty is life imprisonment.

Ball, a friend of the Prince of Wales, (and other members of the royal family) was jailed for 32 months in 2015 after indecently assaulting 18 boys and young men between 1977 and 1992 in one of the biggest scandals ever to rock the Church of England.

It has been claimed, however, that he might have been convicted more than 20 years earlier had Lord Carey and his staff at Lambeth Palace not withheld from the police six letters making other claims about his behaviour. The letters were sent in by members of the public after allegations against Ball surfaced in the 1990s. Ball was arrested and subsequently resigned as Bishop of Gloucester in 1993.

But his only punishment at that time was a caution for gross indecency for molesting a teenage monk and he was later allowed a licence to work as a retired priest.

Peter Ball, pictured with Prince Charles, was jailed for 32 months in 2015 after indecently assaulting 18 boys and young men between 1977 and 1992

Last year, The Mail on Sunday revealed that Anglican officials who had privately reviewed the case suggested that had the letters been given to detectives in 1993, Ball may have been convicted of serious sexual offences.

The report commissioned by Archbishop Welby, published this summer, concluded that the ‘greatest failure’ of the handling of the case was the ‘management’ of the correspondence, in which Lord Carey was ‘significantly involved’.

Lord Carey strongly denies any cover-up or collusion. His supporters have also argued that Ball could still have received a caution in 1993 even if Lambeth Palace had handed the letters to the authorities.

David Greenwood, the head of the child abuse department at Switalskis solicitors and who represents a number of victims of Peter Ball, said the failure to pass them on provided ‘reasonable grounds’ for the Metropolitan police to open a formal investigation.

The Met and Lord Carey both declined to comment.

Lord Carey is already facing questioning next year by the Government’s independent inquiry into child sexual abuse.

http://www.dailymail.co.uk/news/article-5117815/Former-Archbishop-face-probe-paedophile-bishop.html

26 June 2017

Former Archbishop Lord Carey resigns after review into child abuse

Dame Alun Roberts‏ @ciabaudo

This is NOT good enough. He should be taken to court for obstructing the course of justice!

Ex-Archbishop of Canterbury Lord Carey.
Ex-Archbishop of Canterbury Lord Carey. Credit: PA.

The former Archbishop of Canterbury Lord Carey has resigned after a review into child abuse.

Lord Carey has now left his last remaining formal role in the church.

He was criticised in an independent review of the church’s handling of abuse carried out by Bishop Peter Ball.

In 2015, Peter Ball, the former Bishop of Lewes and Gloucester from Somerset, was jailed for 32 months for sexually abusing boys and young men.

Disgraced Peter Ball who was once the Bishop of Gloucester.
Disgraced Peter Ball who was once the Bishop of Gloucester.

http://www.itv.com/news/westcountry/update/2017-06-26/former-archbishop-lord-carey-resigns-after-review-into-child-abuse/


The court heard that police documents in the 1990s revealed they received telephone calls of support for the disgraced bishop from dozens of people, including MPs, former public school headmasters, magistrates and a judge. In addition, his defence team claimed to have more than ‘two thousand letters of support… including letters from cabinet ministers and Royal Family,’ said prosecutor Bobbie Cheema-Grubb QC at the Old Bailey.

Keith Porteous Wood, National Secular Society executive director, commented: “Such volumes could not have been achieved without an huge orchestrated campaign. Copies of the letters should be examined, as complete a list as possible of writers and callers obtained, particularly for those of high profile as their support would have been especially influential. It should be established whose idea this was, who masterminded it and who carried it out.

Archbishop of Canterbury Justin Welby has recently commissioned an independent review of how the Church dealt with the allegations, but the National Secular Society has expressed concerns that the review will not have the scope required to establish the full extent of wrongdoing.

Speaking after sentence was handed down, Mr Wood said: “Much more important than Ball’s sentence is that this case has demonstrated the power the Church which has even recently bullied victims into silence and sought to curry favour with the law to let off perpetrators, or let them off lightly and impose reporting restrictions.

“Ball’s case is a disgraceful catalogue of the legal system letting him off at every juncture. Just last month, two serious charges were inexplicably ordered to ‘lay on the court file’ – presumably to be ignored at least until Ball becomes too old or unfit to stand trial, a ruse he has already tried.

“Abuse victims’ lives are often ruined by the abuse, they are much more likely to be substance abusers and vulnerable to suicidal impulses. One of Ball’s victims, Neil Todd, killed himself and another, Graham Sawyer of Briercliffe, said that he had wished at times that he were dead. He was adamant that ‘people at the highest levels of the Church are more concerned with ‘saving face’.”

Mr Wood said there were numerous examples of this evident in Ball’s case alone.

“Evidence abounds of an institutional culture of intimidation of victims, in effect compounding the abuse, robbing the victims of justice, and not just allowing the perpetrator to escape justice, but enabling them to continue the abuse.

“The extent to which the Church’s attitude has changed is as yet unclear. Several survivors were recently reported to have been told by Paul Butler, Bishop of Durham (responsible for dealing with abuse), that ‘the Church was too busy working on banking reform’ to have time for abuse responses, and his statement when Ball pleaded guilty was perfunctory, given the depth of the Church’s complicity and the extent to which that had increased the suffering of victims. Sawyer maintains that Bishop Butler ‘is out of his depth, and should step aside’.

http://www.secularism.org.uk/news/2015/10/former-anglican-bishop-peter-ball-jailed-as-victims-sue-church-of-england-over-cover-up

Moira Gibb Report on the Church of England and convicted paedophile Bishop Ball:

The report of Dame Moira Gibb into the Church of England’s handling of the abusive bishop Peter Ball makes shocking reading. It reveals a concern for appearance over reality, for the institution over the individual and, most of all, for the strong and powerful over the weak and vulnerable. From the moment the first victims came forward, the response of the church up to the highest level was one of institutional self-protection.

The complaint was not reported to the police, but only to the archbishop of Canterbury, then George Carey, who persisted long past the point of reason in hoping that his colleague was innocent. The police were not told until after the first victim to come forward, Neil Todd, had attempted suicide twice – and even then it was his parents and not the church who made the complaint. The diocese of Gloucester hired a former policeman to investigate, and if possible discredit, the witnesses.

After news of Bishop Ball’s arrest broke, Lambeth Palace received seven independent accusations about his earlier behaviour. Two were seen by Archbishop Carey, who replied to them personally. Only one of the seven, though, was passed to the police, and that the least damning. Lord Carey’s message to the diocese after Bishop Ball was arrested urged prayers for the bishop and said nothing about victims. After Bishop Ball had retired on spurious grounds of ill health and accepted a caution – though remaining in denial about his crimes – Lord Carey worked to have him rehabilitated. True, he did so with less ingenuity than Peter Ball’s identical twin Michael, himself a bishop, who has admitted allowing his twin to deputise for him at “one or two events”, even after his disgrace.

Lord Carey nevertheless gave Peter Ball £12,000 from church funds, leading to loud complaints from the brothers, who had wanted £20,000. He deliberately kept Peter Ball’s name off the Lambeth blacklist of unemployable clergy; he had the disgraced bishop to stay at Lambeth Palace twice; he attempted to find him work in South Africa (writing to Desmond Tutu for this scheme) and in prisons; he wrote to an American parish that “Peter was possibly the victim of a plot but that, of course, cannot be proved”. Lord Carey’s only objection to a full rehabilitation of Bishop Ball as a retired bishop was that it might provoke unfavourable publicity.

This was disgraceful, and the result has been a deserved disgrace. But it was part of a culture of privilege, power and make-believe that corrupted more than one bishop. Lord Carey’s successor, Rowan Williams did nothing to help Bishop Ball but very little and very slowly to hinder him either.

https://www.theguardian.com/commentisfree/2017/jun/25/the-guardian-view-on-abuse-in-church-of-england-reputation-deservedly-damaged

Richard Scorer‏ @Richard_Scorer

report on Bishop Ball a damning indictment of how the establishment in this country protect their own.

In 1993 the CPS agreed to issue Ball with a caution, rather than prosecute, after the personal intervention of then-Archbishop of Canterbury George Carey.

Alun:

In no way would I wish to influence the decision about Bishop Ball. No? But you did so pull the other one next time!

Alun:

I have only 2 explanations for this: 1) Carey condones abuse, or 2) he was protecting a friend of Bishop Ball.

Dr Andrew Watt @DrAndrewWatt

It’s important to know if Prince of Wales helped Ball. cf

Dame Alun Roberts @ciabaudo

for Ball was an honorable man. They are all honourable men. Including yourself Mr Carey!



Bishop Ball was given special treatment because he was mates with Prince Charles!


  Dame Alun Roberts @ciabaudo

Northleach = Ball = Harding = Jennings (lifelong Ball friend) = BigEars Coincidence?

Rt Rev David Jennings

With a little help from his friend: Ball promised to go abroad but went to stay on Charles’ estate.

 

 

http://www.macsas.org.uk/P%20Johnson%20Statement%208-9-15.pdf


previously…

Goddard inquiry: Outrage as bishop Peter Ball jailed for sex offences given public funding for legal team

A lawyer close to the inquiry said: “I was really surprised Ball was given funding. The issue is about how he was allowed to get away with it by the Church not about his offending. He has already been investigated and pleaded guilty.”

http://www.telegraph.co.uk/news/2016/07/30/goddard-inquiry-outrage-as-bishop-jailed-for-sex-offences-given/

Chris Stacey @chrisstacey1

He’s one of the gatekeepers I’ve seen campaigning in Lords to clear name of another Bishop Bell from 1950s. Children don’t feature at all

We cannot allow the Bishop Ball story to be put to bed! Ball’s links to paedophiles and royalty with links to paedos warrants scrutiny!

terryfletcher‏ @terry45336188
If he declined to pass on evidence to the police, doesn’t that make him culpable?

This video highlights ‘Lord’ Carey’s role in preventing the earlier prosecution of Prince Charles’ mate Bishop Ball

Not passing on information re. Bishop Ball was a criminal act on the part of ‘Lord’ Carey. What are the consequences?
How did ‘Lord’ Carey, a man who actively protected an evil paedophile bishop, make it to the top of CoE? Or have I answered my own question?

 
 
Image result for "robert alston" and "george carey"

Bishop Peter Ball, convicted, to Enoch Powell, fascist and alleged satanist and child abuser:

Peter Ball sending the love of God to Enoch and Pam! What a mistake!

Further evidence of close relationship between godly convict Bishop Ball and ‘Rivers of Blood’ Enoch:

Oh, just remind me again who were Enoch’s two aides and buddies! Ah, yes. Proctor and Denby!

Denby – Powell aide on the run

It is thought the armed hold up incident in Down St not far from MI5 offices, may have been linked to Ulster Loyalist terrorist organisations. The following day, Denby phoned an old friend – far right Tory MP Harvey Proctor – and told him he was going abroad.

Denby is said to have visited Ulster several times.

A specialist on shipping law, Denby visited both Iran and Iraq,

He is also alleged to have twice broken into the home of a former senior partner to search for private papers and to have falsified information to a building society so he could extend the mortgage on his Islington home.

Interesting that Barbara Hewson says satanic sexual abuse doesn’t exist while her cousin worked for Enoch Powell who is accused of just that

Why does the Gin Goblin so categorically deny the existence of satanic child abuse like this in Proctor’s home county?

Satanism in Sussex
LazerLight ‏ @Lazer_Light23
‘Four months earlier, in the weeks before Christmas, someone had visited churches in Lewes and smashed the model nativity scenes, tearing the heads off the plaster figures.’
Interesting that Enoch Powell corresponded both with Ball and Montagu who were both let off the hook by Skelhorn.
Can you see what it is yet?
Rev Peter Ball was one of many to correspond with Enoch. Others included Atkinson friend Tonypandy, another alleged abuser.

MI5 knew of cover-up over Cyril Smith child abuse, inquiry hears

9 Oct 2017

MI5 knew the country’s chief prosecutor had covered up a sex abuse inquiry into Cyril Smith but did nothing because it was not its job to expose paedophiles, an inquiry has heard.

Files released by the intelligence agency show it was aware that the Director of Public prosecutions (DPP) had lied to a newspaper over its decision not to prosecute Smith. But it decided not to make the information public because its duty was to ‘defend the realm’ rather than to expose a  prominent politicians accused of being a paedophile.

The disclosure came during the first day of hearings into how Smith, the former Liberal MP, was able to abuse boys at Cambridge House hostel and Knowl View residential school in Rochdale. Smith died in 2010, having never faced prosecution.

The Independent Inquiry into Child Sexual Abuse (IICSA) last night released an MI5 briefing note which showed how Sir Thomas Hetherington, the then DPP, had lied to a local newspaper about the existence of a 1970 police inquiry into allegations of gross indecency made against Smith.

Had the DPP admitted Smith had been under investigation, it would have led to a new inquiry and Smith being put on trial in his lifetime.

Hetherington had called a legal adviser in the intelligence agency to inform him of the press interest from David Bartlett, a journalist with  the Rochdale Alternative Press. The briefing note states: “After consultations, the DPP’s press representative had untruthfully told Bartlett that they had no record of this case. In fact their file closely accorded with the details given by Bartlett.”

The MI5 file from 1979

The memo, from the MI5 legal adviser and written in April 1979, goes on to suggest that the South African intelligence agency had been “trying to obtain compromising information about political figures” and that Smith was one of them.

The police investigation into Smith had been closed nine years earlier in 1970 by Hetherington’s predecessor Sir Norman Skelhorn who decided it was unlikely to lead to a prosecution.

Skelhorn’s decision was made despite a senior detective warning that the “sordid” accusations against Smith “stood up”.

Brian Altman QC, IICSA’s lead counsel, told the inquiry: “The documents show that the Security Service’s legal adviser was informed of the false representations to the press from the DPP’s office.

“Based upon their review of the information they hold, the Security Service considers they took active steps to ensure that those involved in investigating allegations of child sexual abuse against Smith were made aware of all information of relevance to their inquiries.

http://www.telegraph.co.uk/news/2017/10/09/mi5-knew-cover-up-cyril-smith-child-abuse-inquiry-hears/?WT.mc_id=tmg_share_tw

ww

wording here starts off exactly like the torygraph article – so ‘official brief via No 10?’

https://www.theguardian.com/politics/2017/oct/09/mi5-knew-prosecutors-lied-press-about-cyril-smith-inquiry-told-rochdale?CMP=share_btn_tw

Don Hale report vindicated?

http://www.dailymail.co.uk/news/article-3004934/Ex-chief-constable-says-Cyril-Smith-cover-went-right-top.html

 

Skelthorn

https://www.theguardian.com/politics/2015/may/15/tory-mp-victor-montagu-escaped-child-sex-abuse-trial-in-1970s

 

 

Thatcher knowingly knighted child abuser

https://www.sunshinecoastdaily.com.au/news/thatcher-knowingly-knighted-child-abuser/3233018/

Was the Cabinet Ministers ever named who supported former bishop Peter Ball ?

 

Tory MP Tim Rathbone

Alun:

Rathbone was not only David Cameron’s godfather; he was also a relative. David Cameron is related to Queenie. Is that the secret to the support to Ball?

Establishment figures who helped disgraced bishop avoid prosecution for sex abuse revealed

http://www.telegraph.co.uk/news/uknews/crime/12076285/Establishment-figures-who-helped-disgraced-bishop-avoid-prosecution-for-sex-abuse-revealed.html

Bishop of Chichester Eric Kemp labelling Ball’s accusers as ‘mischief makers’

Dominic Walker was one of Ball’s biggest  supporters and he named POWELL, ABSE and WHITELAW as abusers.

 
 Lord Chief Justice Anthony Lloyd helped Bishop Ball with character ref 

 

Alongside Bishop Ball, Harvey Proctor and Bea Carthew, Enoch Powell also corresponded with Nicholas Soames, Proctor’s most ardent defender.

Prince Charles denies trying to help sex crimes bishop escape jail

Unnamed member of the Royal Family sent a letter of support for Peter Ball as prosecutors considered putting him on trial

http://www.independent.co.uk/news/uk/crime/prince-charles-denies-using-influence-to-protect-bishop-from-sex-crimes-prosecution-a6685366.html

David Cameron’s late godfather then Tory MP of Lewes, Tim Rathbone, who gave Mr Cameron his first work experience in the House of Commons.

Mr Rathbone, wrote that he found it “literally inconceivable” that Ball would ever become involved with anyone in the way described.

https://goodnessandharmony.wordpress.com/2016/01/02/establishment-figures-who-helped-paedophile-bishop-peter-ball-avoid-prosecution-for-sex-abuse-revealed/

Harvey Proctor being pronounced a saint by his buddies reminds me of the way Don’t-Carey took Ball under his wings.

Alun:

Interesting how Ball associated with Apartheid supporters but was in turn aided by Rathbone, an opponent of Apartheid.

https://i2.wp.com/www.kingsmeadschool.co.uk/rathboneobituary1.jpg

Former Lord Justice Anthony Lloyd and David Cameron’s late godfather Tory MP Tim Rathbone among figures who wrote in support of former Bishop of Gloucester, Peter Ball, one said he was a “saint”

 Interesting how Ball associated with Apartheid supporters but was in turn aided by Rathbone, an opponent of Apartheid.

Bishop of Chichester Eric Kemp labelling Ball’s accusers as ‘mischief makers’

Dame Alun Roberts‏ @ciabaudo

Northleach = Ball = Harding = Jennings (lifelong Ball friend) = Prince Charles Coincidence?

Image result for bishop ball and prince charles

22 June 2017

Church of England colluded with bishop who abused boys, says Welby

Report about bishop Peter Ball, finding collusion over 20 years, is ‘harrowing reading’

Collusion: Secret or illegal cooperation or conspiracy

Senior figures in the Church of England colluded for a period of 20 years with a disgraced former bishop who sexually abused boys and men, a damning independent report has found.

The archbishop of Canterbury, Justin Welby, said the report on the church’s handling of former bishop Peter Ball made “harrowing reading”.

“The church colluded and concealed rather than seeking to help those who were brave enough to come forward. This is inexcusable and shocking behaviour,” he said.

“To the survivors who were brave enough to share their story and bring Peter Ball to justice, I once again offer an unreserved apology. There are no excuses whatsoever for what took place and the systemic abuse of trust perpetrated by Peter Ball over decades.”

Two former archbishops of Canterbury, George Carey and Rowan Williams, apologised to the victims of Peter Ball after being criticised for their failures in relation to him.

Ball, the former bishop of both Gloucester and Lewes, was jailed in October 2015 for the grooming, sexual exploitation and abuse of 18 vulnerable young men aged 17-25 who had sought spiritual guidance from him between 1977 and 1992. He was released from prison in February after serving 16 months.

His trial heard that after Ball was first accused in 1993, a string of senior establishment figures – including Carey, an unidentified member of the royal family, cabinet ministers and a high court judge – came forward in his support, writing letters to the police and Crown Prosecution Service.

Ball was cautioned by police. He resigned his post as bishop and retired to a rented cottage on the Prince of Wales’s Duchy of Cornwall estate but continued to officiate in 17 public schools until 2007. A fresh investigation was opened in 2012 which led to his conviction.

One of Ball’s victims, Neil Todd – the first to come forward with allegations of abuse – attempted suicide three times before killing himself in 2012.

Welby ordered an independent review of the church’s handling of the case, chaired by Dame Moira Gibb, former chief executive of Camden council.

The report said Ball’s case was dealt with at the highest levels within the church. He “was seen by the church as the man in trouble who the church needed to help”.

Ball was portrayed as a victim, and the review found “little evidence of compassion for Neil Todd even though from the outset it was clear that he was a vulnerable young man who had come to harm”.

It added: “The church appears to have been most interested in protecting itself.”

In the foreword to her report, An Abuse of Faith, published on Thursday, Gibb said the serious sexual wrongdoing of Ball “is shocking in itself but is compounded by the failure of the church to respond appropriately to his misconduct, again over a period of many years”.

“Ball’s priority was to protect and promote himself and he maligned the abused. The church colluded. The church colluded with that rather than seeking to help those he had harmed, or assuring itself of the safety of others.”

The report added, “progress has been slow and continuing, faster improvement is still required”.

Gibb made 11 recommendations in her report, including improving support to survivors of clerical abuse and taking steps to “demonstrate the individual and collective accountability of bishops”.

Peter Hancock, the C of E’s lead safeguarding bishop, who received the report on behalf of the church, said it had failed Ball’s survivors. “Having read the report I am appalled and disturbed by its contents … As a church we colluded, we failed to act and protect those who came forward for help. There are no excuses. We accept all the recommendations and are working to action them.”

Rowan Williams: ‘It is clear I did not give adequate priority to sorting out the concerns and allegations surrounding Peter Ball.’

He added: “For the survivors, it may feel this is all too late.”

According to the report, Ball intimated “on many occasions, to Lord Carey and others, that he enjoys the status of confidant of the Prince of Wales” and “sought to exploit his contact with members of the royal family in order to bolster his position”.

 

The Royal family with the Archbishop Rowan Williams at Windsor Castle for wedding of Prince Charles and Camilla Stock Photo

The Royal family with the Archbishop Rowan Williams, beside protected padophile Bishop Ball, at Windsor Castle for wedding of Prince Charles and Camilla Parker Bowles

Goddard inquiry: Outrage as bishop Peter Ball jailed for sex offences given public funding for legal team

Bishop Ball with Prince Charles and Camilla. Ball gave the homily at the funeral of Camilla Parker Bowles’s father, Major Bruce Shand, in 2006

Image result for moira gibb and prince charles

Image result for moira gibb and prince charles

Moira Gibb is made a Dame CBE by the Prince Charles at Buckingham Palace back in 2012

However, Dame Moira Gibb’s report went on, it “found no evidence that the Prince of Wales or any other member of the royal family sought to intervene at any point in order to protect or promote Ball”.

Image result for bishop ball and camilla funeral and prince charles

Carey was criticised in the report, which said he “set the tone for the church’s response to Ball’s crimes and gave the steer which allowed Ball’s assertions that he was innocent to gain credence”.

Image result for bishop ball and prince charles

In a statement responding to the report, Carey said it made “uncomfortable reading” and he accepted its criticisms of him. “I apologise to the victims of Peter Ball. I believed Peter Ball’s protestations and gave too little credence to the vulnerable young men and boys behind those allegations.”

Carey said he regretted not putting Ball’s name on the Lambeth List – names of people whose suitability for ministry is under question – after he was cautioned.

Under the leadership of Williams, the church began reviewing past cases, a move which ultimately led to the criminal case against Ball being reopened, the report said. However, he was criticised as being “lamentably slow” in making change.

In a statement, Williams said: “Having read the report and reflected on its details, it is clear I did not give adequate priority to sorting out the concerns and allegations surrounding Peter Ball at the earliest opportunity. I recognise such a delay is likely to have increased the pressure and distress experienced by the survivors of his abuse and I am sincerely sorry for this.”

https://www.theguardian.com/world/2017/jun/22/church-of-england-colluded-with-bishop-peter-ball-who-abused-boys-says-justin-welby?CMP=Share_iOSApp_Other

Chris Stacey @chrisstacey1

He’s one of the gatekeepers I’ve seen campaigning in Lords to clear name of another Bishop Bell from 1950s. Children don’t feature at all

 

 

Sex abuse bishop Peter Ball released from prison

  • 4 February 2017

Peter Ball, 84, was jailed for 32 months in October 2015 after admitting a string of historical sex offences against 18 teenagers and young men.

The former bishop of Lewes and Gloucester was released from jail on Friday after serving 16 months.

Phil Johnson said he had served “less than a month for each of the victims”.

Richard Scorer, a lawyer representing a number of Ball’s victims, said his early release was “an affront to justice” and “a huge blow to his victims”.

“This was a man whose appalling crimes represented a gross and systematic abuse of trust spanning decades,” he said.

He said the sentence handed down to him was “in no way proportionate to the crimes committed”, and it seemed he had been freed “at the earliest opportunity”.

In February 2016, the Archbishop of Canterbury, Most Rev Justin Welby, commissioned an independent review of the Ball case.

Mr Johnson said its publication was not likely “for several more months”.

“I think it’s utterly ridiculous that it’s taken longer to write a report on what happened than it has for Peter Ball to serve his jail sentence,” he said.

http://www.bbc.com/news/uk-england-sussex-38868834

 Article from the Sunday Times Magazine 29/1/17, just a few days before the former Bishop Peter Ball was released from prison.

Powerful figures intervened when Ball was investigated for abusing novice monks.

Neil Todd, a trainee monk reported the bishop for sexual abuse in 1992. He committed suicide 20 years later aged 38.

Ball was jailed for 32 months in 2015. There was reportedly considerable and unseemly negotiation between the defence and the CPS

Letters in Support of Bishop Peter Ball Make Extraordinary Reading. Also recording featuring Baroness Butler Sloss

Prince Charles’ bishop ‘friend’ is freed from prison early – despite committing horrific sex offences against 18 teenagers and young men

A predatory bishop who had links to Prince Charles has been freed from prison halfway through his sentence for sex offences.

Peter Ball, described as a ‘monster’ by his victims, served only 16 months for grooming and molesting aspiring novice monks. One victim committed suicide while others have suffered long-lasting trauma.

Survivors condemned the early release of the 84-year-old former Bishop of Lewes and Gloucester.

He was jailed for 32 months in 2015 for offences against 18 teenagers and young men between 1977 and 1992, but was allowed out on licence at the halfway point of his sentence.

Richard Scorer, an abuse lawyer at Slater and Gordon who represented some of Ball’s victims, said his early release after ‘a gross and systematic abuse of trust spanning decades’ was ‘an affront to justice’.

Ball was first investigated in 1992 but escaped with a caution. It emerged later that an unnamed royal was among Establishment figures who had written in support of Ball at the time.

After his caution, Ball was provided with a Duchy of Cornwall home by Prince Charles. Ball counted Charles as a ‘loyal friend’


Mr Scorer added: “What is equally frustrating is that despite his conviction we still have not got to the bottom of which establishment figures – including MPs, cabinet ministers and members of the Royal Family – came out in support of him in the 1990s and prevented justice being served then.

“This is a disgrace and those who suffered at Ball’s hands deserve answers.”

One of Ball’s victims said: “Ball’s crimes led to one of his victims committing suicide so how can 16 months in jail be justice?

“There are still many questions that need answers about who helped him cover up his crimes and what happened.

“What is crucially important is that the inquiry into child abuse answers these questions before it is too late.”
The CoE said Ball has been prohibited from ministry for life.

However the National Probation Service has had to draw up “bespoke” licence conditions with the Church so he can continue to exercise his right to worship.

It is understood that the bespoke licence conditions in place are very strict, and include Ball being forbidden from doing or wearing anything that would give him clerical status, or from leading a service.

A Ministry of Justice spokesman said sex offenders are “robustly risk assessed and subject to a strict set of conditions”.

“If they fail to comply, they can be recalled to prison,” the spokesman said.

The Archbishop of Canterbury, Most Rev Justin Welby, has commissioned an independent review – led by Dame Moira Gibb according to reports – into how the Church dealt with the allegations against Ball.

Last year the Telegraph revealed the Church of England was investigating evidence that Ball took services in the place of his identical twin brother in the 1990s, who was then the Bishop of Truro.

It emerged that he may have taken services in Cornwall, where his brother Michael was a former Bishop of Truro.

link

Revealed: Charles’ dozens of letters to ‘calculating’ paedophile bishop as victims demand they are made public

Jan 27 2017

  • Prince Charles is believed to have written to paedophile bishop Peter Ball 
  • Ball was jailed two years ago for using his position to groom 18 young men 
  • The former Bishop of Gloucester exchanged letters with Prince Charles 
  • Clarence House stressed the letters are not connected with Ball’s case 

Victims of a paedophile bishop last night called for dozens of letters he received from Prince Charles to be made public.

Extensive correspondence is understood to exist between the future king and Peter Ball, the ‘calculating’ former Bishop of Gloucester, who was jailed after admitting exploiting his position to groom and abuse 18 young men.

The prince’s letters now have been handed to an independent inquiry into the case, launched after Ball was convicted two years ago.

It is not clear what role, if any, they will play in the inquiry which is examining the Church’s handling of the Ball case, but Charles has not given any evidence to it either formally or informally nor has he or his team been asked to.

The content of the letters is unknown, but in a statement yesterday, Clarence House said they believed there was nothing in them which pertained to the case.

A spokesman for the prince said: ‘We do not believe that the letters have any bearing on the issues before the inquiry, but we have not objected to them being shared for their consideration.’

Royal sources insist it would be perfectly normal for the future king to write to the priest, who in 1992 became Bishop of Gloucester, the diocese in which Charles’ country home, Highgrove, sits.

One said that the existence of letters between the two simply reflected their ‘long-standing acquaintance’.

Ball was Bishop of Gloucester which covers Prince Charles’s Highgrove Estate 

It is not clear if the prince continued to write to Ball after his well-publicised earlier arrest and police caution for gross indecency against a 17-year-old boy in 1993.

Ball escaped prosecution for this offence, despite investigators knowing of ‘many’ more allegations against him, after the police received dozens of supportive letters and calls from MPs, former public headmasters, JPs and even a Lord Chief Justice.

At the time his lawyers also told the police they had a letter of support from a member of the Royal Family, but prosecutors said they had not seen this correspondence and there is no evidence that this letter even existed.

 

However, Ball clearly did continue to enjoy cordial relations with the royals as he read the homily at the funeral of the father of the Duchess of Cornwall in 2006

Image result for Dame Moira Gibb.

Prince Charles awarding honour to Dame Moira Gibb. Moira Gibb is made a Dame CBE by the Prince of Wales at Buckingham Palace back in 2012

The letters from Charles are understood to have been handed to the Church of England’s independent inquiry, which is being led by former council chief executive Dame Moira Gibb.

A Church of England spokesman said: ‘We are supplying the inquiry with all information relevant to the inquiry’s purposes as set out in its Terms of Reference.’

The Government’s separate child abuse inquiry is also due to investigate whether there were ‘inappropriate attempts by people of prominence to interfere in the criminal justice processes’ after Ball was first accused of child sexual offences 24 years ago.

Phil Johnson, one of Ball’s victims and chairman of the Minister and Clergy Sexual Abuse Survivors group, last night called for the letters to be made public in the ‘spirit of openness.’

He said: ‘I think the victims have a right to know what is in them. They may of course just be innocent letters between friends. But given the grave concerns about how the case was handled, the public also have a right to know what the future head of state wrote to Ball for the avoidance of any doubt.’

After his second arrest in 2015, Ball claimed his victims had been ‘spiritually uplifted’ by his treatment of them. The court heard how he targeted young men seeking spiritual instruction on the Bishop’s ‘Give a Year for Christ’ scheme.

He changed his plea at the last minute and admitted to offences against 18 teenagers and young men between 1977 and 1992. He was sentenced to 32 months for misconduct in public office and 15 months for indecent assault, to run concurrently.

The lawyer for some of those he abused said the way establishment figures closed ranks around him had ‘compounded his victims’ anguish’.

Two years ago, 27 letters that Charles sent to ministers between September 2004 and April 2005 were published after a decade-long legal battle over their release that went to the Supreme Court

link

 

Second member of Fiona Woolf inquiry admits controversial links with Lord Brittan

Dame Moira Gibb, who is to sit with Fiona Woolf on the Government’s child sex abuse inquiry, confirms she also has a link with Lord Brittan

Dame Moira Gibb – who was appointed to sit on the panel along with a number of other experts – has admitted a close personal friend worked with Lord Brittan during part of the period which will be closely scrutinised by the inquiry.

In a letter to Theresa May, the Home Secretary, on October 17 Dame Moira said she had no “direct interest in the matters to which the inquiry relates”.

But just five days later she was forced to write to Mrs May again.

gerald-malone

She wrote: “I would like to set out that Mr Gerald Malone, whom I declared as a personal friend, informed me last night that he was Parliamentary Private Secretary to Lord Brittan in 1985 when Lord Brittan was Secretary of State for Trade and Investment, and a Government whip from 1986-1987.

Gerald Malone was a Conservative MP in Baroness Thatcher’s and Sir John Major’s governments.

As a trusted worker for Lord Brittan in the 1980s it is conceivable the sex abuse inquiry may wish to take evidence from him about Lord Brittan’s tenure at Home Office.

link

Auchi

Other career politicians on the board of General Mediterranean or its subsidiaries are former Liberal party leader Lord  Steel, former president of the European commission Jacques Santer, former Conservative chancellor Norman Lamont and former Tory health minster Gerry Malone, who is chairman of Regent.

www.theguardian.com/society/2003/apr04/health.business?commentpage=1

People don’t like Gerry Malone much. He’s seen as arrogant, unclubbable. ‘I had few friends in politics and it remains so.’ He’s a pal of Andrew Neil’s. John Major’s, too.

He now has a non-executive role in several companies, including Regent GM Laboratories, Ultrasis and Chiltern Invodex.

link

20 May 2003

It has been a long and varied career path from engineering student to teacher, social worker and senior director. …management experience on a four-strong executive board running Kensington and Chelsea council, west London.

She joins a growing list of social services directors making it to the very top in local government, moving to the north London borough of Camden as its £140,000-a-year chief executive.

Director of social services in Kensington and Chelsea since 1990

Gibb’s long path to the top began after a two-year engineering course at Glasgow University. She decided it was not for her, moved into teaching – secondary modern in Newham, east London -but soon decided to move on.

1979 Senior caseworker Gosforth Newcastle

gibb-newcastle

link

“I had a friend who was a social worker and, while I did not know what they did, I was enthusiastic,” Gibb says. She returned to Scotland for a social work degree course in Edinburgh, and then spent five years in Newcastle upon Tyne, working in the city’s tough Scotswood area.

After a spell teaching social work in Preston, she moved south to Surrey, becoming an adviser in child care, then joined the west London borough of Ealing – rising to assistant social services director, before joining Kensington and Chelsea in 1988 as deputy director. She was promoted to director two years later.

link

https://www.england.nhs.uk/about/whos-who/

Dame Moira Gibb is a non-executive member of the UK Statistics Authority.

Dame Moira is Chair of Skills for Care and Chair of City Lit Adult Education College.

She is a non-executive director of the NHS England and chairs its Investment Committee.

She is a member of the Council of Reading University. Her career was in social services and local government, latterly as Chief Executive of Camden Council. She was a Civil Service Commissioner from 2012-15 and a Director of the London Marathon from 2005-11.

link

Moira Gibb – social worker in Newcastle

Newcastle:

Brian Roycroft, Colin Gregg, Dawn Reed and Christopher Lillie – Newcastle City Council Nursery paedophile ring etc


Safe hands Moira Gibb also led William Vahey review

link

Malone is married to a leading Scottish doctor, Anne Blyth. He made tabloid headlines in 1995 when, still a minister, he attended a live sex show.

Mr Malone, who was a health minister in John Major’s government and is now editor of the European, has issued a formal apology to the title’s features editor, Nicola Davidson, after making a drunken sexual approach to her and then hitting her around the head when he was rebuffed.

http://www.independent.co.uk/news/exminister-in-trouble-after-striking-journalist-1165912.html

…He initially became chairman of Regent GM, one of Britain’s biggest suppliers of generic drugs to the NHS, before moving to his current role as chairman of Ultrasis, which specialises in computerised cognitive behavioural therapy software.

But controversy has never been far away where Malone is concerned, and last year he faced an unprecedented challenge to his role in a shareholders’ revolt. Susan Malin, a 42-year-old accountant, stood for election to the board following a row over executive pay, claiming the company was being run “like an old boys’ network”. Unlike the people of Winchester, however, the shareholders stood by him, and the former Tory minister lives to fight another day.

http://www.totalpolitics.com/history/45348/where-are-they-now-gerry-malone.thtml

Re-entering Parliament

Seat of Winchester

He re-entered parliament in 1992, representing the “safe” Conservative seat of Winchester. He was appointed a Minister of State at the Department of Health in 1994, when Virginia Bottomley was the Secretary of State.

http://en.wikipedia.org/wiki/Gerry_Malone

…………………………………………………………………………………………………………………………………………….

BUPA Nursing Awards

Production of Award Ceremony in the presence of the Prime Minister (1991): The Princess Margaret (1992); Virginia Bottomley (1993); Gerry Malone (1994); Secretary of State (1995).

http://s314663725.websitehome.co.uk/jon_laurie/old/live.htm

Nurses jeer Minister as strike looms Threat of action by 900,000 NHS staff

May 1995

NURSES were poised to tear up their long-standing no-strike rule after Ministers yesterday refused to back down on controversial local pay deals.

Junior Health Minister Baroness Cumberlege was booed and heckled by members of the Royal College of Nursing meeting in Harrogate for their annual congress, when she claimed that local pay bargaining was here to stay.

She ended with a defiant message for the Prime Minister, Health Secretary Virginia Bottomley, and Health Minister Gerry Malone.

”We will fight for nursing and for the health services of this country, to ensure that our campaign marks a turning point for nursing, and to use the tremendous support we have received to create a better future. We will fight to win this battle and move on to win the war.”

http://www.heraldscotland.com/sport/spl/aberdeen/nurses-jeer-minister-as-strike-looms-threat-of-action-by-900-000-nhs-staff-1.680450

http://www.heraldscotland.com/sport/spl/aberdeen/gps-to-spurn-malone-s-anti-fraud-prescription-1.47849

Moira Gibb – her views on physical punishment, response to Kensington and Chelsea abuse, and child deaths in Camden under her watch

Malone was  mp for Winchester from 1992 to 1997 (during which time he served as Minister of State for Health under Virginia Bottomley from 1994)

He became editor of the European and was forced to make a public apology for hitting the paper’s features editor, Nicola Davidson, around the head when she rebuffed a drunken sexual advance.

But what of Gibb herself? She has a long history in social work and local government, was president of the Association of Directors of Social Services, received a CBE in 2002, then was knighted in 2012. In 2009, she was appointed by then Children’s Secretary Ed Balls to head the government’s Social Work Task Force in the aftermath of the death of ‘Baby P’, and more recently was appointed to head a public investigation into how paedophile teacher William Vahey was able to drug and abuse 60 children at Southbank International School in London.

link


Anger over massive pensions gulf between local authority bosses and ordinary workers

24 March 2009

At least seven London local government bosses are heading for final salary pensions of more than £100,000 a year, the Evening Standard has learned.

They are the first of a new generation of high-earning council chiefs, now in their fifties, who can look forward to six-figure retirement incomes once their careers are over.

The size of the pensions has angered union leaders, who have drawn attention to the vast gap between the “fat cat” bosses at the top of the local authority earnings league and the average London council worker pension of around £4,000.

And three of those due for a windfall have been criticised for serious failings in their social services department after children died.

But councils said the pensions were justified. A spokeswoman for Camden council, where chief executive Moira Gibb is set to retire on a pension of more than £109,000, said: “All local government pension holders pay a proportion of their own wage into these pension schemes and for some people these reflect years of service.

Moira Gibb
Chief executive of Camden
Age: not disclosed
Salary: £210,000
Estimate local government career at retirement: 40 years
Annual pension: £109,375 (£2,187,500 pot)
Lump sum: £267,750

Moira Gibb qualified as a social worker after a short teaching career. She has worked in social services departments in Newcastle, Surrey, Ealing and Kensington and Chelsea.
Since being appointed as Chief Executive of Camden, four serious case reviews have been carried out into the death or serious injury of a child as a result of abuse or neglect. One, a six-year-old girl, was murdered in 2005 by her mother’s boyfriend, despite being on the child protection register. Ms Gibb announced a restructuring of children’s services “to improve the welfare of all children”. The next year a two-month-old boy died after “horrific” abuse.

link

THE woman leading the Baby P taskforce faces questions after two children died from abuse on her watch, the Evening Standard can reveal.

Children’s Secretary Ed Balls appointed Moira Gibb from Camden council to review social services across England in the wake of the Baby P scandal. But a series of failings by Ms Gibb’s social workers in two separate cases raised concerns over her suitability for the role.

An Evening Standard investigation found that four inquiries have been held into the death or serious harm of a child from suspected abuse or neglect in Camden in the last five years.

Among the victims was a six-year-old girl, Ukleigha Batten-Froggatt, who was murdered in 2005 by her mother’s boyfriend, despite being placed on Camden’s child protection register. Her mother was also killed in the attack.

Social workers failed to check the police records of his mother’s boyfriend, who was revealed as a convicted child sex attacker with a “troubled” past.

Children’s Secretary Ed Balls appointed Moira Gibb from Camden council to review social services across England

Haringey’s MP, Lynne Featherstone, questioned the appointment of Ms Gibb in light of the other cases in Camden.

“This is concerning information,” she said. “It must, unfortunately, put a question mark over Ed Balls’s choice. He should look into the background here so we are reassured over his choice to lead the taskforce.”

Ms Gibb, who has been chief executive of Camden since 2003, said she did not “seek” the role but was asked to take it on.

link

NHS England Board

Dame Moira Gibb: Non-executive Director and Chair of the Investment Committee

Image of Dame Moira Gibb - Non-executive Director and Chair of the Investment CommitteeDame Moira Gibb is Chair of Skills for Care and Chair of City Lit Adult Education College. She is a non-executive director of the UK Statistics Authority and a member of the Council of Reading University.

Her career was in social services and local government, latterly as Chief Executive of Camden Council. She was a Civil Service Commissioner from 2012-15 and a Director of the London Marathon from 2005-11.

Paedophile bishop and a cover-up by the Church lasting 23 years: Scandal deepens

Peter Ball – who was eventually jailed after admitting the abuse last year – benefited from a ‘deeply sinister cover-up’.

Secret documents claimed that he had been let off 23 years ago to ‘prevent a scandal in the press’ – despite the Church of England being told he was a serial abuser. Ball resigned as Bishop of Gloucester in 1993, but returned to work within two years.

The report was compiled at the time by a private detective working for Ball’s legal team. It warned senior figures that Ball had been ‘abusing not only his office but many young men’ and had confessed to his behaviour.

Image result for moira gibb and prince

Its existence was reported by the BBC and it was described as being for the information solely of the Bishop of Chichester, the late Eric Kemp, and the then Archbishop of Canterbury, George Carey.

The documents also indicate the private investigator frequently got to his victims before police did. They also made it clear that Ball had confessed to abusing boys.

However the documents alleged the bishop was let off with only a caution after his lawyers spoke with a ‘sympathetic’ police officer, Wayne Murdock. He returned to work within two years and moved to the Bath and Wells diocese until 2010.

Now details have emerged for the first time of a secret report by a private detective to help Ball’s defence.

According to the BBC, the documents showed that Mr Murdock had discussed with Ball’s legal team ‘the need to prevent a scandal, especially as Peter was a frequent visitor to Sandringham and is friendly with Prince Charles’.

A source, who has seen some of the secret documents, told the Daily Mail: ‘After Ball was arrested the Church hired a private detective to aide his defence.

Prosecutors have already conceded that the decision not to prosecute Ball in 1993 was ‘wrong’ as there was enough evidence to bring charges.

But it emerged that at the time of his arrest, leading Establishment figures – including two Archbishops of Canterbury, Tory MPs, a senior judge and public school headmasters – mounted an extraordinary campaign to protect hi


In 1993, Ball resigned in disgrace after receiving a police caution for committing an act of ‘gross indecency’

ball 1 article 1993

“Evil bishop drove me to suicide”- this Telegraph article about his abuse  was published in Mar 1993

0

Ball escaped with a police caution despite statements from other young men who claimed to have suffered at his hands and  Prince Charles provided Ball with a grace- and-favour mansion on his Duchy of Cornwall estate in Somerset.

The mother of one of Ball’s victim’s said: “This is quite unbelievable. I don’t know what Prince Charles thinks he is doing.

“The man ruined my son’s life and should have been locked away.

“Instead he now lives in luxury on one of the finest estates in the country.

“I don’t feel Ball was ever properly punished – but the fact that the prince has given sanctuary to this pervert is staggering.

link

Bishop escaped abuse charges after MPs and a royal backed him, court told

link

ball and charles and camilla

2006 Prince Charles and Peter Ball  at a memorial service for Camilla’s father Major Bruce Shand at St Paul’s Church in Knightsbridge, London

link

11 July 2016

Lord Carey told the BBC that he had placed Peter Ball on a list of priests banned from the ministry.

But Sussex police documents, released under an Freedom of Information (FOI) request, suggest Ball’s name was not included.

The documents also  indicate Ball associated with other sex offenders in the clergy and that he was investigated in 2008 for being part of a suspected paedophile ring.

ball and rideout

Peter Ball with Peter Canon Gordon Rideout, from Polegate, East Sussex, who was jailed for 10 years in May 2014. He  was found guilty of 36 separate sex offences by a jury at Lewes Crown Court.

http://www.bbc.com/news/uk-england-sussex-36767415

http://aanirfan.blogspot.com/2016/07/famous-eastbourne-people.html

Image result for gordon rideout guilford
Gordon Rideout

Canon Gordon Rideout was the vicar of All Saints Church in Eastbourne for 25 years.

Clergyman Canon Gordon Rideout was chaplain at Moira House School, Eastbourne, until 2003, and chairman of governors at Bishop Bell C of E School in Eastbourne until November 2011.

Clergyman Canon Gordon Rideout was a serial sex offender who preyed on young children across the south of England.

In 2013, Rideout, 74, was jailed for 10 years at Lewes Crown Court after being convicted of two attempted rapes and 34 indecent assaults on 16 boys and girls

In the 1970s Canon Gordon Rideout was taken to a military court on child sex-abuse charges.

At that time Rideout was chaplain on a military base.

GORDON RIDEOUT; PEDOPHILE RING

link

Gordon Trevor Rideout back in court Dec 21 2016

Maybe he’s applying for compassionate relief again?

link

rideout-trial-detail


http://ichef.bbci.co.uk/news/320/media/images/53006000/jpg/_53006174_53006173.jpg

Peter Ball was in regular contact with Vicar Roy Cotton, a convicted paedophile priest.  Cotton took children to visit Ball.

50428892_butler_slosspa

2011 Baroness Butler-Sloss was appointed by the Diocese of Chichester to carry out the review which looked into the behaviour of Cotton and another paedophile priest, Colin Pritchard.

link

link

Bishop turned ‘blind eye’ to Bexhill vicar’s abuse, inquiry hears

06 March 2018

A damning image of ‘wilful blindness’ in historic cases of sexual abuse of children who were ‘terrified and silenced’ by clergy in Sussex has been set out at a public inquiry. Fiona Scolding QC, lead counsel to the Independent Inquiry into Child Sexual Abuse (IICSA), said yesterday that abuse that left an ‘indelible scar’ on children was often ignored or forgiven.

In one segment, Miss Scolding described abuse by a Reverend Colin Pritchard, former vicar of St Barnabas’ Church in Bexhill and a church in Sedlescombe. She said: “There have been suggestions about the culture of abuse operated by Reverend Pritchard and that Bishop Peter Ball turned a blind eye to that abuse.” Pritchard was arrested in 1997 on suspicion of sexual offences, and again in 2007. Miss Scolding said: “There were no restrictions upon his ability to attend church or be involved in ministry with children from his arrest until July 2007.

Reverend Pritchard, who was vicar of St Barnabas in Bexhill, pleaded guilty in 2008 to seven counts of sexual assault on two boys and was jailed for five years. Pritchard – now known as Ifor Whittaker – was convicted last month of sex offences against a boy and jailed for 16 years. The crimes were when he worked in Sedlescombe, police said. Speaking on behalf of the Diocese of Chichester and Archbishops’ Council for the Church of England, Nigel Giffin QC said the Church’s response to abuse in the last few decades was ‘not nearly good enough’. The IICSA inquiry will look into how far institutions failed to protect children from sexual abuse within the Anglican Church. It focuses on abuse within the Diocese of Chichester, which covers all of Sussex, as a case study. Miss Scolding said: “As a society we have over the past 10 years had to examine some uncomfortable truths about our wilful blindness to such abuse.” Richard Scorer, speaking on behalf of many of the victims, said: “The Church of England claims to offer moral guidance to the country yet clerical sexual abuse cases powerfully undermine the claim. This leads to the cover-up of abuse. “The question is whether the Church can be trusted to put its own house in order.” In a statement, Archbishop of Canterbury Justin Welby said: “The failures that we have seen are deeply shaming and I personally find them a cause of horror and sadness. “That children have been abused within the communities of the church is indeed shameful.” The inquiry continues.

https://www.bexhillobserver.net/news/crime/bishop-turned-blind-eye-to-bexhill-vicar-s-abuse-inquiry-hears-1-8404108

Baroness Butler-Sloss Report

 

Former Sussex priest jailed for sex abuse against boy

Feb 22 2018

Ifor Whittaker

Ifor Whittaker was previously known as Colin Pritchard

A “disgusting and despicable” ex-Anglican priest has been jailed for sexually abusing a boy and conspiring with another priest to abuse the child.

Image result for Colin Pritchard

Ifor Whittaker, formerly Colin Pritchard, was convicted of abusing the boy, aged between 10 and 16 when the abuse happened in the 1980s and 1990s.

The 73-year-old also conspired with ex-clergyman Roy Cotton, who has since died, to commit sex acts.

Whittaker, of Rectory Road, Sutton, south London, was jailed for 16 years.

He was told he will serve a minimum of 10 years in prison. He is already a registered sex offender for life after a previous conviction.

Sentencing Whittaker, Judge Paul Tain described the priest’s behaviour as “disgraceful, disgusting and despicable”,

He said: “It was an obvious and clear case of grooming, where he carefully manipulated a vulnerable child.”

Whittaker had “attempted to bamboozle, cheat and mislead the jury”, the judge said.

He said the abuser had “plied the victim with alcohol” and “emotionally blackmailed the boy by saying ‘no one would believe you over a priest'”.

Sedlescombe parish church

The boy had been invited by Whittaker to do gardening work at the church

Whittaker, a former rector of Sedlescombe, near Battle, was convicted of seven counts, which also included gross indecency and inciting the boy to commit gross indecency.

The offences took place between February 1987 and February 1993 in East Sussex, Hove Crown Court was told.

The jury was told Whittaker was a “predatory paedophile” and had organised and facilitated the abuse with Cotton, who worked as a priest in Brede, near Rye, in the 1990s.

He died in 2006 and was never prosecuted.

The victim, now in his 40s, told the court Cotton had been the main abuser and had “just passed me over like a toy to be borrowed by a friend”.

‘Quite forceful’

The court heard the abuse began after he was invited to do gardening work at the church by Whittaker in return for pocket money.

Whittaker and Cotton “had an agreement” and Cotton would often take the boy to and from Whittaker’s house, it was said.

There were also occasions at Cotton’s house when, after abuse had taken place, Whittaker would “suddenly immediately appear in the room as if he had been watching”, the jury heard.

Whittaker’s victim described him as “quite forceful, quite scary”.

The jury was told Whittaker had previously pleaded guilty to gross indecency and indecent assault in 2008 over offences which had take place in Wellingborough in Northamptonshire against teenage boys in the 1980s.

‘Profound regret’

In 2010 Baroness Elizabeth Butler-Sloss was appointed by the Diocese of Chichester to carry out the review into how the two priests were allowed to work at East Sussex churches following the earlier sex abuse allegations.

The diocese apologised “unreservedly” after Baroness Butler-Sloss’s report criticised both senior clergy and Sussex Police over how they dealt with historical claims of abuse by Cotton and the then Colin Pritchard.

Following Whittaker’s latest conviction, the Diocese of Chichester issued a statement saying: “We express our profound sorrow and regret to the victim in this case and our admiration for their courage and determination in coming forward.

“The abuse of children is both a travesty and a tragedy and a complete betrayal of the Christian faith.

“This case demonstrates once again why it is so important to listen to those reporting abuse.”

http://www.bbc.com/news/uk-england-sussex-43141768

THE former Bishop of Blackburn has been criticised in an inquiry report into child sexual abuse in his former diocese.

The Right Rev Nicholas Reade, the Bishop of Blackburn from 2004 to 2012, has been held to account by the Independent Inquiry into Child Sexual Abuse over his time as Archdeacon of Lewes, in the Diocese of Chichester.

The Rev Robert Coles admitted the alleged sexual abuse of a teenage altar server in the 1980s to Bishop Nicholas and a fellow clergyman, the inquiry was told.

But despite Coles confessing to sexual activity with the 15 or 16-year-old boy at his home, neither Bishop Nicholas nor his colleague disclosed this information to police, following the former’s arrest in 1997.

Coles, who was a parish priest across the southern diocese, faced no criminal action at the time.

But an investigation was relaunched in 2012 and he was later convicted on two separate occasions of serious sexual offences involving young boys and given substantial jail sentences.

Referring to the 1997 disclosures, Prof Alexis Jay, the inquiry’s chairman, said in a final report: “Archdeacon Reade declined to report a serious indecent to the police, yet repeatedly sought to justify this failure on the basis that ‘he had not raped the boy’.

“Coles should have been reported to the police and subject to disciplinary action or a risk assessment.”

The inquiry heard that Coles sexually groomed a child in 2007-08. He was officially retired but still continued to officiate.

Mr Reade was also found to have defended another minister, Rev Roy Cotton, who had a past conviction for indecent exposure involving a boy in a church organ loft in the 1950s.

Cotton, an ‘Anglo-Catholic’ was supposed to only be allowed to celebrate Mass at his retirement home but officiated in public several times when children were present, the inquiry report disclosed.

He was investigated twice over allegations that he abused boys in the 70s and 80s, with another disgraced minister. Three victims came forward to make accusations. No criminal action was taken but Sussex Police’s inquiry was found to be ‘inadequate’. Cotton, who was the subject of later church and judicial inquiries, died in September 2006.

Prof Jay, referring to Cotton’s case, added: “This was a clear example of the diocese failing to prioritise its responsibilities for children and young people.

“Its concerns seem to have been led by pastoral concerns for Cotton, rather than the danger he posed to children.”

The current Bishop of Blackburn, the Right Rev Julian Henderson, this week wrote to all clergy in the diocese, calling on them to learn lessons from the inquiry’s findings.

Mr Reade was Archdeacon of Lewes before being appointed Bishop of Blackburn in 2004. He retired in 2012.

The child sex abuse inquiry was prompted by revelations that no fewer than 20 individuals with connections to Chichester Diocese had been convicted of sexual offending against children, including Peter Ball, the former Bishop of Lewes and later Bishop of Gloucester, over the past 50 years.

In her findings, Prof Jay said: “The Church must take action to ensure that this catalogue of errors does not occur again.”

https://www.lancashiretelegraph.co.uk/news/17721096.former-bishop-of-blackburn-failed-to-tell-police-of-boys-sexual-abuse/?ref=twtrec

Update: 26 Apr 2017

Colin Pritchard

Colin Pritchard is accused of seven offences against a boy

A former Anglican priest has been charged with sex offences against a boy in the 1980s and 1990s.

Ifor Whittaker, 72, formerly known as Colin Pritchard, is charged with seven offences involving the boy, who was aged between 12 and 16 at the time.

He is accused of conspiring with ex-clergyman Roy Cotton, who has since died, to commit sex acts with the boy.

Mr Whittaker, of Rectory Road, Sutton, south London, is due to appear before magistrates on 24 May.

He is also accused of gross indecency and inciting the boy to commit gross indecency.

The offences are alleged to have taken place between February 1987 and February 1993 against the boy in East Sussex.

Mr Whittaker was vicar of Sedlescombe, near Battle, and it is claimed the offences took place there, Sussex Police said.

http://www.bbc.com/news/uk-england-sussex-39724639

In 2014, Butler-Sloss covered up for Peter Ball when she kept allegations about bishop Ball’s abuse out of a report.


1aaasloss

peter-ball-vic-housePeter Ball with Vickery House in 1986

Rev Vickery House charged with 8 sex offences which took place between 1970 and 1986 in
East Sussex and Devon.

The police investigated allegations of sexual offences by Ball against 19 young men and boys, in East Sussex and elsewhere between the 1970s and the early 1980s.

Vincent S. aged 10 yrs, from Grafton Children’s Home, was taken to Elm Guest House and to a house in Bexhill, in East Sussex.
John Stingemore lived in Bexhill in East Sussex.
 
John Stingemore was deputy head of Grafton Close children’s home

John Stingemore at the trial of Peter Sutcliffe..linked to Savile..linked to McSweeney…

Sussex Police received a complaint about a sexual assault by Sir Jimmy Savile in Worthing in Sussex.
Nicholas Rabet ran a children’s activity centre in Sussex.
He lived at Cross-in-Hand, near Heathfield, for five years before moving to Asia, and was suspected of having had sex with up to 300 underage boys.
Adrian Johns, former resident of Bryn Alyn children’s home, died in a 1992 fire aged 32 in Brighton, East Sussex. Verdict – unlawful killing
peterblickbexhilleastsussex

Peter Bick lived in Bexhill in East Sussex.

On 23 April 2012, a former altar boy, Christopher Hunnisett, 28, appeared in court accused of murdering Peter Bick, 57, as part of a campaign of hate against paedophiles.

Bick is believed to have been a friend of Prince Philip. Bick shared a love of carriage racing with Prince Philip.

Police found Peter Bick, 57, dead in his flat on January 11 201.

COURTS Clergy/Glazebrook
Hunnisett,  alleged that he was abused by Rev Ronald Glazebrook, above.
2001
The Oxford-educated cleric, who was a headmaster at schools in Pakistan and Zimbabwe before returning to Britain to become the warden at an East End drop-in centre, retired to the Sussex resort almost 20 years ago.
Many knew him through Christ Church in St Leonards-on-Sea.
Image result for gordon rideout guilford

image140

cnkozgowiaa8bic

ball at wedding

2005 The wedding of Prince Charles and Camilla Parker Bowles

Lambeth Palace was warned that Peter Ball, a close friend of Prince Charles and who attended his wedding to Camilla Parker Bowles in 2005, was a serial abuser of boys and young men shortly before he resigned as Bishop of Gloucester in 1993.

link

Ball resigned as Bishop of Gloucester following the caution and a short time later Prince Charles invited him to live in a lodge house owned by the Duchy of Cornwall in Aller, Somerset.

He described the Prince of Wales at the time as ‘a loyal friend’.

88_big

Peter Ball lived at Manor Lodge in Aller, Somerset, provided by Prince Charles on the Duchy of Cornwall estate (Guide Price £375,000)

Former Archbishop of Canterbury Lord Carey wrote to police in 1993 with letters of support for the then Bishop of Gloucester Peter Ball who was being investigated for sex offences

religion-rt-rev-michael-ball-and-twin-brother-rt-rev-peter-ball-church-gc581m

1993 Rt Rev Michael Ball and twin Brother Rt Rev Peter Ball – Church House – Westminster

link

carey-praying-for-ball

Carey praying the name of Bishop Ball will be cleared.

The Guardian

London, Greater London, England

Monday, January 4, 1993 – 3

52107552-prince-charles-meeting-the-archbishop-of-gettyimages

In one of Lord Carey’s letters he told police it was “improbable”  that Peter Ball was guilty.

The Old Bailey was told a member of the Royal Family and other establishment figures backed Ball while he tried to avoid charges of sexually abusing young aspiring priests in the early 1990s.


Church failed to pass Peter Ball abuse evidence to police in 1993

11 July 2016

Sussex

Church leaders failed to give police incriminating evidence about disgraced former Bishop Peter Ball in 1993, according to Sussex police documents.

Ball, 84, was jailed last year for sex assaults on 18 teenagers and young men in the 1970s, 80s and 90s.

ball 1 article 1993

March 14 1993 Sunday Telegraph enlarged image here:  ball sunday-telegraph-p-ball-14-3-93

He courted a niece of Sir Anthony Eden (former prime minister)

Peter Ball was governor of Radley, Wellington and Lancing

Bishop Ball 1977 - THE QUEEN has appointed a monk as Church of...

2 March 1977

The Queen has appointed a monk as – Church of England bishop for only the third time in living memory…Father Peter Ball. The two other modern monk-bishops have been the late Rt Rev Walter Frere, Bishop of Truro, 1923-35 and the Rt Rev Trevor Huddleston, the present Bishop of Stepney

Truthseeker1 @thewakeupcall09

Bishop Peter Ball, Tom Driberg & Trevor Huddleston all went to Lancing College and are all paedophiles.

Some of Peter Ball’s “schemers” were sent to work with the Community in Uruguay

Neil Todd, the teenage aspirant monk who was sexually abused by Ball, said  bishop Ball told him that the Prince had written him personal letters. He didn’t say what was in them …Then he told me they were in his safe and added: “One day they will be very valuable.”’

link

“…complained to the police, who then spent 15 weeks turning out every cupboard in Ball’s life over the past 20 years.

Whatever else the police found – and there may well have been other allegations – they evidently decided to take no further action.”

link

highgrovehserex_468x346

Peter Ball and Jimmy Savile were close and visited Prince Charles at Highgrove often.

Staff at Highgrove, the Prince of Wales’s country home, had grown accustomed to these intimate exchanges when the Rt Rev Peter Ball, the now disgraced Bishop of Gloucester, came to offer solace and enlightenment to their boss.

49d1de7907fddd01162e71bea3887651a5af1468

Prince Charles has a strange temple at Highgrove.

During his time in Lewes, Peter Ball got to know Jimmy Savile well.

Ball was bishop of Lewes between 1977 and 1992

link

Image result for SAVILE AND PRINCE CHARLES

and Jimmy Savile was bishop Ball’s principal entree into the Waleses’ household.

 

Always wondered why the friendship between them? An odd couple.

AnnaStillHereRaccoon

Mutual interests?

LazerLight @Lazer_Light

“Nobody will ever know what you have done for this country Jimmy. This is to go some way in thanking you for that.”


Image result for SAVILE AND QUEEN

Truthseeker1 @thewakeupcall09

Lot No 524 ‘THE QUEEN FIXED IT FOR JIM’ Jim’ll Fix It badge.

 

 

This York Student Television project from 1992 makes clear reference to Jimmy Savile’s paedophile tendencies.

https://youtu.be/H35BXwksW-s

Published on Oct 31, 2012

This York Student Television project from 1992 makes clear reference to Jimmy Savile’s paedophile tendencies. The source description says it originates from 2nd February 2011 but the end credits twice state clearly 1992. It seems to attempt to shy away from literal sodomy on Savile’s part but there are clear and unambiguous sexual references including a direct allegation of paedophilia.

Description

Jim’ll Sodomise You was a one-off short spoof of Jim’ll Fix It. It features David Bartlett wearing a tracksuit and glitzy wig and covered in bling, doing a not-bad impression of Jimmy Saville.

The idea being that Jim in this case would not fix it, and would thereby sodomise your ambitions (rather than literally sodomise you).


Bishop Peter Ball and Jimmy Savile were close and visited Prince Charles at Highgrove often.