John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader charged with buggery of a 14-yr old.


Update

Former Croydon headteacher John Coatman has buggery convictions annulled by High Court judges due to police and Crown Prosecution Service errors.

18 Apr 2017

A retired headmaster who had been found guilty of gross indecency with a 14-year-old boy has had his conviction nulled due to police and Crown Prosecution Service errors.

John Coatman, 76, a former headteacher at St Andrew’s Church of England High School in Waddon appealed to the High Court to overturn his conviction for historic sexual abuse at the Old Bailey in August.

Senior judges this month overturned the jury’s verdicts that Mr Coatman, who had also been honoured by the Queen for his services to young people, had sexual activity with the teenager in the 1970s.

Three judges at the Royal Courts of Justice quashed his outstanding convictions on April 6, ruling that Mr Coatman should not have faced the charges under section 1 of the Indecency With Children Act 1960 and section 13 of the Sexual Offences Act 1956.

The Right Honourable Lady Justice Hallett DBE stated: “Both (the police and Crown Prosecution Service) were wrong (to pursue these charges).

“The appellant could not be charged with offences under section 1 because of the age of the complainant at the time and could not be charged with offences under section 13 because they were time barred.”

Mr Coatman could not have committed an offence against a 14-year-old boy in 1973 under Section 1 of the 1960 Act because the law did not relate to alleged victims of that age until 2001, Lady Justice Hallett ruled.

Buggery charges levied against Mr Coatman under Section 13 of the 1956 Act – provided at the time under the heading ‘Indecency with Men’ – were ‘inapt’, the judge ruled, because the alleged conduct amounted to an assault towards a victim, rather than a sexual act with another man.

Lady Justice Hallett added: “Over the last few years this court has issued repeated warnings about the dangers of poor drafting of indictments in cases of alleged ‘historic sexual abuse’.”

A Crown Prosecution Service (CPS) spokesperson said: “We have contacted the complainant in this case to explain the issue and apologised.

“The CPS has issued advice to our specialist sexual offences prosecutors about the appropriate offences to charge in these particular circumstances, to reflect the changes in the law and recent Court of Appeal judgements.

“Cases currently before the courts have also been re-checked to ensure the error does not happen again.”

http://www.yourlocalguardian.co.uk/news/15230961.Former_headteacher_has_buggery_convictions_anulled/

The judges said the Crown Prosecution Service (CPS) was “responsible for this deeply regrettable state of affairs” and added a new case could potentially be brought against Mr Coatman alleging different charges.

Mr Coatman was made an MBE in 2012 for services to young people. During his trial he told the court he had worked with about 22,000 young people in his lifetime,

http://www.croydonadvertiser.co.uk/former-croydon-head-teacher-cleared-by/story-30254096-detail/story.html


Ex-head teacher John Coatman appeals conviction after being found guilty of gross indecency

A jury at the Old Bailey in August found John Coatman, 75, guilty of gross indecency with a boy in the early 1970s

Coatman, of Leyburn Gardens, was due to be sentenced at the Old Bailey today, but applied to the Court of Appeal to overturn his conviction. He did not appear in court himself.

The hearing was indefinitely adjourned by Judge Richard Hone, who previously warned Coatman, who taught for 42 years, to expect a jail term.
link

Update: August 26, 2016

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader found guilty of gross indecency with young boy

John Coatman, leader of Urban Saints Youth Group, Croydon was warned by Judge Richard Hone QC that he faced a jail term. He is due to be sentenced on September 30.

Sexual contact took place on about four or five occasions.

In emotional testimony in front of the jury, the man – who was 14 at the time at the time – broke down in tears as he described the alleged abuse taking place 

“… the effects of abuse on a young person can be quite traumatic…”

The survivor also said Coatman had asked whether any other boys he knew “might be interested”.

 link

link

 

377e2a9100000578-3753419-image-a-3_1471886185455
A retired headmaster, John Coatman, has been charged with having sex with a 14-year-old boy he met through a Christian youth group in the 1970s.

Jurors heard that at the time of the incidents, Coatman was not only the headteacher of a secondary school in south London (St Andrew’s Church of England High School), but was also involved in a Christian group for boys.  

The name of the Christian youth group is – Crusaders/now called  Urban Saints Youth Group organisation – Cliff Richard’s group

http://research.omicsgroup.org/index.php/Urban_Saints

http://www.dailymail.co.uk/news/article-3753419/Retired-headmaster-75-head-sex-14-year-old-boy-met-Christian-youth-group-1970s.html

Mr Coatman, who described himself as a bachelor told jurors that the topic of sex did crop up during youth group meetings, but only in reference to passages in the Bible involving “Christian aspects of sexual behaviour”, he added.

link

John Coatman MBE Supporters

From a lonely John Coatman testimonial website (comprised of a handful of supporters)

Testimonial by Victoria Swainson

“…I also did my bronze and silver Duke of Edinburgh awards outside of school, through a group organised and led by John (Coatman), and attended a residential Crusaders weekend on the Isle of Wight, again which he’d organised”

 Testimonial by Dr Amy Kendrick

 My name is Amy Kendrick and I was a pupil at St Andrew’s Church of England School in Croydon between 1992 and 1997.

http:///search?updated-min=2015-01-01T00:00:00-08:00&updated-max=2016-01-01T00:00:00-08:00&max-results=3

Dr Amy Kendrick – related to evangelical songwriter Graham Kendrick?

Graham Kendrick

Special commissions from such charities as Tear Fund, the Children’s Society, Church Army and Care for the Family, have resulted in songs of compassion and justice. They have been sung at major public occasions – including the Dunblane memorial service.

Festival of LightAmong these were Malcolm Muggeridge, Lord Longford, Bishop Trevor Huddleston and Cliff Richard. Among the performers were Cliff Richard, and Graham Kendrick.

link

link

Truthseeker1‏ @thewakeupcall09

Crusaders launch Network for Revival

General Eva Burrows, Rev David Coffey, Rt Rev Michael Hare-Duke, Rev Selwyn Hughes, Rev Dr Donald English, Gerald Williams, Rt Rev Dr James L Weatherhead, Jill Dando, Most Rev Desmond Tutu, Rt Rev Stanley Booth-Clibborn

Gyles Brandreth – part of Lord Longford’s porno junket – (which included Jimmy Savile and Cliff Richard)…

Amongst those who were included, and who stayed the course, were singer Cliff Richard and Radio One DJ Jimmy Savile, alongside more obvious suspects like Malcolm Muggeridge (he had spoken at VALA’s first convention, declaring that ‘if Till Death Us Do Part is life, I cannot see that there would be anything to do but commit suicide’) and the Rt. Revd Ronald Ralph Williams, the Bishop of Leicester,

 

 

Here is a list of people who signed off on Longford’s porn report in 1972

There were 47 signatories, with three notes of reservation from Kingsley Amis, Elizabeth Jane Howard and David Goodbourn (from Times, Sep. 20th, 1972):

Mr Kingsley Amis
Professor J. N. D. Anderson
Dr. G. R. Beasley-Murray
Miss Dorothy Berridge
Mrs Sara Binney
Lieutenant-Colonel Sir Ian Bowater
The Rt Rev Bishop B. C. Butler
Professor Francis Camps
Sir Frederick Catherwood
the Rev Thomas Corbishley SJ
Lord Justice Edmund Davies
Mr Peter Dawson
Mr Dennis Delderfield
Lord Douglass
Lord Dulverton
Dr. Stanley Ellison
Canon S. H. Evans
Lord Fletcher
Mr Frank Gillard
Mr David Goodbourn
Mr Peter Grosvenor
Professor Agnes Headlam-Morley
Mr David Holbrook
Miss Elizabeth Jane Howard
Mr Martin Hughes
Miss Angela Jones
Mr Herbert Kerrigan
Mr Peter Kettle
Mr Ronald H Kirkwood
The Bishop of Leicester, Dr Williams
Mr John Godfray Le Quesne, QC
The Rev Joseph McCulloch
Miss Carol McCullough
Lady Masham
Mrs Mary Miles
Mr Malcolm Muggeridge
Mr Jeremy Murray-Brown
Mr Cliff Richard
Mr Basil Rooke-Ley
Mr Jimmy Savile
Dr. Christine F. T. Saville
Dr. Peter D. Scott
Mr James Sharkey
Lord Shawcross
The Rev. Lord Soper
The Bishop of Stepney Dr. Huddleston
The Rev. K. M. Steven
Colonel S. J. Watson
Mrs Shiela Wiltshire
Mr Peregrine Worsthorne
The Archbishop of York Dr. Coggan
Mrs. P. S. Ziegler

link

 

logo2x

The Tear Fund charity was created out of the Evangelical Alliance (EA) and the Evangelical Refugee Fund created by the United Nations.

In January 1969 Cliff Richard did two fundraising concerts for Tearfund at London’s Royal Albert Hall. He has served as the charity’s Vice President and in 1999 served as its president

article-1053130-026e2fc900000578-126_468x311

Life-long bachelor Cliff Richard – his manager and live-in companion of more than 30 years, Bill Latham (right) was  hugely involved with charity work and was in “on the start of Tearfund”

In 1972  Latham was Deputy Director of Tearfund and had been instrumental in persuading Jean Le Maistre, a Christian politician on the island who was just launching Jersey Overseas Aid, to take a team for his first project to a hospital in Nazareth.

link

cliff tear fund

1978 English pop singer Cliff Richard in concert for the Christian charity, Tear Fund.

jamesogilvyroyalweddingpreweddingdinneriaqmd75ldgtl

Julia Ogilvy  (centre)– a Trustee of Tearfund with Princess Alexandra and James Ogilvy

Julia Ogilvy is a member of the extended British Royal Family. She is the wife of James Ogilvy, the only son of Sir Angus Ogilvy and Princess Alexandra, The Honourable Lady Ogilvy, a granddaughter of King George V and first cousin of Her Majesty the Queen.

link

Jimmy Savile admitted getting knighthood was ‘a relief because it got me off the hook’

His OBE folder contained a handwritten letter from Angus Ogilvy

link

More on the Ogilvys- The Ogilvys

Testimonial by Joshua Woodcock
 John Coatman was at first my leader, then as i grew older my co-leader as i joined the team leading the group and even after i left a dear friend mine. My very first contact with John was at St Andrews school where he was my sisters head master.
I went to Wallington crusaders with John for the best part of 15 years
From mass groups of us walking over box hill in the middle of the night every year to may trips away to Westbrook on the isle of white.

John Coatman reckons he’s been to about 300 Crusaders camps over the years

link

img_0071

westbrook_new_website

westbrook20front

Westbrook started life as a large Victorian residence surrounded by 25 acres of mixed parkland that was purchased by Crusaders Union in 1948

The original intention of the Committee at the time was to use a Memorial Fund of just over £500 to purchase a field as a permanent camp site for the ever developing Crusader holidays

link

 Crusaders Youth Group/Urban Saints

(Notable Crusader Peter Broadbent 

RT REVD PETER ALAN BROADBENTdirector at George Carey’s son Mark Carey’s school ST.JOHN’S COLLEGE NOTTINGHAM LIMITED

Peter Broadbent became a Christian at 14 through ‘Crusaders’, a Christian youth organisation. He trained for the ministry at St John’s College, Nottingham.

link

link

broadbent

Ordained in 1977, His first parish job was as Curate to George Carey, when he was Vicar of St Nicholas, Durham. He  was at St Nicholas’ Church til 1980 and he was an Islington Labor councillor 1982-1990.)

Lord Carey is a director of Christian Weekly Newspapers along with RT REVD PETER ALAN BROADBENT

link

Other notable Crusaders

link

Donald Wiseman worked for military intelligence.

In 1942 he became senior intelligence officer of the Mediterranean Allied Tactical Air Forces.

Wiseman joined a special intelligence group handling the Ultra signals, deciphered at Bletchley Park.

Wiseman worked with the Christian Crusaders

Wiseman also maintained a close connection with the Crusaders organisation. He was leader of the class at Finchley, which included Cliff Richard

Martin J. Selman, “Donald J. Wiseman,” in Walter A. Elwell and J. D. Weaver (eds.), Bible Interpreters of the 20th Century (Grand Rapids: Baker, 1999) p. 309

http://aanirfan.blogspot.com/2016/06/cliff-richard-crusaders-military.html


1979 Margaret Thatcher immediately carried out her promise to slash public spending, recommending that heating be drastically rationed in offices and schools.

This led to a remarkable revolt in Westerham in October 1979 when rebel children from Churchill School, led by senior pupils, burned their text books and walked out in protest against the cold. When headmaster John Coatman went into the playing field to remonstrate, many returned. Around 50 to 60 protesters stayed outside until a caretaker confirmed that the boilers were on.

link

 T H E O L D W H I T G I F T I A N A S S O C I A T I O N , C R O H A M M A N O R R O A D , S O U T H C R O Y D O N , S U R R E Y

John A Coatman attended Whitgift (1952-59) as did his brother Robert William Coatman, MBE, JP

coatman family whitgift
Robert William Coatman, MBE
3007948-large
Robert William Coatman, MBE – ONE of Croydon’s longest-serving councillors.He was first elected as a Conservative for Croydon Central ward in 1966 and went on to represent its successor ward, Fairfield, until his retirement.

Councillor Coatman was elected in 1966 to represent Croydon Central ward, following a family tradition after his great-uncle, GF Coatman, represented Croydon Central in the 1920s

Bob Coatman was educated at Whitgift School and worked for 41 years as a chartered surveyor.

He was best known on the council for his role in planning – serving on the planning committee from 1968 and spending 16 years as its chairman.

 He was Mayor of Croydon in 1977-78.

In 1993, Mr Coatman was made an MBE for his services to local government, and he received a lifelong service award from the council in 2006.

He also served as a magistrate at Croydon Magistrates’ Court for 21 years from 1976.

Outside of council business, Mr Coatman was founder president of both the Rotary Club of Croydon South and the Croydon Mayors’ Association.

He had also been a member of the Croydon South Probus Club and the Old Whitgiftian Association and a longstanding member of the court of the Whitgift Foundation.

His interests included classic cars, he was  a member of the A40 Farina Club and the history of Croydon, and he was a member of the Croydon Corps of Drums.

coatman john

2012 John Coatman. Leader, Urban Saints Youth Group, Croydon – MBE for services to Young People. (London, CR0)

standrews

Coatman was head teacher at St Andrew’s until he retired in 1997 and was awarded with an MBE by The Queen in 2012 for his services to young people.

Life-long youth worker given MBE

A FORMER head teacher who has spent his life working with Croydon’s youth has been recognised for his services to young people.

John Coatman, who taught at St Andrew’s School in Warrington Road, has been appointed an MBE.

Mr Coatman joined youth group the Croydon Crusaders, now known as Urban Saints, in 1949 aged eight and rose to represent the club on a national and international level.

 John Coatman

John is very active “for his years”, keeps fit and loves to travel the world – he’s always looking for travel companions who can keep up with him.

Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people leading expeditions to Austria, a project which has secured European Union funding, and on countless Duke of Edinburgh Award trips.


Imperial College LondonJohn Coatman, BSc Civil Engineering 1962

link

link


Ten English Days or TED – by John Coatman, on behalf of the leadership team:

Coatman TED Austria

The expedition is being run as part of the work of Croydon Crusaders. Crusaders is a registered charity and the expedition is a charitable activity supporting the work of a charity in Austria. Please ask for information about gift aid.
EU GRANTS
In 2001, 2002, 2003, 2004 and 2005 we had generous grants towards the project from the European Union and we may be applying again this year.
This will be my seventh year leading the TED expedition so I know a great deal about where we are going and what we will be doing. For the first 3 years the trip was part of the Crusoe (Crusaders Overseas Expeditions) programme organised by Crusaders. From 2003 the same expedition has been run under my own Croydon Crusaders Group. Apart from that, all is the same and it is a great success. The 2006 trip is open to any Christian young person aged 15 to 25 who wants to serve God on a working holiday. For legal reasons, by applying they become members of Croydon Crusaders. I promise a great deal of fun in one of the most beautiful parts of Europe in a building that you will find tobe very hospitable and lovely. You will live in luxury but I also promise that you will work hard!
We will be going to Schloss Klaus in Upper Austria.

https://web.archive.org/web/20160823154816/http://www.youthblog.org/tedaustria2006.pdf

Schloss Klaus

link


b2zkx5aciaafnbm

One of our loyal readers, John Coatman of The Croydon Crusaders, decided to pop in this morning and say hello!

The Pass is a magazine inspiring the UK’s Group Travel Organisers.


2011 Croydon Council consultant – John Coatman Crusaders

https://www.croydon.gov.uk/sites/default/files/articles/downloads/appendices1-3.pdf


coatman com ck

Nature of business (SIC) – 7020 Letting of own property

https://companycheck.co.uk/director/906652625/MR-JOHN-ANTHONY-COATMAN/companies


WALLINGTON CRUSADER HALL

Crusader Hall in Carshalton, England

Charitable Objects

“To Be Used For All Or Any Of The Purposes Of The Wallington Crusaders’ Bible Class For Public And Private Schoolboys And Young Men In Such Manner As The Leader Of Learders For The Time Being Thereof Shall Think Fit Within The Limits Of The Trusts Hereinafter Declared And Subject To Such Terms And Obligations As May Be Agreed Between The Trustees And The Wallington Crusaders’ Bible Class Aforesaid.”

Operations

Operation Location(s) Domestic
Surrey
Sutton

Trustees

Name

CHRISTIAN AND SPORTING ACTIVITIES MOSTLY FOR YOUNG PEOPLE WALLINGTON 253811

253811 MR BOB HEDDERLY, MR DERRICK CHARLES LEWIN 462944 MR NOEL GODFREY CARPENTER 467551 ROBERT VERNON HEDDERLY 468174 IVAN RATNAYAKE 3266458 JOHN COATMAN 3266459


 

cr1970chtimes08_21x_zps3eca9245

1970 Cliff had just returned from spending two weeks at a Christian Crusader camp. Cliff has entertained many young people on a boat that he moors on the Norfolk Broads

 …………………………………….

Cliff Richard led an armada of five motor cruisers along the Norfolk Broads…Last night with 27 boys from the Crusaders’ Union...in his six-berth Pomander ...

cliff2b-2bnorfolk2bbroads2b

cr1972dexp04_04x_zps256ad2f4

cr1966chtimes11_18x_zps31ab0c54

link

cliff2bbroads

WHAT IS AN URBAN SAINTS GROUP ANYWAY? There was a bumper crop of Urban Saints family members included in the 2012 New Year’s Honours list by Her Majesty The Queen.

This included MBEs for John Coatman (for his work with young people in Croydon, including the Wallington Urban Saints group), Dr Avice Hall & Stephen Hammersley (for their work in education, the community and their own local groups, in St Albans and Harpenden respectively). Former Crusaders Director, Dr Alan Kerbey, received an OBE for his work with young people in education and another former staff team member, Colin Henry, was recognised for with a MBE, for services to education in his role as Chair of Governors at Christ’s College in Guildford.

URBAN SAINTS is the operating name of The Crusaders’ Union, a company limited by guarantee and registered in England & Wales, company number 07771037, charity number 1144923

https://companycheck.co.uk/company/07771037/THE-CRUSADERS-UNION/companies-house-data

http://docslide.us/documents/engage-spring-2012-56f388fd581ab.html


l-r-president-of-crusaders-steve-chalke-sir-cliff-richard

2006
Crusaders, the youth missionary movement, hosted “An Evening with Sir Cliff Richard” recently in Central London to celebrate its centenary.

Alongside Steve Chalke, the President of Crusaders, Sir Cliff shared his personal life and faith, as well as performing a couple of songs from his repertoire.

Sir Cliff shared openly about his early days as a young performer, his big break, his very public conversion to Christ and the significant role played by Crusader leaders in his early Christian journey.

He spoke fondly of his time with Crusaders.

Sir Cliff is Patron of the Crusaders

http://www.christiantoday.com/article/sir.cliff.richard.shares.faith.at.crusaders.centenary/8014.htm

 


Paul O’Grady: “He’s really been through it this year, poor Cliff. He’s had a terrible time.”

Cliff Richard to O’Grady: “…you and I we’ve stood side by side through the storms together and all through the years you have been golden”

sir-cliff-richard-and-paul-ogrady

Cliff Richard’s drag queen friend and supporter, Paul O’Grady worked at care homes where Jimmy Savile abused and where Crusaders (members of the organisation that Cliff Richard is patron of)  were charged with abuse.

lily-savage-580x350_73610a

Paul O’Grady as drag queen, Lily Savage (Carlton Television) worked for Camden Council Social Services

1004410

O’Grady worked at The Children’s Convalescent Home and School on Meols Drive, West KirbyMeols Drive, West Kirby

link

paul-o-grady-the-devil-rides-out

From his autobiography:

o grady children's home

link

Last night TV funnyman Paul O’Grady told how Savile was banned from being alone on a girls’ ward at a care home where the Lily Savage star once worked.

Paul says: “When I worked in a children’s home in West Kirby in the 1970s, Jimmy Savile came to visit.

O’Grady, recalled the “creepy” DJ, Jimmy Savile visiting the Conny Home in West Kirby, Merseyside, which housed disabled and abused children in the 1970s.

He said: “Some of the house mothers were told not to let him on the girls’
unit unsupervised.”

Esther Rantzen and Paul O’Grady

31d765e700000578-0-image-m-101_1457094029831

link

link

paul o grady crusaders quote

o grady crusaders

link

West Kirby Residential School, West Kirby, Wirral

A group of 10 claimants has already issued legal proceedings relating to claims for severe physical and sexual abuse from the mid 1970s to the early 1990s at West Kirby Residential School in Meols Drive.

Three men (Graham Charles Webb, Henry Christie, Matthew Johnson) received jail sentences at Liverpool Crown Court for their part in the physical and sexual abuse at the residential school.

*Former head of care Graham Charles Webb, was jailed for seven years in July 1997 for abusing boys at the school and at camps he helped organise.

Webb, who also worked for a well known Christian youth movement, admitted abusing 20 children over a period of almost 20 years.

https://theukdatabase.com/2013/05/04/west-kirby-residential-school/

(West Kirby Residential School, West Kirby, Wirral

Matthew Johnson was also at Balliol School, Sedburgh, Cumbria.

The former house parent, of Kirby Stephen, Cumbria, committed the offences on five pupils at the residential school and three boy scouts who were in his care when he was a scout master.)


And another Crusader leader charged with abusing boys:

Crusader leader vicar Rev David Henry McIntosh:

 

Crusader Graham Webb charged along with

fellow Crusader leader vicar Rev David Henry McIntosh:

Alongside McIntosh in the dock was 41-year-old Graham Webb, who was care head at a West Kirby residential school, and Bournemouth man Robert Moses.

Some of the charges involve both McIntosh and Webb, who were leaders of activity holidays.

FORMER West Kirby residential school head Graham Webb and a vicar face indecency charges.

23 May 1997

Rev David Henry McIntosh, of Fenwick Lane, Runcorn, has been bailed with sureties of £2,000. A condition of bail is to make no contact with Webb. They will appear at Crown Court to plea on June 12, after being directed to the higher court by Wirral magistrates.

http://www.wirralglobe.co.uk/news/7439630.Head_and_vicar_face_sex_trial/?ref=arc

 26 Mar 1997

The Rev McIntosh had been staying at an address in Fenwick Lane, Halton Lodge, Runcorn, but has now been moved to a secret venue which was not revealed in open court.

Reporting restrictions have not been lifted.

link

A Church of England VICAR, the Rev David Henry McIntosh,

who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

The court was told that the “shower games” took place during Crusader holidays at a boarding school in Swindon, Wiltshire, in 1988,1994 and 1995 and at a weekend gathering of boys for a reunion at a church commissioner’s house in Llandudno in 1994.

His position was made more serious by the fact he had helped draw up documents advising leaders about appropriate behaviour with the boys.

The Church of England vicar, who resigned from his post at Barnton, near Northwich, after his arrest last December, used to work as part of a ministry team in Ellesmere Port

He studied maths and physics at Durham University.

He is charged with 19 indecent assault allegations at West Kirby, Swindon, Minehead, Malvern and Cheltenham, four matters of gross indecency at West Kirby and two other offences brought under the Sexual Offences Act.

He had been involved with the Crusaders for longer than his involvement in the church, attending more than 40 holidays during that period of time.

link

link

 December 1997

 PERVERT VICAR JAILED

 A VICAR who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

McIntosh, who was camp chaplain at the holidays at Pinewood boarding school, Swindon, from 1988 to 1991, became overall holiday leader there in 1993.

The two boys whom McIntosh abused in Llandudno were both from an Ellesmere Port school where he was vicar.

https://theukdatabase.com/2012/04/23/david-mcintosh-swindonruncornwarrington/

link

link


 Another Crusader charged with abusing boys at a care home:

image-24m

Mr Gilbart-Smith… who had led the Crusaders children’s group for fifty years was accused of abuse

All the allegations were said to have involved Mr Gilbart-Smith and others at Greenfield House children’s hostel in Maidenhead, Berkshire.

During that time the court heard residents were subjected to sustained, systemic abuse at the hands of the home’s managers and numerous visitors.

The youngsters were repeatedly raped and even ‘loaned out’ to other paedophiles elsewhere.

Mr Gilbart-Smith, a successful businessman, was accused of being one of those who took part in the sex attacks.

http://www.dailymail.co.uk/news/article-1292277/Paedophile-suspect-doused-petrol-victim-court-dock-drama-acquittal.html

Nine men “horrendously abused” by a paedophile ring in a children’s home 40 years ago have received an out-of-court settlement totalling more than £300,000

The civil settlement came despite the fact that no-one has ever been convicted of criminal offences regarding the abuse at the council-run Green Field House in Maidenhead, Berkshire, between 1964 and 1970

The home was then managed by ex-soldier Don Prescott, who died about 19 years ago.

He used to abuse the boys and rent them out to other paedophiles as far afield as Leicester, London, Cambridge and Reading

https://theukdatabase.com/2012/04/21/green-field-house-childrens-home-maidenhead/

“Unfortunately for the boys staying at Green Field House, it was the centre of a paedophile ring numbering so many men some of the boys lost count of those who abused them.

“They suffered the most horrendous abuse – it was the worst type of sexual abuse. They were filmed, photographed and had to take part in the abuse.

“… it went on for six years.”

http://news.bbc.co.uk/2/hi/uk_news/england/berkshire/6195572.stm

Nine men all with children and grandchildren claimed to have been raped by Gilbart-Smith the Lloyds investor during their stay at Green Field House children’s home Maidenhead (Theresa May’s constituency).

Gilbart-Smith, offered no defence other than a denial and a moral smoke screen, as he claimed to be a “Christian” who was a church leader at Foxes Piece School, Newfield Road, Marlow. Gilbart-Smith also told the court that he was a Bible teaching missionary and friends with a David Pawson.

http://www.thepaedotrial.com/crown-court-paedo-defence/

link

The Prime Minister & The Nobbler

In 1970 the council in Theresa Mays Maidenhead constituency, brushed the horrific Green Field House child abuse scandal under the carpet, hoping  it would never again see the light of day.

The child abuse surfaced again some thirty years later in 2000. Maidenhead police investigated but there was insufficient evidence to proceed with a criminal case, so a civil case was pursued by two complainants.

For the following five years *RBWM, denied the abuse ever took place. However, on the 29th November 2006 RBWM were forced to accept responsibility, and they agreed to settle a £300,000 compensation claim with nine rape victims, plus the considerable legal costs incurred from a five year investigation by solicitors Dyer Burdett.

*When we reference RBWM we are referring to the Royal Borough of Windsor & Maidenhead or Berkshire County Council (BBC) whose responsibilities RBWM inherited and or their insurers.

 

http://news.bbc.co.uk/1/hi/england/berkshire/6195572.stm

RBWM by settling the claims and paying £300,000 in compensation, agreed with the claimants and the Dyer-Burdett legal team that the unnamed man mentioned in the BBC website article, was a paedophile and had raped and abused 4 of the 9 claimants.

To recover their loss, RWBM immediately sued the unnamed man, who promptly paid RBWM £300,000 to cover their loss.

On top of the £300,000 the unnamed man also paid RBWM’s legal bill, including the costs relating to Dyer Burdett’s five year investigation. However, before committing to settle this payment, the unnamed man insisted on the following caveats:

  • RBWM would keep his name secret.
  • RBWM would keep the amount of cash he paid them a secret.
  • RBWM would exclude him from any future claims if they paid compensation to any more of his rape victims. 

With total disregard for the spirit of the law and public funds, RBWM amazingly agreed to the caveats and struck a deal with the now self confessed paedophile. This secret paedophile deal included a substantial payment to exclude the unnamed man from any future claims, if RBWM compensated any more of his rape victims.

THE BELOW STATEMENT IS A FACT!

The amount the unnamed man paid was over £1,000,000!

TO PAY HIS PAEDO-BILL THE UNNAMED MAN TOOK THE FOLLOWING ACTION!

April 12th 2007, the unnamed man sold his family home of twenty five years, Winterberry Jobs Lane, Cookham, SL6 9TX, for £1,475,000,00.

 

Winterberry Jobs Lane Cookham

Around the same time the unnamed man sold Ballyhaise Quarry Road, Marlow, SL7 1RE for £1,251,423,00. Ballyhaise had been a family home for about 35 years.

MORE INVESTMENTS WERE CASHED IN INCLUDING CAPE MARCO HOTELS.

 

By 2010 RBWM had settled 21 individual compensation claims for abuse that had taken place at the Green Field House children’s home. RBWM settled more than 10 compensation claims for rape by the unnamed man. None of the later claimants were made aware that their compensation claim was being paid with money RBWM had received from the rapist in a secret deal. 

After three years of writing to Theresa May concerning the corrupt RBWM paedophile hush payment with ZERO response, the below letter & the book Rich Man Poor Man was sent to 100’s of MP’s.

 

Out of the 300 MPs the letter and book was sent to, one Scottish MP Brian Donohoe responded with a phone call.  Mr Donohoe suggested that I approach Theresa May through my local MP which at that time was Mike Thornton, I acted on Mr Donohoe’s simple advice.

In the below email to Mike Thornton MP, RBWM break their secret agreement and name (Denham) Gilbart-Smith as the unnamed man that paid the RBWM rape bill. 

 

2010 17th May

After a 2 year police investigation, Gilbart-Smith stood trial for 17 charges of raping and abusing 8 kids as young as nine. The secret RBWM deal was not allowed to be mentioned during the trial.

WATCH THE TRIAL VIDEO 

  •  Gilbart-Smith agreed with the prosecution that all of his friends that went to the children’s home were paedophiles.
  • Gilbart-Smith agreed to being an unpaid helper at the kids home and going on holidays with the children and the paedophiles.
  • Gilbart-Smith agreed to being at the numerous places where the children were raped sold and abused by paedophiles.
  • Gilbart-Smith’s only defence during the six week trial was, he didn’t know that his friends were paedophiles, he had no idea that the boys were being raped by his friends, and he personally did not rape or abuse any of the boys.
  • Nine men who for the best part hadn’t seen each other for 40 years all claimed to have been raped or abused by Gilbart-Smith.
    (One of the 9 made a complaint too late for charges to be made)
  • The purpose of a jury is to return a verdict based on the evidence presented to the court, this jury returned a verdict in total contradiction to the overwhelming and robust evidence. All the jury had to decide in what for all intense and purposes was a ‘cut and dried’ case was: “Who is telling the truth, the nine men who hadn’t seen each other for 40 years or Gilbart-Smith?”

Watch the video and cringe at Gilbart-Smith’s pathetic lies, a jury of ten year old kids would have seen through Gilbart-Smith’s nonsense and found him guilty. In The Nobbler it is very clearly outlined how Gilbart-Smith, with no defence WHATSOEVER would once again outsmart the system with his wealth. If Gilbart-Smith had access to one million or fifty million pounds, all of it would be worthless to him in jail. No more Michelin Star restaurants for Greasy-Gilbart just porridge.

With the prospect of disgracing the family name and spending the rest of his life on the monster wing with child murderers, paedophiles, rapists and every other vile creature under the sun. True to his modus operandi, Gilbart-Smith paid out a large sum of *cash to nobble the jury.

*This would be very easy to establish as fact, seven years on a simple financial investigation on the jury members starting with the foreman would prove very interesting.

In 2010 Gilbart-Smith ran *IMS an insurance company that insured policy holders against kidnapping, international terrorism and such like. So Gilbart-Smith was no stranger to spooks and double dealing in the murky world of international intelligence, espionage, and subterfuge. Gilbart-Smith would communicate with spy academy type characters on a daily basis in his work environment.

*Gilbart-Smith is no longer connected with IMS.

http://www.bbc.co.uk/news/10513751

The author of The Nobbler John Affleck was sent to prison for 12 months for contempt of the court for protesting against the corrupt verdict. Gilbart-Smith left court a free man with the tax payer paying his massive legal bill. Had the jury found Gilbart-Smith guilty, he would have had to pay his own legal fees, so if the content of The Nobbler book is truthful, Gilbart-Smith in effect paid for his jury nobbling activities with tax payers money.

Instead of suing John for slander and false accusations including tampering with the jury and the murder of three blackmailers, immediately after the trial at the age of 64 The Nobbler swiftly cashed in his assets and left the UK, leaving behind his children and grandchildren, he became a citizen of Northern Cyprus, a Muslim country that has no extradition treaty with the UK.

…………………………………

After John was released from prison Maidenhead MP Theresa May refused to answer any of Johns correspondence for the following three years concerning this matter. However, Mrs May did write to another of Gilbart-Smiths rape victims who lives in her constituency.

 

NOTE: Theresa May doesn’t respond to the question that was asked about the secret RBWM paedophile deal, but rather in typical politician fashion, she evades the question with statements like;

“we discussed your concerns”

“I appreciate your concerns” 

“I have raised this matter” 

“I noted the contents”

“In addition I have also raised this” 

“I hope this will be of use”

Theresa May was specifically asked whether the secret £300,000 RBWM payment was moral, legal or in the public interest? For whatever reason the now Prime Minister has refused to look into this matter.

Myself and numerous other victims and or their MPs including; Norman Baker MP, Mike Thornton MP, Nick de Bois, MP, John Redwood MP, Mims Davies MP have all written to Theresa May as MP then Home Secretary and now Prime Minister asking the same question and Theresa May has consistently refused to answer this very simple question.

ALL MP LETTERS  ARE IN THE JOURNALIST PACK

Prime Minister, instead of giving up salt & vinegar crisps for lent 2017, do you think it might be more appropriate for a person in your position to GIVE UP not answering a straight forward  simple question concerning the £300,000 rapist payment to the authority in your constituency?

 

On the 8th September John received a reply from Sarah Newton the minister for vulnerability at the Home Office. Incredibly Ms Newton advised John to complain to RBWM about the million pound plus payment that RBWM had received from  Denham Gilbart-Smith after RBWM accused Gilbart-Smith of raping around ten children in their care.

QUESTION FOR SARAH NEWTON THE MINISTER FOR VULNERABILITY

Dear Mrs Newton, Should I also complain to Mr Gilbart-Smith for raping me when I was a ten year old kid?

You really couldn’t make this stuff up, it’s taken five years to get that advice from the Home Office. 

http://thenobbler.com/


coatman mbe

Is John Coatman MBE  linked with these other Crusader leaders who have been charged with csa?

Is he part of a ring?

John Coatman reckons he’s been to about 300 Crusaders camps over the years”

link

“Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people”

link

Coatman …”rose to represent the club on a national and international level.”

link

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

“John (Coatman) was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member…”

policy statement urban saints

Coatman on the South East Regional Steering Group of the Urban Saints (formerly known as the Crusaders)

coatman steering group

The South East Regional Steering Group

The South East Regional Steering Group consists of  …

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

John was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member of the Croydon group.

link

John Coatman organised and took part in many residential Crusaders weekend on the Isle of Wight



crusader postcard

link

This Video May Prove Cliff Richard Is A Child Abuser

 “Richard faced accusations from four men, relating to the period between 1958 and 1983, but was never arrested or charged. The case was dropped by the Crown Prosecution Service in June, after it decided there was insufficient evidence to bring an action.”

I believe in the Devil, I spend more time with him than I do with God,” Would a devout Christian admit to that? I don’t think so.

link

proxy

Why does Kitty always refer to just one accuser (he) when he knows there were several?

link

it was 9 accusers…9!!! The file to CPS wasn’t blank! Good wholesome Christian who hangs about with shady characters


Misc info on Cliff Richard’s friend Paul O’Grady who worked at West Kirby Residential School

dsc_0390

Predator Savile’s attack on victim at High Royds Psychiatric Hospital in Menston

The hospital is located within in the City of Leeds metropolitan borough and was first opened on 8 October 1888 as the West Riding Pauper Lunatic Asylum. In 1988, Jimmy Savile assaulted a patient at the hospital’s 100 anniversary celebrations.[1]

It was in 1988 that Savile was a guest at a garden party to celebrate High Royds’ 100th anniversary, said local historian Mark Davis.

He was a frequent visitor” said Mr Davis, a trustee of the Friends of High Royds Memorial Garden

http://www.ilkleygazette.co.uk/news/news_local/10168697.Predator_Savile___s_attack_on_victim_at_High_Royds/#
link

Paul O’Grady used to work on one of the wards when I was there. He was a staff nurse and was training to be a comedian at the time.

http://www.highroydshospital.com/galleries/1902-2/

Menston

royds-hospital-to-st-marys-menston

High Royds Hospital to St Mary’s Menston School .6 mile


Menston

St Mary’s Menston Catholic Voluntary Academy

Perverts WILL be allowed to stay in the classroom

  • Teachers already cleared to return to work will not have cases reviewed

Image result for Geoffrey Bettley

Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Child porn: Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Geoffrey Bettley was allowed to keep working as a teacher even after he was convicted of possessing indecent images of children

Bettley was working at St Mary’s Catholic High School in Menston, West Yorkshire, when he was arrested for downloading nearly 200 images.

He was cautioned and placed on a ‘barred list’ by the Independent Safeguarding Authority, although his name was taken off last June.

His case was heard by the National College for Teaching and Leadership professional conduct panel, which concluded that he was not a risk to children and the DfE backed the decision.

Peter Saunders, of the National Association for People Abused in Childhood, said he had ‘zero’ confidence in the Government’s ability to tackle child-related offences.

Everyone is aghast at the failure to grasp the common sense that everything must be done to ensure that these people can never go near classrooms again,’ he said.

Bettley, who joined St Mary’s in September 2001 from Yorkshire Martyrs Catholic School, in Bradford, West Yorks, was suspended from his job on December 9, 2010, and dismissed a year later.

In October 2011 the Independent Safeguarding Authority banned him from working with children, but removed the restriction on 21 June 2012


Mr Bettley, does not, in the view of the Panel, represent a risk to children and young people.

NAME OF DECISION MAKER: Alan Meyrick
DATE: 17 May 2013

Geoffrey Bettley

Former Employer:
St Mary’s, Menston, variously known as St Mary’s Catholic High School and
St Mary’s Catholic Comprehensive School
______________________________________________

link

National College for Teaching and Leadership (NCTL)

NCTL deputy director Alan Meyrick


LazerLight ‏@lazer_Light23

Alan Meyrick was Assistant Private Sec to Peter Brooke in NI. Hmmm


Image result for peter brooke kincora

Alan Meyrick Assistant PS 1989-91

uk.linkedin.com/in/alan-meyrick-a85aa86


Kincora: ‘Highest profile people connected to abuse’ claim

 Peter Brooke stonewalled.

The Kincora Boys’ Home in east Belfast was at the centre of a child abuse scandal in the 1980s

link

Kincora controversy

In February 1990, Brooke told Kevin McNamara, Labour’s then Northern Ireland spokesman, that the Kincora affair had been investigated ‘as fully and thoroughly as lies within the power of the Government to investigate it, and that no purpose would now be served by a further inquiry’

In October 1990, Brooke conceded for the first time, that the reports about the Kincora home came to the attention of the police.

link


Peter Brooke was sworn of the Privy Council in 1988. He was made Chairman of the Conservative Party in 1987, and then Secretary of State for Northern Ireland in 1989.

During his time as Heritage Secretary, he oversaw the restoration of Windsor Castle following the fire that had struck the state apartments in 1992.

via ww

Image result for peter bottomley i will sue

Peter Brooke’s PPS was a chap called Bottomley.

His PPS for a time was Peter Bottomley (1990). In September 1984, Peter was Parliamentary Under-Secretary of State at the Northern Ireland Office.

I’ll sue if anyone links me to untrue paedophile claims, says Tory grandee Sir Peter Bottomley

  • Worthing West MP issues public denial of any involvement in child abuse 
  • Denied there had been a major Establishment conspiracy to cover up abuse

Curious that after studying economics at Trinity College Peter Bottomley became a truck driver.

a very unlucky MP, Peter Bottomley at 2 disasters..

No it’s 3 ….Kings Cross, Heysel Stadium and Kegworth

No, it’s 4: EGH

 so ice cream van & truck driver Bottomley present at 4 areas of interest – & thrives


Alan Meyrick

Deputy Director Teacher Regulation at the Department for Education

Shrewsbury, United Kingdom
Education Management
Current
  1. Department for Education
Previous
  1. General Teaching Council for England,
  2. General Medical Council,
  3. Home Office – Metropolitan Police Committee
Education
  1. University of Cambridge

Experience

  • Deputy Director Teacher Regulation

    Department for Education
    April 2012 – Present (4 years 7 months)
  • Chief Executive

    General Teaching Council for England
    March 2011 – March 2012 (1 year 1 month)
  • Registrar

    General Teaching Council for England
    2000 – 2011 (11 years)
  • Head of Registration Policy

    General Medical Council
    April 1999 – March 2000 (1 year)
  • Deputy Secretary

    Home Office – Metropolitan Police Committee
    January 1996 – March 1999 (3 years 3 months)
  • Personnel Management and Programme Manager

    Home Office
    February 1991 – January 1996 (5 years)
  • Assistant Private Secretary to Secretary of State

    Northern Ireland Office
    January 1989 – February 1991 (2 years 2 months)
  • Internal Management Consultant

    Home Office
    September 1987 – January 1989 (1 year 5 months)
  • Project Officer

    Home Office Prison Department
    September 1985 – September 1987 (2 years 1 month)

    HM Prison

    Education

    • University of Cambridge

      BA Hons, Theology and Religious Studies
      1982 – 1985
    • King Edward VI School

      A’ Levels, English, Religious Studies; French
      1976 – 1981

    Service


St. Mary’s Menston
Bradford Road
Menston
West Yorkshire
United Kingdom
LS29 6AE

Jimmy Savile:  Two separate attacks in High Royds Hospital at Menston, near Ilkley, which treated psychiatric patients, in the 1970s and 1980s.



09c92615-b2b3-060a-b8836710146cc270

Paul O’Grady appointed MBE by Prince Charles – The star said: “I’m delighted. Now I’m part of the Establishment.”

Prince Charles – friend of  “creepy” Jimmy Savile:

prince-charles-jimmy-savile


 

Paul O’Grady:

Even now, 40 years on, the TV host and comedian shivers as he relives the night he saved the 18-month-old youngster’s life while working for social services. (Camden Council Social Services)

He tells how he fled the flat where he was keeping watch on the baby after a terrifying confrontation with the little lad’s drunken father – and how the drama ended with him making a desperate phone call to the Salvation Army for help.

Paul O’Grady reveals the terrifying moment in 1976 … he feared for his own survival

 Paul O'Grady: The Sally Army and Me

Paul O’Grady, while employed by Camden Council Social Services 

 took a toddler to a pub where Adam Ant was playing

Reliving his unforgettable ordeal in 1976, Paul says: “It was a dangerous situation for the kid, and for me.

“There were a few times when my life and that of The Sally Army crossed paths, but that night is one of the most memorable.”

After heading to London in the 70s, a few years before conjuring up Lily Savage , Liverpudlian Paul, then 21, worked for Camden Council Social Services providing respite care for families at home.

He says: “I remember the mother of this child had to go to hospital for an operation so I was there to look after him. He was only 18 months.

“It must have been about 2am when there was a banging at the door. I answered it …‘What are you doing carrying on with my wife?” he said.

“I tried to explain I was a care worker, but he just told me, ‘I want my kid.’

“‘You’re not getting your kid, mate,’ I said. ‘I’m sorry, you’ve got to get through me first.’

So I took the child in the middle of the night…I hurried into this club next to Camden Town tube. I remember Adam And The Ants* were playing a gig there that night.”

“I asked the manager if I could use his phone to call my duty worker. But I couldn’t get through to him for some reason. So I called The Sally Army instead and said, ‘can you bloody help me?’

“And they came. And they didn’t ask lots of questions. They wrapped the kid in a blanket. We had a place of safety in Kentish Town and they took him there.

http://www.mirror.co.uk/tv/tv-news/paul-ogrady-reveals-terrifying-moment-7635112


Adam Ant’s father, Alfred Leslie Goddard (left), was jailed for preying on runaway boys nearly 30 years ago.

 Leslie Alfred Goddard  worked as a chauffeur.

 

*Stuart Leslie Goddard/Adam Ant’s father- Leslie Alfred Goddard- was jailed in 1987 with Sidney Cooke as part of the Dirty Dozen gang.

http://aanirfan.blogspot.com/2015/08/goddard-cooke-adam-ant-and-security.html

Boys had been hawked around “safe houses” and passed on to other members of the gang which included council porter Alfred Goddard, father of 1980s pop star Adam Ant.

The former council porter was a member of a gang that included Britain’s most notorious paedophile, Sidney Cooke, who was later convicted of the sadistic gang rape and killing of a teenage boy and is suspected of murdering many more.

It has emerged that detectives investigating shock allegations of three murders and systemic child sex abuse by senior Establishment figures are looking into Goddard’s possible involvement.

Image result for westminster

The suggestion is that the child sex ring, dubbed the Dirty Dozen and known to have targeted vulnerable youngsters, could have passed on their victims for the MPs to abuse.

Image result for dolphin Square, Pimlico

At the time, Goddard lived in Eccleston Square, Pimlico, close to the exclusive apartments of Dolphin Square where the VIP child abuse ring is said to have been based.

29th Jan 1999 Sidney Cooke appears before Newbury Magistrates Court, charged with 14 serious sexual offences. which were said to have taken place in Battersea and Stockwell in south London; Twyford, Berks; Canterbury, Kent; Washington, Tyne and Wear and Hatfield, Berkhamsted and Tring in Herts.

link

adam-ant-margaret

Adam Ant’s mother was an embroiderer or the Queen’s dressmaker Norman Hartnell. and worked at Paul McCartney’s house as a cleaner.

Like Sidney Cooke, Leslie Alfred Goddard was also a chauffeur to rich families.
link

Alfred Leslie Goddard had served in the Royal Air Force.

https://en.wikipedia.org/wiki/Adam_Ant

Image result for martin allen missingImage result for martin allen missing


Cliff Richard’s friend Paul O’Grady is a patron of  the Peter Tatchell Foundation

tatchell1

peter-tatchell-patrons

http://www.petertatchellfoundation.org/node/573

Is this the current CHE membership leaflet with photo of Nettie Pollard & Peter Tatchell from 2011?

“Pollard gave a constant stream of support to paedophiles and promoted their views.”

Photo below: Nettie Pollard (EC Member) with Peter Tatchell at the 2011 Annual Conference:

Nettie Pollard was member number 70 of the Paedophile Information Exchange.

link

tatchell-and-nettie-pollard

 

nettie-pollard

Pensioner backed Paedophile Information Exchange and may hold key to links with left wing groups

Nettie Pollard was a key figure in the London left – a Sunday People investigation reveals her to be a chief apologist for some of PIE’s most chilling demands

Even those who have lived beside her for years have little idea about her life – none of her neighbours has ever been invited inside the home she has lived in alone for almost 30 years.

But 69-year-old Nettie Pollard may hold the key to how the Paedophile Information Exchange infiltrated left wing groups in the 1970s.

She was a key figure in the London left, working for the National Council for Civil Liberties for two decades.

But a Sunday People investigation reveals Pollard to be chief apologist for some of PIE’s most chilling demands.

Our investigation found that throughout her career Pollard gave a constant stream of support to paedophiles and promoted their views. She also:

  • Supported PIE’s call to scrap the age of consent.
  • Argued against the introduction of a bill to protect children.
  • Sat on committees with known ­paedophiles and PIE members.
  • Wrote a twisted essay defending sex between adults and children.

It emerged MP Harriet Harman, ­husband Jack Dromey and former Health Secretary Patricia Hewitt had been involved with the NCCL when PIE was affiliated to it.

Mrs Harman has subsequently moved to distance herself from Pollard and paedophiles, with a spokesman stating they “did not influence any of the work she did there”.

Image result for harriet harman pie

However one source involved with the London left in the 70s claims – ­embarrassingly for Mrs Harman – that she and Pollard did work together on occasions within the NCCL .

The source said: “Nettie was a big presence in the movement back in the 1970s and couldn’t be ignored by anyone wanting to get on in the NCCL.”

Our investigation first places Pollard in 1975 working as the Gay and Lesbian Officer for the NCCL.

And that brought her into close ­contact with the infamous PIE – the child sex group which campaigned to have the age of consent lowered or scrapped.

As well as her role at the NCCL, Pollard was and remains a significant member of the Campaign for Homosexual Equality – a group that defended PIE’s rights at their 1983 conference.

But even after PIE was disbanded in 1984, Pollard made no secret of her ­sympathy for the organisation’s aims.

In 1993 she contributed a ­defence of the ­sexualisation of youngsters to a book called Bad Girls and Dirty Pictures.

Entitled The Small Matter of Children, Pollard’s essay draws on work by known paedophiles such as former PIE vice-chair Warren Middleton to build its case.

Pollard argues child sex should be legal if the act is “consensual”.

It also uses language like “willing partners” to describe sex between adults and children.

But by far the most disturbing section is Pollard’s attempt to justify the sexualisation of children.

She writes: “Far from being ‘innocent’ and becoming sexual at puberty, as was once the common belief, it is now indisputable that everyone is sexual, even before birth.”

The research cited was also used in PIE’s bid to reduce the age of consent to just four.

Pollard continued to work for the NCCL until her mysterious ­departure from the group in 1997.

She was made redundant but reports from Feminists Against Censorship implies murkier reasons ­behind her exit.

A ­newsletter from the time reads: “Within the last several months, two of NCCL’s employees have remarked that the organisation’s longest-serving staff member, Nettie Pollard, was the last civil libertarian left on the payroll.”

Challenging the cost-cutting explanation given it added: “Since she is one of the few indispensable staff members, and the most ­expensive to make redundant, we suspect economy is not the reason.”

Pollard, whose Facebook page currently shows her support for causes including an anti-drones campaign and attacks on the “Big Brother” state, also showcases her taste in music with a link to indie rock band The Donutsh – described by one of their following as sounding “like Johnny Cash biting off Johnny Rotten’s head”.

She refused to answer the door to us when we visited her home.

 Image result for harriet harman and nettie pollard
Harriet Harman and Peter Tatchell

 

link

Peter Tatchell was a leading member of the Gay Liberation Front (GLF) but never knew or met any GLF members that where paedophiles like John David Stamford ?


Harriet Harman, PIE , etc …..

Is Peter Tatchell A Paedophile Or Simply Misunderstood?

Peter Tatchell was born in Melbourne Australia on 25th January 1952, he moved to London in 1971 to avoid conscription. In 1978 Tatchell joined the Labour Party and moved to Bermondsey, South East London. Tatchell ran as the Bermondsey Labour Party candidate in the 1983 General Election. Despite Bermondsey being a Labour stronghold he lost to Liberal candidate Simon Hughes. In February 2000 he left the Labour Party for unknown reasons. In 2004 he joined the Green Party and was chosen to be their candidate for Oxford East in the 2010 General Election, however for some reason he withdrew his candidacy in 2009.
Comrade Tatchell
Peter Tatchell (the UK’s most prominent homosexual activist and a favourite of the BBC) has done more than demand the abolition of the age of consent, he has broken the law on the age of consent in Britain at least once.

Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophilie apologist.
Peter Tatchell is a regular on the BBC. The BBC have refused to state whether he appears as a human rights activist, homosexual campaigner or paedophile apologist. They have also refused to state how much they have paid him for appearances.

As a gay 18-year-old Australian anti-Vietnam war draft-dodger, he came to the UK in 1971 and lived with a 16-year-old boy in London. The homosexual age of consent in England at the time was 21. Later he campaigned for lowering it to 16, and now he wants it lowered again to 14. What will he want after that?

When the age of consent for homosexuals was lowered to 16 an Outrage (Tatchell’s organization) banner said “16 is just a start” – it didn’t state what the end goal was.

Mr Tatchell criticises the age of consent laws. Here is a quotation from his own website:

“Nevertheless, like any minimum age, it is arbitrary and fails to acknowledge that different people mature sexually at different ages. A few are ready for sex at 12; others not until they’re 20. Having a single, inflexible age of consent doesn’t take into account these differences. It dogmatically imposes a limit, regardless of individual circumstances“.

Peter Tatchell wrote the chapter “Questioning Ages of Majority and Ages of Consent” for a book openly advocating paedophilia and finding ways “to make paedophilia acceptable“.

This book, published in 1986 and called The Betrayal of Youth (B.O.Y.), was edited by Warren Middleton, then vice-chairperson of the Paedophile Information Exchange, Britain’s number one paedophile advocacy group.

Stephen Green, anti-paedophile campaigner wrote: “The book was part of a campaign to abolish all ages of consent, destroy the responsibilities of parents for their children, deny any ill-effects on children of interference by paedophiles, and withal to make it easier for paedophiles to gain sexual access to children.“

In The Betrayal of Youth Tatchell wrote that the age of sexual consent is “Reinforcing a set of increasingly quaint, minority moral values left over from the Victorian era“.

Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.
Tatchell often ambushes public figures who don’t support the homosexual/paedophile agenda. The MSM and especially the BBC usually give him great publicity for these stunts.

He was not on his own in this belief.Many of his fellow socio-communists and homosexual activists thought the same:

Campaign for Homosexual Equality chairman Michael Jarrett was identifying paedophiles as an oppressed group, and the CHE list of “demands” included the complete abolition of minimum ages for sexual activity. The Labour Gay Rights Manifesto of 1985 said ‘A socialist society would supersede the family household. … Gay people and children should have the right to live together. … It follows from what we have already said that we favour the abolition of the age of consent.’

27092011583[1]


Feminists like Beatrice Faust contributed to The Betrayal of Youth, as well as other homosexual activists besides Tatchell, including Jeffrey Weeks and Eric Presland, who “related his first paedophile experience with an Asian boy of thirteen, and boasted of interfering with a little boy of six“.

The book is considered so toxic that Amazon doesn’t sell it and you cannot search its content in Google Books.

Tatchell is well aware of how much all this is bad publicity for him and keeps rationalizing and adjusting his positions, but only the ideologically blind or pathologically naive cannot see through his self-excuses.

He has prepared a standard self-defence which can be found on his own website and has been repeated verbatim on many outlets. It used to also be on the site of his friend militant atheist, Richard Dawkins, but it’s not there any more. Maybe even Dawkins draws a line at what is morally allowed, even though his motto is “There’s probably no God – now stop worrying and enjoy your life”.

In this article that supposedly should serve to exculpate him, Tatchell has nothing better than this: “The critics also cite Warren Middleton’s 1980s book, Betrayal of Youth, to which I contributed a chapter. I had no idea that he was involved in child sex abuse matters when I was asked to write.”

Considering that Warren Middleton was co-founder and vice-chairperson of the Paedophile Information Exchange (PIE), a prominent group promoting paedophilia, it was impossible for Tatchell not to have known his propensities. In addition, both Tatchell and Middleton were part of the Gay Liberation Front/Angry Brigade, a neo-Marxist revolutionary group of radical students at the London School of Economics, thus making Tatchell’s protestations of ignorance verge on the ridiculous.

Peter Righton of the Paedophile Information Exchange.
Peter Righton of the Paedophile Information Exchange – a Child welfare expert who wanted the age of consent lowering to four.

Were you aware that Tatchell contributed a chapter to this book?

THE BETRAYAL OF YOUTH

The contents and contributors of The Betrayal of Youth:

Chapter 1: ‘Incest’ by Clive Coliman: Described as “An ardent supporter of the children’s rights movement.”

Chapter 2: ‘Child Pornography and Erotica’ by Richard Green: Illustrator for the Paedophile Information Exchange magazine under the pseudonym “Dominik”

Chapter 3: ‘Child Prostitution’ by Warren Middleton of P.I.E.

Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from the anti-Christian Peace News.

Chapter 5: ‘Power and Consent’ by Eric Presland: Homosexual activist. Contributed also to the American paedophile book “The Age Taboo.”

Chapter 6: ‘Love and Let Love’ by Tuppy Owens, Editor of the Sex Maniac’s Diary, and Tom O’Carroll: ex-Chairman of P.I.E. who was convicted in 1981 of conspiracy to corrupt public morals by sending out a paedophile contact list.

Chapter 7: ‘Children and Sex’ by Fr Michael Ingram: Catholic priest, defender of paedophilia.

Chapter 8: ‘The Paedophiles’ by Beatrice Faust: militant feminist & civil libertarian.

Chapter 9: ‘Questioning Ages of Majority and Ages of Consent’ by Peter Tatchell.

Chapter 10: ‘Ends and Means: How to Make Paedophilia Acceptable?’ by Roger Moody of Peace News: “One of the most outspoken advocates of children’s rights in Britain .” Well-documented as a ubiquitous paedophile intellectual.

Chapter 11: ‘Socialism, Class, and Children’s Rights’ by John Lindsay: “ardent supporter of children’s rights.” Member of the Socialist Workers’ Party. Homosexual activist, hates the institution of the family.

Chapter 12: ‘Childhood Sexuality and Paedophilia: Some Questions Answered’ by Warren Middleton of P.I.E.

Chapter 13: ‘The Oppression of the Young: An Inside Perspective’ by Jeff Vernon: Involved in Gay Youth Movement and Campaign for Homosexual Equality.

Appendix 1: “P.I.E., from 1980 Until its Demise in 1985” by Steven A. Smith: ex-chairman of P.I.E. Fled to Holland in 1984, became “active in the Dutch crusade for children’s rights,” was deported back to the UK in 1991 and sentenced to 18 months for sending indecent articles through the post.

Appendix 2: “The Uranians” by Timothy d’Arch Smith: Bookseller. Author of “Love in Earnest.”

Peter Tatchell’s self-defence begins with:

“Unlike many Catholic clergy, I have never abused anyone. Unlike the Pope, I have never failed to report abusers or covered up their crimes.”

These are blatant falsities. It wasn’t many Catholic clergy, it was an extremely small minority. And, as shown in Lies About The Catholic Church Child Sex Abuse Scandal, there is no reason, except bigotry and prejudice, to single out Catholic clergy who in fact have committed fewer of these crimes than any other pedagogic institution, religious or secular.

Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religous values.
Peter Tatchell and his homosexual/paedophile allies often attacked the Christian Church for having Christian values. There is no record of him bursting in to a synagogue or mosque to protest against their religious values.

Saying what he does about the Pope is a criminal act, it is slander. The Pope has never covered up for anyone.Tatchell and his friends in the mainstream media (especially the BBC) think that if you repeat a lie enough times your audience will start to believe that it’s true.

But blaming the Church whenever you’re in trouble is a good way to distract the public from your own deviations from the norm. It’s worked so far so why shouldn’t it work now? Maybe because people have started calling your bluff, Pete.

Peter Tatchell has a seething hatred of Christian morals and values.
Peter Tatchell has a seething hatred of Christian morals and values.

The above should tell you how trustworthy and credible Tatchell is, but there’s more.

Look at his defence of the book Dares To Speak:

“Dares to Speak was an academic book published in 1997, authored by professors, anthropologists, psychologists, sociologists, a Dutch senator and a former editor of a Catholic newspaper. It discussed the age of sexual consent and whether all sex between young people and adults is necessarily unwanted and harmful, based on what it said was objective research with young people.

The book does not endorse or excuse sexual relationships with young people that involve coercion, manipulation or damage. The authors queried, among other things, the balance between giving young people sexual rights and protecting them against abuse. These are entirely legitimate issues to discuss.”

Leaving aside the irony (probably lost on humorless Tatchell) about his using a “former editor of a Catholic newspaper” as a guarantor of the morality of a book while he constantly treats the Catholic Church like a den of abusers. The book Dares to Speak, that Tatchell praises so much as an academic achievement, was edited by Joseph Geraci, who was also the editor of Paidika: The Journal of Paedophilia. The book is a collection of articles from the journal.

Before it was quietly removed, this was Wikipedia’s entry for the publication:

Paidika: The Journal of Paedophilia (1987–1995) was a journal published by the Stichting Paidika Foundation whose purpose was to promote the normalization of pedophilia. Its editor was Joseph Geraci and the editorial board included articles by writers Frits Bernard, Edward Brongersma, Vern L. Bullough, and D. H. (Donald) Mader, some of whom campaigned as pro-pedophile activists.

After the normalization of homosexuality, we’ll have the normalization of paedophilia.


 

 

Graham Ovenden was a Guest Editorial of Paidika Journal of Paedophilia in 1994

PAIDIKA NUMBER 10 WINTER 1994: Guest Editorial: Fall from Grace, by Graham Ovenden

Paidika: The Journal of Paedophilia
Full-Text Files (PDF, GIF and plain-text searchable HTML)
Documents Not Likely to be Widely Available in Libraries
archived here by
Gerald Jones, Ph.D.
University of Southern California, 1964-2007:
Student, Lecturer, Adjunct Assistant Professor of Statistics, Staff (Retired)

15092011573[1]

http://zoompad.blogspot.co.uk/2013/06/paidika-number-10-winter-1994-guest.html


Here is Tatchell’s letter to the Guardian dated 26th June 1997 (a few weeks after Labour’s General Election win) which he denied writing when I asked him about it. However I can find no record of a complaint to the Guardian, the Press Complaints Commission or any lawsuit for libel:
Ros Coward (Why Dares to Speak says nothing useful, June 23) thinks it is “shocking” that Gay Men’s Press has published a book, Dares To Speak, which challenges the assumption that all sex involving children and adults is abusive. I think it is courageous. The distinguished psychologists and anthropologists cited in this book deserve to be heard. Offering a rational, informed perspective on sexual relations between younger and older people, they document examples of societies where consenting inter-generational sex is considered normal, beneficial and enjoyable by old and young alike.
Prof Gilbert Herdt points to the Sambia tribe of Papua New Guinea, where all young boys have sex with older warriors as part of their initiation into manhood. Far from being harmed, Prof Herdt says the boys grow up to be happy, well-adjusted husbands and fathers. The positive nature of some child-adult sexual relationships is not confined to non-Western cultures. Several of my friends – gay and straight, male and female – had sex with adults from the ages of nine to 13. None feel they were abused. All say it was their conscious choice and gave them great joy. While it may be impossible to condone paedophilia, it is time society acknowledged the truth that not all sex involving children is unwanted,abusive and harmful.
Peter Tatchell.
Picture 9
Peter Tatchell has repeatedly denied writing the letter above. However below is his reply in the Guardian (1st July 1997) to criticism of his original letter. In his second letter (below) he never denies writing the first letter (above) or claims he was edited in any way.
Peter Tachell’s second letter to the Guardian on 1st July 1997.
Peter Tachell’s second letter to the Guardian on 1st July 1997.

Peter Tatchell has often claimed he lives a monk-like existence living on a mere £9,000 income per annum. When I challenged him on this he changed his claim to £29,000 plus expenses. However he has refused to disclose his payments for his numerous main stream media appearances or disclose how much his yearly expenses are.
Peter Tatchell in his Council flat.
Peter Tatchell in his Bermondsey Council flat.

Peter Tatchell has declined to be interviewed for this article, however I will leave him the option of the right of reply in the comments section.

__________________

P.I.E – Paedophile Information Exchange

Members/Activists/Connected of P.I.E
Former PIE Chairperson and current pro-paedophile activist Tom O’Carroll
tom

David Joy, 66 – once No2 in the notorious Paedophile Information Exchange. In 1984 he was jailed for 18 months for publishing obscene material in a PIE newsletter. In 1996 he got two more years after admitting indecent assaults dating back to the 80s. Then in January 2006 cops found 1,129 images of children aged one to 13 at his rundown flat in Loughborough, Leics. Some were in the level 5 category – featuring sado-masochism, torture or bestiality.
david-joy1

DR Morris Fraser – P.I.E founder member & leading child psychiatrist – had a criminal record for taking indecent photographs of children and assault in 1972. Good friends with both Napier, Waters and Righton
morris

Terrence Waters – Former prep school teacher – Closely linked to several P.I.E members incl Andrew Sadler – adopted the alias “James Opphin daler”. The name contains an anagram of the word “paedophile”. In 1994 Waters was sentenced to ten years for possessing child abuse images and the sexual abuse of a 10 year old boy. In 2011 convicted for more sexual abuse against children at Allen House School – More on Waters on this link
Michael Johnson – jailed for four years on six specimen counts of indecent assault against two boys aged nine and 11. In 1988 Dr Morris Fraser and Michael Johnson set up a sailing charity for disadvantaged boys called the Azimuth Trust based in Cornwall.
Andrew Sadler – Former teacher who was jailed abroad for sex offences against boys – Links to Fraser and Napier –
Andrew Sadler

More on Sadler on this link
Leo Adamson helped set up Pie to distribute obscene pictures of young boys while John Parratt aka Warren Middleton was a former vice-chairman of the organisation
Leo Adamson, left. John Parratt right

Former chairman/leader Steven Freeman aka Steven Adrian Smith
freeman

Freeman/Smith was a former Home Office security guard and was described in court in 1984 as the, “powerhouse and engine room of P.I.E, and the life blood of contact which he edited and printed.
The members’ hotline for the Paedophile Information Exchange (PIE) rang, of all places, inside the Home Office. The phone would be picked up by Steven Smith, a paedophile and member of the group who worked in security in Whitehall, from where he would tell callers where to go for the next meeting to discuss issues including decriminalising sex with children as young as four.
John Morrison and Barry cutler – Members
john morrison left. Barry Cutler, right

Geoffrey Prime – Former member and KGB spy
957218

Sir Peter Hayman – Several links to P.I.E and its members – Former High Commissioner to Canada
peterhayman01

Notorious paedophile and TV presenter Jimmy Savile was almost certainly a full member of P.I.E
Jimmy+Savile

Peter Bremner (aka Roger Nash) Member level – Bremner has convictions for indecently assaulting children. Jailed for 6 months in 1994 with David Joy. in 1978 Bremner was given a three month prison sentence suspended for 2 years and fined £150 for indecently assaulting 3 boys, two aged 8 and one aged just 5
peter brmner

John Stamford – A former church minister published international guides for child molesters. He died before his trial. Stamford used a homosexual travel guide called spartacus as a front for a mailing ordering service offering information on child prostitutes in Thailand, Brazil and other nations. The organisation was alleged to have operated through a box number in London. The details of each of the members, including their sexual preferences, the desired age of the children and preferred countries of origin were stored on a computer. The members received personalised lists of children.

For more on Stamford and Spartacus magazine click here
Stephen King aka Stephen Gosling – so called child expert was a member of P.I.E. His unbelievable role was to advise UK judges on sentencing for paedophiles
stephen_king

Richard Bigham – Eldest son of viscount of Mersey admitted he was a member
Former Vicar and millionaire Michael Studdert –financial backer and member level
millionaire-michael-studdert

David Wade – The treasurer of P.I.E
Entry level members – Robert Bushell, Geoffrey Taylor, David Hooper, Nigel Beatman – Click this to see summary of their convictions
Michael Hanson – First chairman (set up P.I.E. as a special interest group within the Scottish Minorities Group with Ian Dunn)
Keith Hose – 2ND Chairman In the PIE Chairperson’s Annual Report for 1975-6, Keith Hose wrote that ‘The only way for PIE to survive, was to seek out as much publicity for the organization as possible…. If we got bad publicity we would not run into a corner but stand and fight. We felt that the only way to get more paedophiles joining P I E… was to seek out and try to get all kinds of publications to print our organization’s name and address and to make pedophilia a real public issue.’
British antiques expert Keith Harding was active in the Paedophile Information Exchange
Harding was convicted of indecent assault against four children aged eight and nine in the late 1950s and was a “schedule 1” offender – meaning his convictions remained on his police file for life.
But he was later given the Freedom of the City of London and became a member of the Worshipful Company of Clockmakers, meeting business and political figures at the height of his career. The clockmaker and music box expert ran a museum regularly visited by children, despite social services being aware 20 years ago of his convictions for child abuse.
harding1

A document held by police in the mid-1980s listed Keith Harding as PIE member number 329 next to his north London address.
Ian Campbell Dunn – Co-founder (born 01/05/43 died 10/03/98)
iandunn1

Shortly before his death, Dunn, a prominent gay activist, became convener of lobby group Outright Scotland. In 1997, he condemned police over a camera surveillance operation in public toilets in Stirling which led to several gay men being charged – even though the investigation also revealed that some men had sex with a 13-year-old boy. In 1974, Dunn co -founded the Paedophile Information Exchange ( PIE) with Michael Hanson. It became the leading contact group for adults campaigning for the right to have sex with children. In an interview in 1997, Dunn admitted he and Hanson had agreed to facilitate research into sex with children.
Dunn was caught on tape bragging abut interfering with a fourteen-year-old boy. The existence of the tape caused him to abandon a libel action he had brought against a Sunday newspaper, which named him as a paedophile. The encounter itself does not seem to have been a one-off – at his funeral in 1998, a young man claimed Dunn had raped him when he was fifteen. Dunn also supported a paedophile magazine called ‘Minor Problems.’
Charles Napier One-time treasurer of PIE Charles Napier is alleged to have sexually assaulted boys whilst a gym master at Copthorne School. He became an English Language Trainer at the British Council and was convicted of sexual assault against minors in London in 1995 and investigated as an alleged member of a paedophile network operating in British schools in 1996. He set up his own school in Turkey and resumed English Language Training with the British Council after serving his sentence
Charles Napier

Michael Dagnall · Tony Zalewski – Lee Edwards –Named in Daily Express, 26th August 1983

Lee Edwards aka Edward Brand executive committee member of PIE Does the photofit look like him ?

 

Lee Edwards & the Paedophile Friendship Service

Bernard Haunch – Teacher – He was also a member of a group called the Paedophile Information Exchange but apparently claimed it was a discussion group
Bernard Haunch

Dr Edward Brongersma (Deceased) – has written extensively in the area of sexuology, especially on pornography, ephebophilia, pedophilia and the age of consent. His books on this subjects include: Das Verfehmte Geschlecht (in German, 1970), Sex en Straf (“Sex and Punishment”, 1972), Over pedofielen en kinderlokkers (“On Pedophiles and Child Molesters”, 1975), and his last work is his magnum opus and entitled Loving Boys (two volumes, 1988–1990).
Dr Edward Brongersma

Peter Righton AKA Paul Pelham – Righton was the former director of education at the National Institute for Social Work, and a consultant for the National Children’s Bureau. Yet he was also a founding member of the Paedophile Information Exchange (PIE), which wanted the age of consent reduced to four. Righton published essays justifying paedophilia, which he called no more mysterious than “a penchant for redheads”. Police raided his home and found hundreds of letters between him and other paedophiles
peter ri

Warren Middleton, aka John Parratt one of PIE’s first London members – Creater of the Understanding Paedophilia (UP) magazine that was eventually replaced by Magpie
Michael Dagnall – Close friend and fellow abuser with Tom O’carroll Click this , it mentions Dagnall and P.I.E involvement @ page 19
Richard Travell – Active member status – Travell was handed a three-year community order in 2006 for possessing indecent images of children.
Untitled

Alan John Doggett (1936-1978), (pictured above) conductor, composer and choir master. Leader of London Boys Choir – A letter in Magpie 10 reported and commented on the suspected suicide of Alan Doggett weeks before he was due to face child sex charges for having sex with a choir boy. Hit by train. Also has links to a certain Paul Raven aka Gary Glitter
C. J. Bradbury Robinson – American author who wrote several times for Magpie magazine – His pro-paedophile books include A crocodile of choirboys “Bare Knees, Boy Knees.” The latter offers an “unmatched” and “startling trip into the strange world of the Paederast,” says the description on Amazon, which has one used copy for sale for $500
Richard James – Writer at Magpie
Paul Green – Writer at Magpie
Peter Deathman – P.I.E member who was regulary visited in prison by Tom O’Carroll. Deathman served a 10 year sentence not for mere sexual abuse but for child stealing
Den Nichols – Author of paedophilia literature called “Towards a Better Perspective For Boy-Lovers”. Published in 1976. In its preface to ‘serious minded adult males who feel an existential attraction to young boys”. Copies were advertised and sold by P.I.E/Magpie for £1 each, including post & packaging
David Grove – AKA Robin Brabban – born 1904 – secretary and Ex treasurer of PIE
Michael Walker – London – Member level of P.I.E – He did not agree on certain issues of P.I.E but condemned hostility against P.I.E
Anthony Green – Somerset – He attended a meeting of P.I.E that was attacked by the Nation Front. He urged tolerance and understanding of paedophiles
William Thornycroft – He was disgusted at attacks on P.I.E. He was quoted “The sexual freedom of children was needed” – Member of Communist Party Gay Rights Committee in the 70’s
Robert Atkinson – Newcastle teacher was arrested for sexually abusing a 13 year old student. He was fined £200. The headmaster and staff however continued to support him after the his guilt. Member level status in P.I.E
Ian Harvey – P.I.E member – He sought to differentiate bewteen “good paedophiles” and pedarasts, but without defining his terms or explaining why
Micky Burbidge – He supported P.I.E’s proposal to abolish the age of consent laws. Also wrote a book entitled“Evidence on the law relating to and penalties for certain sexual offences involving children for the Home Office Criminal Law Revision Committee” with Kieth Hose
Frits Bernard (1920 – 2006) was a Dutch psychologist,sexologist, homosexual activist, and pro-pedophile activist.Together with the late Edward Brongersma, he laid the foundations of the emancipation movement of boylovers in the Netherlands.
Keith Spence – He applauded the “courage” of the leaders of P.I.E in the face of ; quote – Hysteria, hostility and violence, also wrote several paedophile articles for Magpie about sexual abuse of young boys
June 1983: Scoutmaster Michael Williams of Castle Bromwich. Birmingham, resigned after being exposed as a member of P.I.E
Jane Rule – Canadian Writer of lesbian-themed novels and non-fiction. Co author of Magpie: Journal of the Paedophile Information Exchange – Also supporter of NAMBLA (The North American Man-Boy Love Association (NAMBLA) was founded in December 1978 and is an activist homosexual and pedophilia coalition group. Their primary aim is stated to be the overturn of statutory rape laws and reduction of “age of consent” laws that require a child be of a certain age (which varies by state) before they can agree to sexual intercourse.
John Finnin – Co author of Magpie: Journal of the Paedophile Information Exchange
Peter Saxon – Co author of Magpie: Journal of the Paedophile Information Exchange
Derry Webster – Tom O’Carroll was named in court as a ‘customer’ for Webster’s child abuse images and video collection. Webster was jailed for his part for selling the obscene films, magazines and pictures
Kenneth Plummer – Involved with O’Carroll. He stated “Any study that can take adult-child sexuality out of the zone of shrieking horror and place it in the demystified zone of everyday experience must be welcomed”. sociologist Dr Kenneth Plummer of Essex University, sent a “warm message of support” for “Betrayal of Youth,” and, in company with Nettie Pollard and Professor Donald West (qv), also read, made suggestions and then praised “Paedophilia the Radical Case” receiving “heartfelt thanks” from its author, Paedophile Information Exchange Chairman Tom O’Carroll. Attented several P.I.E meetings
.
.Harman letter PIE http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://www.telegraph.co.uk/news/politics/labour/4949555/Harriet-Harman-under-attack-over-bid-to-water-down-child-pornography-law.html
.
http://cigpapers.wordpress.com/2013/06/05/p-i-e-paedophile-information-exchange-exposed-part-two/
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://en.m.wikipedia.org/wiki/Age_of_consent_manifestations_(UK)
.
http://labour25.com/category/age-of-consent/
.
http://en.m.wikipedia.org/wiki/Liberty_(pressure_group)
.
http://ukpaedos-exposed.com/uk-child-abusers-named-and-shamed/p-i-e/
.
http://blogs.spectator.co.uk/nick-cohen/2014/02/when-is-a-scandal-not-a-scandal/.
.
http://ufohunterorguk.com/tag/nccl/
.
http://www.wikileaks-forum.com/united-states/479/the-truth-about-some-politicians-backing-practicing-pedophiles-and-cp/15984/
.
http://www.theguardian.com/society/2014/feb/26/lobbying-paedophile-campaign-revealed-hewitt
.
http://aangirfan.blogspot.co.uk/2013/02/nspcc-mi6.html?m=1
.
PIE’s new name
http://www.libertarian.co.uk
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-
love/p-i-e
.
http://ukpaedos-exposed.com/the-civil-servant-in-the-home-offices-pie-funding-inquiry-and-his-academic-articles-on-boy-love/p-i-e/
.
Tony Blair part of PIE
http://www.thedailybeast.com/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html#url=/articles/2014/02/26/pedophile-advocacy-comes-back-to-bite-a-british-politician.html
.
PIE & HMqueen
https://m.facebook.com/story.php?story_fbid=638499922852151&id=100000764465111&refid=7&_ft_=qid.5988561366331161130%3Amf_story_key.1134116637656814874
.
http://www.dailymail.co.uk/news/article-2575505/Letter-paedophile-group-links-Harriet-Harman-Patricia-Hewitt-AFTER-said-marginalised.html
.
http://dailybalenews.com/2014/02/08/paedophiles-plan-to-build-village-in-devon-update/
.
http://m.couriermail.com.au/news/opinion/opinion-why-does-the-left-support-this-avalanche-of-pedophile-filth/story-fnihsr9v-1226861620956
.
Liverpool (NICHE)
http://sindonax.wordpress.com/2014/03/25/paedophile-cover-ups-the-hows-and-whys/
.
PIE
http://spotlightonabuse.wordpress.com/category/pie-paedophile-information-exchange/
.
https://docs.google.com/file/d/0B4PQp1NQ39MPYzU5NDVhY2QtMWViYi00MDRkLWE4OWQtOTc2NjA5MWZiNWI3/edit
.
http://ianpace.wordpress.com/2014/03/15/pie-and-the-home-office-three-memberssupporters-on-inside-funded-magazine-printed-and-phone-line/
.
http://web.archive.org/web/20041116144121/http://home.wanadoo.nl/host/wilson_83/index.htm
.
Labour controlled BBC
http://gaiusmarcellus.blogspot.co.uk/2010/03/unacceptable-links-between-labour-and.html

Silent
http://www.silentlambs.org/
Silent
http://iamthewitness.com/listeners/Jewish.child.molesters.that.are.never.on.the.NEWS-WHY.htm
.

https://gettingreadyfor2015.wordpress.com/2014/01/18/a-bill-maloney-up-date/
.
http://www.real-whitby.co.uk/savilejaconelli-yewtreehibiscus-sborough-paedo-ring-time-line
.
http://www.nationalarchives.gov.uk/a2a/records.aspx?cat=097-hcagrey&cid=-1
.
https://m.facebook.com/story.php?story_fbid=747913618599372&id=100001422211809&refid=28&_ft_=qid.6033289562555813767%3Amf_story_key.2800040682799693877&__tn__=%2As&fbt_id=747913618599372&lul&_rdr#s_ff81768c6432b3819fe18456041bb4e6
.
http://order-order.com/2014/07/08/watch-former-tory-whip-boasts-about-paedo-mp-cover-up/

LINK

Arlo Tatum,[1] the executive secretary of the Central Committee for Conscientious Objectors, sued Melvin Laird, the Secretary of Defense. Tatum sued after Washington Monthly published an article revealing that US military intelligence units were gathering https://twitter.com/cassandracognointelligence on civilians and civil organizations in the US.[2]

8

Arlo Tatum moves to UK & joins Albany Trust after suing US army for alleged unlawful “surveillance of lawful citizen political activity.”

Tatum had composed and sung songs for Aldermaston peace marches during the 50s and had also become the Director of Peace News. [Arlo Tatum obituary, The Guardian 7 May 2014]

And Jack Straw’s autobiog reveals his MI5 file started from the Aldermaston marches

During 1975, while Paedophile Information Exchange member Roger Moody was working for Peace News he was promoting the organisation in its pages.

https://bitsofbooksblog.wordpress.com/2015/02/23/march-1977-albany-trust-arlo-tatum-peace-news-and-paedophiles/

2 female authors/contributors to PIE’s Warren Middleton’s B.O.Y were also involved with Peace News like Roger Moody

(Chapter 4: ‘Gender Differences’ by Liz Holtom and Kathy Challis: both from  Peace News.)

Peace/anti-nuclear campaigners heavily targeted by state surveillance since pre1970s to current day:

So how with all the surveillance were the paedophiles for peace lobbyists missed?

 

Or were they a useful control/eye on non-paedophile peace campaigners?

Were paedophiles used as informants on anti-nuclear protestors?

Perusing Peace News from 1975+ I was glad to find ONE letter to Editor saying what I was thinking….

paraphrased: “What’s with Peace News new preoccupation with paedophile rights? What’s it got to do with anti-nuclear/peace activism?”

Writer of letter was an extremely disappointed long-term subscriber who just couldn’t fathom what had changed for Peace News


Government lawyers…in a vain attempt to keep a lid on Peter Wright’s revelations, seem to be turning a blind eye toward Peace News – the paper published passages from Spycatcher.

The Guardian London, Greater London, England Wednesday,  September 2, 1987 – 36

 


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.

Advertisements

School children ‘given experimental drugs without their parents’ consent in 1960s Home Office-approved trial’


Colette L Annesley‏ @ColetteAnnesley

Latest disclosure includes veterinary drugs administered to girls being sexually abused

Staff members speaks of abuse at Gravesend children’s home

06 November 2017

In an exclusive interview with the Messenger, the 62-year-old man, who asked to be referred to as L Simpson, said recalling his time at Kendall House brought back “terrible memories” which made him “feel sick”.

He worked there during the summer of 1975, between years of study at Kingston University, where he was working on a sociology dissertation. He was offered work there through his flatmate, whose father was a vicar with connections to Kendall House.

Mr Simpson, who was 20, soon realised it was not the placement he was expecting.

“I started on the same day as another chap called Ron. He had very little experience, and I had only done some volunteering at a short stay unit in Putney over Christmas,” he said. “We were asked to wait in the garden and this young guy came up to me and said, ‘I would ask to leave here. What goes on here isn’t right’.”

Last year’s report named Doris Law as the home’s superintendent and its chief psychiatrist was Dr Perinpanayagam.

But Mr Simpson said in his experience another woman seemed to be in charge.

He said: “The first thing she said to me was, ‘I will ask you to do things and I will only ask once’, so it felt almost like a prison camp.

“She was a very large lady, very overbearing physically, and the way she spoke was like one of those army marshals you seen in movies. It frightened the life out of me.

“There was an oppressive atmosphere. It reminded me of Clockwork Orange. But the feeling I got was that the behaviour had become so normalised. Any sense of child care was nonexistent and the atmosphere was of secrecy.”

Mr Simpson’s job was mostly to keep the girls in line from moment-to-moment, and it was obvious there was something wrong.

It was a rare instance when they were not reeling from the effects of drugs, but it had become so routine that they thought nothing of it.

Mr Simpson and Ron saw some of the girls’ files and secretly took notes on what was being administered, but nobody would acknowledge their concerns.

“I sent a letter to the Guardian and heard nothing,” said Mr Simpson.

“I went down to the National Council for Civil Liberties in Euston and spoke to this chap. He sympathised but said he had nothing to go on as hand-written notes wouldn’t get very far in court.

“From what I’d heard other people had reported it to the police in Gravesend but they were doing nothing, so I didn’t see the point.”

Mr Simpson said the girls’ records showed they were being given drugs at every meal. He also saw one girl kept in a cell for almost 24 hours for trying to run away.

Mr Simpson stayed in another property nearby and recalled neighbours complaining about screams coming from the home.

“It’s really upsetting that we tried to do something and got nowhere,” said Mr Simpson.

“Until the report came out I had tried to bury it. It brings back terrible memories and makes me feel sick.

“Not enough people wanted to say anything at the time and it makes me so angry.”

Mr Simpson still has the notes he took secretly of drugs administered to girls, listed under “breakfast, tea and supper” and some poured into cups of tea.

He noted oxytetrin, a veterinary product used to treat infections, thioridazine, used to treat schizophrenia and psychosis, and dalmane, which is for insomnia.

“Some of the girls had pretty troubled backgrounds but I didn’t see any behaviour that suggested they were any different or outlandish,” he added. “It’s an emotional time for young teenagers going through physical and emotional changes.

“Drugs are not the way to deal with these problems. These were young kids. It’s just awful.”

This year it also emerged that the priest overseeing Kent social services while Kendall House was open never reported staff to police.

In an interview recorded in 2006, and since uploaded to the British Library’s sound archive, the Rev Nicolas Stacey said that youngsters in care could be “incredibly manipulative” and make things up.

Mr Stacey was a director of social services from 1974 until 1985. Kendall House was shut down the following year.

Girls were injected with drugs, locked in an isolation room, kept in straitjackets, given electric shock treatment at a mental health hospital and raped.

Despite such crimes being reported by the children at the time, staff were told never to go to the police.

Dr Sue Proctor chaired the review into the home and described it as “the most troubling thing she had ever worked on”. She had previously chaired the investigation into disgraced DJ Jimmy Savile.

She tweeted that the interview was “appalling” and Mr Stacey had “failed” those at Kendall House.

A spokesman for Kent County Council said at the time the interview would be investigated.

http://www.kentonline.co.uk/gravesend/news/inmates-were-given-drugs-with-134688/

Teresa Cooper‏ @Teresacooper

Bishop James wanted a well known ex council leader with a shocking history of child abuse failures & his mates wife on the KH review panel.

Kendall House campaigner finds more links between Kent social services and notorious C of E children’s home

3 October 2017

A SURVIVOR of the Church of England-run children’s home Kendall House has called for a fresh inquiry into its links with Kent social services and the Anglican priest who ran the department.

Teresa Cooper, whose campaigning led to compensation payouts and eventually an independent review by the dioceses of Ro­­­chester and Canterbury, has unearthed docu­ments that demonstrate a new connection between the social-services department of Kent County Council (KCC) and the girls-only children’s home in Gravesend.

The Revd Nick Stacey, who died earlier this year (News, 12 May), was director of Kent social services from 1974 to 1985, at the same time as staff at Kendall House were drugging, straitjacketing, and physically and sexually abusing vulnerable girls (News, 15 July 2016).

Earlier this year, an interview with Mr Stacey emerged in which he said that his policy was to never report staff accused of abuse to the police because children in care routinely lied (News, 7 July).

In a letter to Mrs Cooper in August, KCC said that it knew of no “direct link or relation­ship” between Kendall House and the former director of social services.

Mrs Cooper has since obtained a copy of a letter from March 1976, however, which suggests that Mr Stacey was directly involved in arranging the adoption of a baby born to a 14-year-old girl living in Kendall House. In the document, Mr Stacey asks the girl’s GP whether there is any history of hereditary medical conditions in the girl’s family which the child could inherit.

Between 1976 and 1986, KCC placed six teenage girls, between the ages of 13 and 16, at Kendall House, which was jointly overseen by the dioceses of Rochester and Canterbury.

Other files obtained by Mrs Cooper reveal that the girl’s social worker told superiors at the Kent social services about his concerns about Kendall House: in particular, the highly negative approach of its staff, and their re­­liance on drugging the girls to ensure com­pli­ance.

“I have long doubted the effectiveness of Kendall House as a treatment option,” the social worker wrote. “Throughout 1975, I became increasingly concerned about the atti­tude among the staff at Kendall House to­­­wards the children in their care.”

The staff used a lot of “negative condition­ing”, which could be connected to their “reli­gious philosophy”, he said. Some of them re­­peatedly referred to the children as “animals”. “I cannot remember any of the staff making a positive comment about this child throughout the whole of 1975.”

The superintendent who ran the home, Doris Law, at one point told the social worker that the 14-year-old girl had disclosed that she had been sexually abused by her father when a young child.

“With [the girl] sitting on Miss Law’s lap, the child had been encouraged to demonstrate how, apparently, she had been penetrated by her father,” he wrote in his report. Miss Law then took the girl to an Anglican church for her to receive “absolution”, he said.

The social worker also questions the appro­priateness of the medication repeatedly given to the girl.

The documents reveal that, as soon as the Kendall House staff realised that she was pregnant, they stopped giving her drugs, some of which were noted as possibly causing med­ical problems for her unborn child.

“In view of [the girl]’s condition, and the drugs she was taking in very early pregnancy, this child may well be at risk physically,” one of the staff members had written.

“Because of [the girl]’s very poor physical condition, and her need for medication on her return to Kendall House at the beginning of last Sep­tember, prognosis for the baby is uncertain,” Miss Law wrote in the files.

This report, and its conclusions on Kendall House, were sent to the senior research officer at KCC’s social-services department, Dr Roger Morgan, but there is no evidence that it was acted on. The abuses at Kendall House were finally revealed by a TV documentary in 1980.

The C of E’s review of Kendall House, which published in detail the trauma suffered by girls who lived there, looked only at the running of the home itself, and the part played by the Church, and did not enquire into links with Kent’s other social services or Mr Stacey.

Mrs Cooper said that the only way forward now was to reopen the independent review of Kendall House. “I did have my concerns about adoptions in the first place, and the Church of England refused to include it in the terms of reference.

“The review should have picked up on [Mr Stacey’s involvement]; it shouldn’t have been me who found out all this information now.”

A spokeswoman for the dioceses said that, after his interview came to light, church officials had looked in vain to see whether Mr Stacey, who had permission to officiate in the diocese of Canterbury, had ever visited Kendall House or been implicated in the scandal.

“These documents appear to highlight pre­cisely what was made clear in the Kendall House review: that the level of care offered to residents was severely lacking,” a statement from the dioceses said.

A spokesman for KCC said: “We have every sympathy for Mrs Cooper because of the abuse she undoubtedly suffered at Kendall House. However, this was a Church of Eng­land, rather than KCC, establishment and Mrs Cooper was placed there by another local authority. …”

https://www.churchtimes.co.uk/articles/2017/13-october/news/uk/kendall-house-campaigner-finds-more-links#.WeA1PfNQ0uw.twitter

Community youth service campaign gets a rough reception

The Guardian, 14 May 1981

Nick Stacey, chairman of Youth Call and director of Kent’s Social Services departmentDavid Steel, Alf Morris, Anthony Steen, Cardinal Hume and Sir Peter Parker

Jimmy Savile At Launch Of New Railcard For Disabled.: Sir Peter Parker Chairman of British Rail’s latest member of the family of Railcards – for Disabled

Teresa Cooper @Teresacooper

And these two have a long history with Stacey

 

Teresa Cooper @Teresacooper

They knew the drugs caused birth defects. They all knew. The CofE didnt want people to know they adopted babies out from kh & 7 other units
They kept all that out of the steered review.
The CofE have treated me so bad bc they hate me for exposing KH and latest news. They use their PRs to spout scripted crap unchallenged.
CofE delib withheld the KH addendum report for a month & released it at Xmas & delib snubbed it bc I was in it. Care? I dont think so.
CofE did in fact delib lie in KH review TofR & to exclude me & my 30yr fight for justice + 100% delib excluded me from KH reunion. They lie
The insurance.. Teresa has the doc evidence in case their main story is challenged. He was challenged and they all left me to deal with it.
I gave them confidential info & they took sound bites of Nazir Ali & used it on someone elses story when it was me he was talking about.

More than 100 victims now in Derbyshire’s biggest child abuse scandal

May 29 2017

More than 100 alleged victims of horrific experiments and abuse at a Derbyshire hospital have now come forward – making it the county’s biggest-ever probe into crimes against children.

Police are investigating the actions of controversial medic Dr Kenneth Milner at Aston Hall Hospital in the 1960s and 70s, where he is accused of pumping vulnerable youngsters with drugs to correct “deviant” behaviour.

Dianne Collins, of Nelsons Solicitors in Lodge Lane, Derby, represents around 30 people.

She said: “I have never come across a case like this before, it’s the biggest we’ve ever done or are aware of in terms of people coming forward.

And I think this is just the tip of the iceberg, there will be a lot of other people out there who have not come forward or who might have died which is very sad because they will not be able to get justice.

One hundred and five is a very high number and I suspect the national coverage this story has received would have meant more people coming forward.”

Richard Scorer, who has been described as one of Britain’s leading specialists in the field of abuse law, said the Aston Hall case was “major”.

Mr Scorer, who works at legal firm Slater and Gordon, said: “This is highly serious and one of the biggest abuse scandals in a mental health institution. It’s is very substantial.

“It looks like Dr Milner had a complete liberty to abuse and it appears there were no safeguarding procedures in place to stop that happening. I have represented 168 alleged victims of Jimmy Savile but that was across various institutions but this is just one.

“Somebody like this would have had a lot of power over very vulnerable victims, especially because this was in a mental health setting. They could not leave and anything they said against him would not be believed.”

http://www.derbytelegraph.co.uk/lawyers-say-this-is-the-biggest-child-abuse-scandal-they-have-come-across-in-derbyshire/story-30355797-detail/story.html#lSqtF4uusExoZOcJ.99

Aston Hall: 58 crimes recorded at former Derbyshire mental hospital

 April 13, 2017

THE SECRETS OF ASTON HALL, DERBYSHIRE

ASTON HALL HOSPITAL, DERBYSHIRE

PROLIFIC ABUSE & EXPERIMENTATION ON CHILDREN

 

IMG_1359

Aston Hall is a former stately home which was turned in to an auxiliary hospital during the First World War, before then being sold by the owners and becoming a state secure psychiatric hospital.  It housed adults but, unbeknownst to many local residents, also contained a childen’s wing.

In 2016 it was announced that a number of former patients had come forward to allege the most appalling systematic abuse as well as claims of being used as ‘guinea pigs’ for medical experiments by the head physician.  Many of them were just children at the time.

In 2016, DI Simon Tunnicliffe of Derbyshire Police confirmed that a number of allegations had been made and that the police were “working with partners to assess the nature of the allegations“.

Deputy Director at NHS England (Midlands and East), Sylvia Knight, issued a statement:

NHS England is aware that historic abuse allegations have been made in relation to residents of the former NHS learning disabilities facility at Aston Hall, Derby.

A complex enquiry process has been established by the Derbyshire Safeguarding Children Board in line with its published procedure.

It is important that anyone who feels they have been a victim receives support and we are talking with Derbyshire Healthcare NHS Foundation Trust to ensure that it and other organisations provide all necessary help and support.

Nottingham’s Police and Crime Commissioner, Paddy Tipping, confirmed that Aston Hall was featuring within two ongoing police probes.

2017: It is confirmed that an investigation is ongoing in to allegations of abuse at Aston Hall, and that former patients would also be giving evidence to the National Child Abuse Inquiry (IICSA).

IMG_1360

The Hospital:

I happened to stumble across a book on Amazon written by Barbara O’Hare, entitled ‘The Hospital: How I survived the secret child experiments of Aston Hall’ (available in both paperback and on Kindle).  When I began reading Barbara’s appalling recollections of her experience (and many other girls) being transferred from The Cedars Children’s Home to Aston Hall and being systematically abused and experimented on, I was appalled.  I’d never heard of Aston Hall and the only other experimentation I’d heard about was Kendall House, where Dr Marenthiran Perinpanayagam (referred to by some as the British Dr Mengele) was routinely drugging girls, who were then being abused.

At the age of 12, Barbara was sent from The Cedars home to Aston Hall, where she was immediately drugged into a vegetative state before swiftly experiencing something that was known as ‘the treatment’.  It involved Dr Kenneth Milner – the head physician, a sedative type drug, abuse and a photographer.

The book itself is an eyeopener.  It is obviously very difficult to read given the subject matter, but it is well written and engrossing.  I read it within 24 hours and felt compelled to look into it and put together this blog post.  It’s yet another example of the state’s secret and shameful treatment of the most vulnerable in our society.

IMG_1358

Dr Kenneth Milner:

Dr Milner had a long and distinguished career.  Working for the Home Office, he was a former medical officer at Dartmoor Prison and worked at both Broadmoor and Rampton, as well as spending 30 years at Aston Hall from 1947-1975, despite having had no training as a child psychiatrist.  As a member of the Education Standing Committee for the Royal Medico Psychological Association (with William Sargant) from 1953–54, he also contributed to debates on ‘mental deficiency‘. He died in 1976.

IMG_1361

Sodium Amytal:

Sodium Amytal is a drug commonly known as ‘truth serum’.  It is a psychoactive drug that was used in psychiatric treatment in an effort to obtain information from subjects who are unable or unwilling to provide it otherwise.  It is now widely banned.

Ether:

Once patients had been injected with Sodium Amytal, a mask was placed over their face and drops of ether were put on a pad under their noses.

Cases:

1959: A mother held a protest against issues surrounding her sons death at Aston Hall.  Barry Wright was 24 years old when he drowned after absconded from Aston Hall.  His mother, Gertrude Wright, claimed that she and her husband were not told of their son’s death until two weeks later and had also been buried in an unmarked grave 30 miles away from his home.  An open verdict was recorded.

1972: A board of inquiry was held into allegations by Thomas Brindley of ill-treatment towards his son, Robert, who was aged 37.  He claimed his son had been ill-treated and injured.

2002: Nurse, Donna Roulston, aged 27, was struck off after being found guilty of assaulting patients within Aston Hall.

Media:

What Happened at Aston Hall Hospital? – BBC Radio 4 podcast from July 2016.  A full transcript is available at the bottom of this blog post.

Jason Stubbings injected and abused – BBC interview from February 2017, with a former patient who was just 14 when he was placed in Aston Hall.

Further reading:

https://scepticpeg.wordpress.com/2017/07/24/the-secrets-of-aston-hall-derbyshire/


Dr Kenneth Milner, right, is accused of abusing patients at Aston Hall.

Dr Kenneth Milner, right, is accused of abusing patients at Aston Hall.

Police investigate 58 allegations of abuse against doctor at a former mental hospital where child patients were drugged and thrown into padded cells

  • Doctor who died 41 years ago is being investigated on child abuse allegations
  • Kenneth Milner ran Aston Hall Children’s Hospital in Derbyshire for 28 years
  • He is accused of injecting children with truth serum before assaulting them
  • Police have confirmed they are looking into 58 allegations of abuse against him 

Police are investigating 58 allegations of abuse against a late doctor at a former mental hospital where child patients were drugged and thrown into padded cells.

Police are investigating 58 allegations of child abuse against Dr Kenneth Milner, pictured, who died 41 years ago

Police are investigating 58 allegations of child abuse against Dr Kenneth Milner, pictured, who died 41 years ago

A string of allegations have been made against Dr Kenneth Milner, who died 41 years ago, about his conduct at Aston Hall Children’s Hospital near Derby, of which he was in charge.

The psychiatrist and hospital chief superintendent is alleged to have injected children with the truth serum sodium amytal before sexually abusing them.

Dozens have said Milner, who had previously worked at Broadmoor and Rampton hospitals was trying to ‘normalise’ naughty children.

He died in 1976 just one year after he left the institution, having worked there between 1947 and 1975.

Police launched Operation Hydrant with health and social workers to investigate the abuse claims.

Yesterday officers confirmed they were investing 58 allegations of abuse against Milner with more potential victims coming forward.

Writing a letter to the alleged victims, Derbyshire Police said they have recorded ’58 crimes regarding various offences involving the actions of Dr Milner and treatment at Aston Hall’.

It reads: ‘I am satisfied that all former residents who have indicated they wish to be contacted by the police have been identified and approached, in addition to this we are continuing to see further individuals coming forward.

David Martin,  alleges Dr Milner ‘injected him with something’ and then gave him ether to ‘make him go to sleep’, leaving him unable to remember what happened to him

‘This is currently being reviewed I will then make a decision as to which staff members will be approached by the investigations team.

‘We are now in possession of a report regarding the practices at Aston Hall. Based on this, we are currently in the process of recording various crime types in relation to accounts given by former residents.

‘Once we are satisfied all accounts have been obtained, we will prepare a report for consideration of the Crown Prosecution Service.

‘I would like to take this opportunity to re-emphasise that, although this work is extremely time consuming, the investigation team remain focused and committed to establishing the facts as to what took place.’

David Martin, 55, claims he was abused twice by Dr Milner at Aston Hall while aged 12 and 13, including on his first day at the hospital.

The father-of-five said: ‘I was kicking and screaming on my way to Aston Hall. I remember being with some people from social services.

‘When I was there, I was grabbed and put in a cell. That night Dr Milner and two nurses came into the cell.

Dr Milner worked at Aston Hall, pictured, for 28 years and several patients have come forward with allegations against him

Dr Milner worked at Aston Hall, pictured, for 28 years and several patients have come forward with allegations against him

‘He gave me an injection and put a mask on me when I was tied down. He then gave me ether. But after that I don’t remember what happened. It made me go to sleep.

‘I was experimented on while I was asleep. It happened to me twice and it was wrong.

‘Once you’re in a place like that and things happen, it’s sick. It stays on your mind and people have wrongly labelled me in life because I stayed there.’

He claimed the abuse has caused him to ‘struggle with relationships and trusting people’.

He added: ‘They made me feel mentally ill by being there but there was nothing wrong with me.

‘I was never perfect and I did get in trouble. But there was nothing wrong with me.’

Mr Martin said he was relieved the police were investigating Mr Milner over the allegations.

Mr Martin said he was 'relieved' police had launched the investigation

Mr Martin said he was ‘relieved’ police had launched the investigation

He said: ‘It’s a very good feeling because finally someone has listened to what we said.

‘Finally, we can say for certain that what happened to us was wrong.

‘It should never have happened. What we went through was terrible. I’m very pleased with the police investigation.

‘They have been thorough and expert. It’s been complex for them and us.

‘Now I know many victims want to continue to push and get a conclusion to this.’

Another alleged victim, Trevor Bell, 62, claims he was forced to take drugs when he was 13 after Milner labelled him an ‘uncontrollable child’.

Mr Bell, who now lives in Sydney, had been in and out of care homes since the age of two.

He said: ‘When I first went in I thought it was going to be just another home but it wasn’t.

‘I couldn’t run away from this one. I met Dr Milner on my second day and he explained about my treatment.

‘He called it narco analysis but it was sodium amytal. They stripped me, put me in a padded room, everything was white.

‘They gave me an injection, then put a pad over my face, covering everything except my nose. And then he poured ether on my face.

‘They said they wanted to find out where things had gone wrong when I was a kid, why I was misbehaving. I was 13 years old. I didn’t understand a thing.’

Police say they are now in possession of a report regarding the 'practices' at the hospital, pictured, under Dr Milner's charge

Police say they are now in possession of a report regarding the ‘practices’ at the hospital, pictured, under Dr Milner’s charge

Mr Bell is now working with a lawyer to get his medical records.

Sodium amytal is a strong barbiturate described as a ‘truth serum’ because it makes the recipient lose all inhibitions.

Mr Bell added: ‘According to Dr Milner we were out of control kids. We were an experiment.

‘We had no rights, no love, nothing. Just a piece of meat for someone to play with.’

Amanda Solloway, MP for Derby North, who raised the issue in Parliament, said: ‘I think it’s very important that this has come in the public domain and the update from the police shows that anybody who was ever abused at any point in their life should feel confident to come forward because it will be taken seriously.

‘Crimes have been identified and that is positive. I want to thank the police as well. This is an ongoing investigation that has been detailed and shows they are taking this seriously.’


 

I have a growing list of units that have a 75 yr + blocks on the files.

Units that drugged children are heavily protected. The iiCSA cherry pick

In fact, there was quite a few on a block re CofE

I found 1 on the CofE & it was about a child abused.


Mar 11

Teresa Cooper, abused at Kendall House in Gravesend, lodges complaint against Kent police

In 2009 Kent Police carried out an investigation into the way it had handled allegations of abuse at the home, but found insufficient evidence to pursue charges against those responsible.

After the full extent of the abuse at the Pelham Road home was finally revealed by an independent review last year, the force received a Freedom of Information request for the disclosure of their 2009 report.

Ms Cooper claims the police report clearly identifies her and has begun the process of complaining to the Independent Police Complaints Commission (IPCC) for what she views as a breach of data protection.

She said: “I do not think it is appropriate for police to send out confidential information that survivors of abuse have given to them in confidence, even if they have put their life in the public domain.

“There’s a lot of information that I never put in the public domain that was in that report.

“The police had no right to send out that kind of information, whether it’s me or anyone else.”

A police spokesman confirmed the force had received a complaint regarding the disclosure of the 2009 review, but said it would not be recorded.

They said: “The review had been redacted to remove any personal or identifying features.

“The elements of the complaint were considered but it was decided the complaint should not be recorded as such.

“The complainant was provided with details of how to appeal to the Independent Police Complaints Commission should they not agree with the decision.”

Kent Police was criticised in last year’s independent review, which was commissioned by the Bishop of Rochester, the Rt Rev James Langstaff, in January 2015, after years of campaigning by Ms Cooper.

Meanwhile, Ms Cooper has stopped pursuing legal action against the church over birth defects suffered by the children and grandchildren of former residents due to costs.


Update:

‘I was tied up, drugged and abused at the age of 12 – by a doctor’

Liverpool woman Barbara O’Hare has written a book about how she survived secret medical experiments

3 FEB 2017

“I didn’t understand what sexual abuse was because I was a 12-year-old kid – a very naive 12-year-old kid. And I was in a hospital where I thought I would be safe.”

Barbara O’Hare, now 58, is sitting in her Liverpool home and painfully reliving the trauma of her childhood.

She has lived here since escaping the hell she documents in shocking detail in her book The Hospital: How I Survived The Secret Child Experiments At Aston Hall (to be published on February 9 by Blink, £7.99).

 

Dr Kenneth Milner

More than 50 alleged victims have claimed Dr Milner tied them down, injected them and pumped them with high-dose drugs before questioning them about their experiences as a child. Others claim they were sexually abused by Dr Milner, who died in 1976.

http://www.derbytelegraph.co.uk/aston-hall/story-30115144-detail/story.html

 

The former Aston Hall Hospital was in Derbyshire and the activities of the late Dr Kenneth Milner, who was Aston Hall’s head physician from 1947 to 1975 and died in 1976, are currently the subject of a major police and NHS investigation.

Barbara says: “Milner left me confused, traumatised and very, very frightened – and he destroyed my mind, body and soul.”

Brought up in the Midlands, Barbara had an extremely unstable and fragmented childhood – spending much of it with foster parents and in children’s homes. She did know her dad, but for many years didn’t know if her mum was alive or dead, saying: “I don’t know if dad was trying to protect me or spite her.”

Eventually she ended up at Aston Hall Hospital which, before 1948, was known as the Nottingham Corporation Home for Mental Deficients.

Barbara explains: “I was apparently sent there because I had behavioural problems, but I wasn’t the problem – the adults were always the problem.”

Of her nightmare time at Aston Hall, Barbara says sodium amytal, a barbiturate derivative with sedative-hypnotic properties, was used by Milner, supposedly aimed at correcting bad behaviour.

She says: “I would be tied up and injected by a nurse as I lay on a mattress in a padded room and left feeling like a piece of stone, with every muscle frozen.

“Then Milner came in and put three cushions next to the mattress and lay down on them. I never saw the mask he put on my face coming, but I remember it hurt my skin – and ether was then dripped on it which made me go unconscious.

“Along with many others, I was sexually abused and experimented on. But I actually think the worst thing he did was label us. He was happy to label us ‘mental defectives’ in a bid to justify his sick experiments.

“It is my feeling he was knocking us out on order for paedophiles. I have no photographs of myself as a child and it kills me to say this and makes me feel sick to the stomach, but in my heart I believe the only pictures of me that will exist could be in the possession of paedophiles – I am sure pictures were taken as I was lying in that room.”

“Milner was at the hospital from 1947 until 1975 – who knows how many more people like me there could be? My Facebook group (Survivors of Aston Hall) currently has between 30 and 45 active members, depending on how they are coping at any given time, but I think my book will open the floodgates.”

Since leaving the hospital, Barbara’s life has often been troubled and traumatic – it has included spells of being homeless and living on the streets of London, while she spent years hitting brick walls and being wrapped up in red tape as she tried to make sense of what happened to her as a vulnerable 12- -year-old and get hold of her medical files.

She was also diagnosed with cervical cancer and credits Liverpool Women’s Hospital and Clatterbridge Hospital with saving her life.

And today she says: “I want closure. I want to know the full truth of what happened. I can’t see there ever being a conviction. Milner is the person who should have been convicted but that can’t happen. I would have liked to have seen him treated like we were – locked in a dark room and feeling terrified.

“I want an apology but I don’t think the powers-that-be know how to say sorry. It would be a fake apology if it comes.”

A spokesman for Derbyshire Police confirmed investigations were ongoing.

And a spokesman for Derbyshire Healthcare NHS Foundation Trust said: “The allegations of historical abuse in the 1960s and 1970s at… Aston Hall Hospital are very serious. These allegations are being investigated by a partnership of agencies, including health and the police through the Derbyshire safeguarding children board.

“It would be inappropriate to comment further while these investigations are underway.”

Stephen Edwards, a solicitor from Liverpool-based Armstrongs Solicitors, is representing Barbara and other alleged victims of Dr Milner, and has previously said: “We represent a number of individuals in respect of civil claims for damages arising out of the subject matter. Our aim as solicitors is to support our clients during this difficult and upsetting process, but further to ensure that they are compensated for the atrocities in which they have sadly been involved.

“We would prefer not to comment further as to any specifics of the cases, save to say that we are satisfied that our clients have strong cases.”

http://www.liverpoolecho.co.uk/news/liverpool-news/i-tied-up-drugged-abused-12554171

Home channelled girls to ‘truth serum’ hospital

  • 5 February 2017

Girls in local authority care may have faced experimental drug treatment after being channelled via a remand home.

Breadsall Remand Home in Derby took girls from the Midlands and Yorkshire and sent many to Aston Hall Hospital.

The hospital has been accused of using a discredited “truth serum” therapy on patients as young as 11.

An ex-patient said the revelation made her “disgusted to the pit of my stomach”.

 
Dr Kenneth Milner, Aston Hall’s medical head, is accused of carrying out traumatic “therapies” on children

Aston Hall in Derbyshire was opened in the 1920s for those deemed to have mental health problems. It could cater for about 100 children of both sexes, but took adults as well.

It closed in the 1990s but comments on a website about derelict buildings brought its grim history to light.

Former patients began to swap experiences, describing Aston Hall as “pure hell” and “a horrendous place”.

This put the focus on Dr Kenneth Milner, who took over the centre in 1947.

 
Sodium amytal, a so-called truth serum, was originally used on traumatised soldiers

A treatment run by Dr Milner saw patients, including a number of children, being isolated, stripped and drugged, according to claims.

Records show he was using sodium amytal and may have been employing “narcoanalysis” – a military method for treating servicemen with repressed traumatic experiences, which was largely abandoned after World War Two.

This evidence, combined with a lack of published research and few medical records, have led to Dr Milner’s methods being called into question.

Many former patients have spoken of the trauma of the process, with some claiming to have had false memories of abuse suggested to them and even been sexually abused by Dr Milner.

But new research has shown there was a system for bringing children, particularly girls, to Aston Hall.

breadsall-milner-records

 Inspection reports revealed doubts about Dr Milner’s treatments in the 1960s

The National Archives show a single remand home may have made hundreds of girls available to Dr Milner, despite the doubts of regulators.

These documents show Dr Milner was available to provide psychiatric reports for those admitted to the Breadsall Remand Home for Girls as far back as 1964.

The home, which held about 20 children at any one time, mostly served the Derby and Nottingham areas, but took girls from at least 11 other local authorities, including Sheffield, Leicester, Coventry and Stoke.

The same year, the home’s committee asked the regional board to consider the appointment of a children’s psychiatrist, rather than Dr Milner and Aston Hall, as “more appropriate” to its work.

 Former patient Barbara O’Hare finds it hard to even look at the Breadsall home – now a private building

But a 1966 report shows Dr Milner was still examining girls at the home, and a year later councils were recorded as using it “as a means of bringing very disturbed girls to the attention of Dr Milner”.

An inspection in February 1971 said “Dr Milner continues to be associated with this remand home through… the superintendent. He sees cases at her discretion.”

The superintendent, recorded as Miss IP Brookes, is believed by police to have died. Dr Milner retired in 1975 and died shortly after.

 

breadsall

Barbara O’Hare was 12 when sent from Coventry to Breadsall, where she said she was visited by Dr Milner.

“He came in and said ‘poor girl’ and stroked my hand.

“He said: ‘Would you like to come to hospital?’ and I thought it would be an escape. I was expecting grapes and comics.”

Ms O’Hare, who had always been confused by how she came to be in Derby, has waived her right to anonymity to publicise what happened at Breadsall and Aston.

At the hospital she said she was taken to a bare room, given sodium amytal and subjected to “terrifying” questioning.

She said about the latest revelations: “I am disgusted to the pit of my stomach and I am shocked. Everything has gone together like a jigsaw.

“Everything that I’ve been trying to prove and say for years is there now. This proves a lot of people stories.”

Ms O’Hare is among 30 former patients who have submitted a claim for compensation to the Department for Health through a solicitor. Other claims are also believed to have been submitted.

A spokesman for the department said the matter was under investigation.

Derbyshire Safeguarding Children Board, a multi-agency body including police, health and social services, says it is working to ensure the allegations are thoroughly investigated and the appropriate support is in place for people who need it.

Det Insp Gemma Booth from Derbyshire Police said: “The scale and nature of this inquiry naturally means that this is protracted and complex.

“The investigation team have focused on meeting former residents of Aston Hall Hospital as well as identifying and tracing other witnesses who can offer their recollections, including previous staff members.

“A large part of the inquiry involves reviewing records and the investigation team is working closely with archivists in both social care and the NHS to trace, locate and review these.”

Derbyshire County Council, which was ultimately responsible for the Breadsall home, said it could not comment while investigations were under way.

link

Kendall House: Church faces massive payout to abuse victims

Jan 14 2017

Former residents of Kendall House in Pelham Road, Gravesend have been seeking out solicitors since the results of an independent investigation into its “harrowing” regime were published in a review last summer.

The results of a further review were released just before Christmas and “gratitude” payouts of £1,000 have already been made to the more than 20 women who gave evidence, but many of them are still suing the church for what happened to them.

Samantha Robson, of Robsonshaw Solicitors, has been bringing claims against the church over Kendall House since 2011, with six more victims coming forward since the review was published.

“Closure is very important to these women who finally want recognition for their mistreatment when they were vulnerable children,” she said.

“Some of these victims have suffered significant health issues as a consequence of their treatment at Kendall House. Often claimants will need to be examined by a specialist psychiatrist to provide evidence on mental health issues.

“In other instances, claimants have suffered conditions such as fibromyalgia (a long-term condition causing pain all over the body), which may have been affected by the drugs administered at the children’s home.”

The church is insured for such cases and has already settled a number of them, with Mrs Robson securing a five-figure award of compensation for a woman who lived at Kendall House in the 1980s.

Mrs Robson, who has been specialising in sexual abuse claims for 16 years, said the church was taking a “positive” approach to the cases and did not want to prolong the victims’ suffering.

She added that the church would likely end up paying out hundreds of thousands of pounds in damages and legal fees.

Campaigner Teresa Cooper, who last month described the £1,000 gratitude payments as “an insult”, is one of those pursuing action over birth defects suffered by the children and grandchildren of former Kendall House residents.

Ms Cooper’s daughter Sarah was born with a cleft palate and her two sons and grandchild also have serious health issues, which Ms Cooper believes are as a result of the drugs she was given at the Gravesend home.

Her solicitor, Madeline Seibert, of Attwaters Jameson Hill, said last year: “The women residents of Kendall House need closure and justice in relation to these tragic events.”

Back in 2010, the church agreed an out-of-court settlement with Ms Cooper to the tune of £50,000 but did not accept liability for the abuse until the review was published last summer.

She contributed to the second review and the panel, chaired by Dr Sue Proctor, who led the investigation into disgraced DJ Jimmy Savile, thanked her for her efforts.

link

Update: Kendall House: Church payments to drugged girls an ‘insult’

22 December 2016

Teresa Cooper said: “They made my life a walking, living, breathing hell. We were pumped full of drugs over and over again by force.”

She said she had been left suicidal and unemployable, and lives in constant pain.

She said the £1,000 payment she received failed to atone for the illnesses she had suffered since being at the home.

link

Image result for queen elizabeth wealth gold crown
The head of the church – Queen Elizabeth’s wealth.
queen-wealth
What is the Church of England worth?
The Church Commissioners manage the historic assets of the Church of England, worth more than £4 billion. The portfolio of assets includes stock market investments, and commercial, residential and rural property investments
The Church of Englnd invests in big pharmaGlaxoSmithKline, Unilever (Leon Brittan, Malcolm Rifkind, Philip J Boeckman )
 Mar 22, 2016 – UK pharmaceuticals firm GlaxoSmithKline faces claims of corruption, bribery, wrongful death, and dumping live polio virus into a Belgian water

UK fraud office probes GSK after claims of foreign bribery

link

GlaxoSmithKline faces fresh drug bribery claims in Syria

68974827_v_charttwo
GlaxoSmithKline
Unilever &

pizzagate

Unilever, Acumen, and the Clinton Giustra Enterprise Partnership announce USD $10 million Clinton Global Initiative Commitment to Action to support smallholder farmers

Sir Malcolm Rifkin another executive with ties to pedophilia and this massacre at a school where kid were getting abused, so it sounds like it was planned. He stepped down in 2015 from Unilever board for play for cash. He earned more with Unilever than as a foreign minister in the UK
Unilever ties to save the children

There’s no way Unilever could be linked to $-billion enterprises like global child sex trafficking and child pornography rings; the global arms trade; narcotics production and trafficking operations; or industrial-scale money laundering (for example).

I mean, the fact that Unilever’s chief executive, Paul Polman, partners with the Lynn Forester de Rothschild to write business articles?

Such collaboration (friendship too?) can only prove that Unilever has a moral and ethical leader. Because, after all, the Rothschilds – as is well known – gave away their staggering, blood-money fortune in order to alleviate global poverty. (I may be wrong about that last bit),

Touchingly, Lynn Forester was introduced to her husband, Sir Evelyn de Rothschild, by Henry Kissinger at the 1998 Bilderberg Group conference.

And I’m certain that the “family investment company” Lynn and Sir Evelyn established in 2003 – “E.L. Rothchild” – is not connected to any of the aforementioned wicked global trades or money laundering, either.

http://www.ilsole24ore.com/art/economia/2014-05-23/the-capitalist-threat-to-capitalism-183715_PRN.shtml

http://knowledge.ckgsb.edu.cn/2013/06/26/china/el-rothschilds-investments/

“One of the rare items concerning the TAVISTOCK INSTITUTE appears in Business Week, Oct. 26, 1963, with a photograph of its building in the most expensive medical offices area of London. The story mentions ‘the Freudian bias’ of the Institute, and comments that it is amply financed by British blue-chip corporations, *** INCLUDING UNILEVER *** …”

http://www.whale.to/b/tavistock_q.html

“Harold Bridger, the last surviving founder member of the TAVISTOCK INSTITUTE OF HUMAN RELATIONS, has died at the age of 95 … Bridger worked intensively with a wide range of client companies, including Philips, Shell and UNILEVER; his work with Unilever, in particular, spanned many decades…”

https://www.ispso.org/news:bridger-obituary

“‘In the Sports Palace we were Hitler’s personal guests of honour and were shown onto a podium next to Goebbels and Göring’, writes Paul Rijkens, UNILEVER’S Senior Director in the years leading up to the war…

“Unilever’s close relationship with Hitler continued when, in 1932, the German Government suspended the Gold Standard and imposed control on the export of money from Germany. In order to trade and make profits Unilever needed concessions from the German Government and ultimately from Hitler.

“Rijkens wrote: ‘We would not only try to get a business agreement but would try to get on friendly relations with the Nazis.’”

http://newint.org/features/1987/06/05/keynote/

unilever-logo-icecream
Unilever logos for ice cream

 

GlaxoSmithKline –

Sex tape started GlaxoSmithKline bribery inquiry in China

link


Kendall House Addendum to Main Report

Kendall House Review Report

Update December 2016:

Following the publication of the Kendall House Review report earlier this year, the Dioceses of Rochester and Canterbury wanted to ensure that any former residents who had not contributed to it, were given an opportunity to record their experiences. The Kendall House Review Addendum is the result of those conversations with the Review Panel and should be read alongside the original report.

Kendall House Review Report
Kendall House Addendum to Main Report, November 2016
Statement from the Review Panel

http://www.rochester.anglican.org/kendall-house-review-report.php


Dec  16 2016

Main Report can be accessed HERE
Click images below to expand, or click HERE to view PDF report.

What can I say? The report  begins well and gives due credit to Teresa Cooper for the 30 years of her tireless struggle to achieve recognition for the maltreatment meted out to her and other residents.

And there it ends. One might ask, given the unprecedented access that Dr Sue Proctor had to Kendall House and Church of England records, why there is no reference to any official documents that might corroborate the testimony of the former residents that participated. One might further ask why the only reference to any official documentation in this report is to note its absence when particularly damning allegations are made by former residents – including the legally sensitive (for the Church of England) subject of organised drug experimentation on children at Kendall House.

Doesn’t that seem odd to you? No documented corroboration of witness testimony – but the noting of the absence of corroborative documentation when it suits?

If I were a conspiracy theorist I’d have a field day with this report – as I’m not, I’ll just say that this report falls far below what I’d expect from an independent report undertaken by professionals.

link

Update: Dec  13 2016

Kendall House: More harrowing accounts of historic abuse at Church of England children’s home in Gravesend

Harrowing accounts of historical child abuse have been revealed by a further review into a Church of England home for young girls.

More than three decades of cruelty at Kendall House in Gravesend was first exposed by the findings of an expert panel in June, with residents found to have been drugged, sexually assaulted, locked in an isolation room and kept in straitjackets.

The 137-page report, compiled by Dr Sue Proctor, part-time judge Samantha Cohen and former police detective superintendent Ray Galloway, described Kendall House as “a frightening, violent and unpredictable place to live”.

Dr Proctor, who chaired the investigation into disgraced DJ Jimmy Savile, said the abuse at Kendall House was the most troubling thing she had worked on.

So many other former residents came forward after its publication that the Rt Rev James Langstaff, Bishop of Rochester, agreed to an extended review, which has resulted in testimonies from one woman who was just nine when she was sent to Kendall House.

She had never been in a children’s home previously and it remains unclear why she was sent there, with other girls sent there by the Dioceses of Rochester and Canterbury ranging from 11 to 16-years-old.

She arrived in the mid-1970s and was quickly introduced to the superintendent Doris Law, who oversaw what went on at the home.

Another of the girls interviewed for the extension was 15 when she arrived at Kendall House in the early 1970s and recalls barred windows on the outside.

She was also introduced to Miss Law soon after her arrival, who is said to have pulled her by the hair and handed her over to two other women.

First impressions of the building in Pelham Road, which opened in 1947, were said to demonstrate a “nasty, horrible atmosphere”, with new arrivals left scared and confused by what was happening to them.

One woman recalled: “An injection would happen if you’d had an argument with somebody, if they felt you were being rude or disrespectful. Anything you stepped out of line for, in their eyes, then you got sedated, basically.

“This injection would literally just knock you out completely, out cold, and I would just remember the next day, the next morning. I’d be in bed and I’d be like I can’t remember how I got there.”

Girls were also administered tablets, which staff told them were simply vitamins and would sometimes hand them out at meal time. If they refused to take them, staff would threaten them.

Psychiatrist Dr Marenthiran Perinpanayagam would oversee much of the drugging and a failure to properly hold him to account was identified as one of the Dioceses’ major failings in the original report.

Staff were also said to take blood and urine samples from those they drugged, and Miss Law and other senior diocesan officers were said to downplay such practices in meetings with social services.

Girls staying at Kendall House were regularly threatened for misbehaviour with being sent to the psychiatric hospital Stone House, which shut in 2007. One girl who was taken there was given electric shock treatment.

Such issues were reported to Kent Police, but officers have been accused of not taking the concerns of the girls seriously.

The report states that no further investigations took place despite the serious nature of the allegations and many of the girls were driven to self-harm.

Sexual assault accusations have also been raised with police since the home shut in 1986, but these also haven’t been followed up. One of the women interviewed said that police had told her the abuse was “in her head”.

Campaigner Teresa Cooper

One of the four former residents to contribute to this week’s report was Teresa Cooper, who has spent the last three decades fighting for a full investigation into Kendall House.

Ms Cooper did not take part in the original review due to a dispute over the terms of reference, but the panel felt she should be included in the extension.

The panel acknowledge that many of the complaints made about Kendall House in the years since its closure were made by Ms Cooper.

If Kent Police had done something about it at the time, they would have found the same things that the review did,” she said.

The police were not trying to help me, they were trying to help themselves. They didn’t deal with my allegations properly. Rather than try to deal with it they have actually gone out of their way to discredit me.

“Kent Police didn’t think for a minute that a review would come out. They owe me a huge apology. They screwed up and they need to accept that they screwed up.”

link

Teresa Cooper‏ @Teresacooper

Oct 4

The British Medical Association who knew he was mass drugging us and OD us & they supported him. New info from Kent police breach of my data


EXPERIMENTAL drug trials on school children were approved by Home Office doctors in the 1960s, it has been revealed.

Disruptive boys were given an anticonvulsant drug to see if it would help to control their behaviour while a proposal to give girls a powerful sedative was also considered.

In the disturbing revelations, exposed in National Archive files, parents were not consulted with consent left to managers.

richmond hill school b & w

Richmond Hill Approved School

The anticonvulsant drug trial was performed at the Richmond Hill Approved School in North Yorkshire, which housed male students aged 15-17 years-old.

The school for boys was established at a Victorian building on the site in 1961 after The Green Howards moved from its regimental headquarters and continued until 1973, when approved schools were replaced by community homes.

One of the documents was dated late 1967 and signed off by Dr JR Hawkings. He wanted to give some of them a drug called Beclamide

The proposal at the girls school had been considered for all students at the Springhead Park Approved School in Rothwell, which cared for 14 and 15-year-olds.

The drug that would have been trialled was Haloperidol, which is a powerful sedative now used as an anti-psychotic.

All three doctors involved in the drug trial plans are now deceased.

Home Office psychiatrist Dr Pamela Mason approved of the drug trials, saying she recommended “maximum support” for the project.

As the Richmond Hill trial got under way, a second trial was proposed, again by a school psychiatrist, at Springhead Park Approved School for girls in Rothwell near Leeds.

This was a sister school to the better known Duncroft in Surrey, a small institution for girls of higher intelligence.

In November 1968, Dr Joyce Galbraith wrote to Dr Mason at the Home Office “in strict confidence”.

She suggested giving Haloperidol to every girl in the school, for 18 weeks.

Again, Dr Mason supported the plan.

The files also show that Shelagh Sunner, headmistress of the school between 1966 and 1982, did not support the trial.

Bob Hammal, a teacher at Richmond Hill between 1968 and 1972, said he did not know about the trial at the time and is appalled.

link

http://www.bbc.com/news/uk-37149029http://www.bbc.com/news/uk-37149029

https://www.thesun.co.uk/news/1652873/home-office-docs-agreed-seedy-secret-drug-trials-on-restless-borstal-boys-in-60s-files-reveal/


P.O.I.

joyce galbraith

Dr Joyce Galbraith, a psychiatrist working at Springhead Park (Dr Joyce Galbraith, the archivist of the York Medical Society)

Dr JR Hawkings, a psychiatrist working at Richmond Hill

Dr Pamela G Mason Home Office psychiatrist

^ In cahoots  with Henry Hunter of Balderton Hospital?  

 

 

 

and Dr Kenneth Milner of Aston Hall Hospital

via Kaz

“In Nottinghamshire, there were a series of lunatic asylums used to house wayward children. Those that refused to conform to schooling or the structure of family life. Doctors that thought nothing wrong in testing new anti-psychotic drugs and new treatment methods on the inmates…”

“This work was led, from what I can gather, by Dr Henry Hunter of Balderton Hospital in Newark, Notts. Funded by the Sheffield Health Authority, he accessed patients from numerous asylums around the region.

In turn, the doctors from these asylums trawled the children’s homes and secure units, looking for viable subjects for upcoming research or drug trials.”

“Over the years, Dr Hunter, Superintendent of Balderton saw fit to “borrow” patients from other facilities in the area.
Whittington Hall Hospital
Nottingham County and Borough Lunatic Asylum
Harmston Hall Hospital
Glenfrith Hospital
Aston Hall

Treatments included Chloropromazine, Trifluoperazine, Sodium Amytal, Ether, sensory deprivation.”



Police launch investigation into historic abuse claims at Derbyshire children’s hospital Aston Hall

FORMER child patients at a hospital at the centre of abuse allegations have told how they were drugged and thrown into padded rooms “to find out why they were misbehaving”.

“They said they wanted to find out where things had gone wrong when I was a kid, treatments at night time, at eight or nine o’clock. When we saw the car pulling up, we were petrified. We would scream. We were normal healthy children. There was nothing wrong with us. I don’t know why we were there.”

Det Insp Simon Tunnicliffe, head of Operation Hydrant, said: “A number of people have contacted the police wanting to talk about their experiences at Aston Hall.


mental-650095

The psychiatrist and hospital chief superintendent Dr Kenneth Milner (right), is alleged to have injected children with the truth serum sodium amytal before sexually abusing them. 

link

thehorrors

Kenneth Oswald Milner was born on June 26, 1909, and educated at Wakefield Grammar School and Leeds University, graduating with honours in 1933 and gained his medical doctorate at the university in 1939.

It said he served as a medical officer in HM Prison Service at Broadmoor Hospital and later as deputy medical superintendent at Rampton Hospital.

Aston Hall

This was before being appointed physician superintendent at Aston Hall Hospital in 1947, where he remained until 1975.

http://www.express.co.uk/news/uk/652148/police-investigating-abuse-allegations-Aston-Hall-Derby-Operation-Hydrant-truth-serum

http://www.derbytelegraph.co.uk/just-troubled-teenager-ended-aston-hall-forget/story-28810446-detail/story.html


Establishment Physician – Dr Pamela Mason

pam mason queen

 1984-87 Pamela Mason  Queen’s Honorary Physician

link

pamela mason who's who scan enlarged

Pamela Georgina Walsh Mason married first to David Paltenghi and

then to Director/Producer Jan Darnley-Smith in 1965

pamela georgina mason paltenghi

MASON Pamela Georgina Walsh, Medical Officer; Psychiatrist, m. (1) David Paltenghi. 1949, dec. 1961, 2 sons, (2) Jan Darnley-Smith, 1 965. Education: Christ’s Hospital School, Royal Free School of Medicine. University of London; MRCS.

jan darnley-smith

Career

Dr Pamela Mason Senior Principal Medical Officer at the Department of Health and Social Security

pam mason holloway

Visiting Psychiatrist, Holloway Prison, 1962-67 (When Myra Hindley was there)

link

1987

MASON, Pamela Georgina Walsh 34 Goodwood Ct., Devonshire St., London W1N ILSMB BS Lond. … Late: Hon. Phys. HM the Queen; Sen Pnncip. Med. Off. DHSS; Cons. Psychiat. Childr Dept. Home Office

link

Adviser to Church of England Children’s Society 1962-


1967

Pamela Mason MB, BS, DPM Consultant Psychiatrist to the Home Office Children’s Department and Visiting Psychiatrist to Duncroft Approved School.


Social Work Today – Volume 1 – Page 21

https://books.google.com/books?id=h1VFAQAAIAAJ
1970 – ‎Snippet view

Peter Righton of the National Institute for Social Work Training spoke on the relationship between residential and community-based … Dr Pamela Mason, who is psychiatric adviser to the Home Office children’s department, speaking about …

https://www.google.com/search?tbm=bks&hl=en&q=dr+pamela+mason+and+righton



via WW:

All of this was government run and controlled.


duncroft savile mason

Jimmy Savile visited Duncroft Approved School for Girls in the 1970s, pictured here, in 1974, with staff members and students

 

Dr Pamela Mason 

Consultant Psychiatrist to the Home Office Children’s Department

and

Visiting Psychiatrist to Duncroft Approved School.

Pamela Mason, who supported the drugging of these children in Richmond Hill Approved School and in Springhead Park Approved School, without parental consent, was the Home Office visiting psychiatrist at Duncroft Approved School where  Jimmy Savile visited and had his own room.

Duncroft, a ‘paedophile sweet shop’…

Savile abused 23 girls at a school for emotionally disturbed teenagers where he was given ‘unrestricted and largely unsupervised’ access to youngsters, a report revealed.

The paedophile DJ carried out at least 46 sexual offences Duncroft School.

He was even allowed to stay overnight and abused girls across the property and in vehicles parked outside, including his Rolls-Royce.

The abuse even took place in the principal’s office

He is also recorded to have twice stayed at Norman Lodge, a hostel in the grounds used as a place of transition for girls who had gained employment, and also visited the intensive care unit twice.

http://www.dailymail.co.uk/news/article-3060559/Jimmy-Savile-abused-23-youngsters-Duncroft-School-emotionally-disturbed-teenage-girls.html

James Robertson Justice, a bosom pal of Prince Philip

http://www.dailymail.co.uk/femail/article-1319004/Molly-Parkin-I-abused-father-I-affair-man-30-years-older.html

78706595_prince_phil_83670c

Former pupils recall that other visitors included the popular character actor James Robertson Justice and  the Conservative politician, Home Secretary (1957–62)  Rab Butler.

http://www.dailymail.co.uk/news/article-2220802/Meirion-Jones-BBC-war-astonishing-claims-reporter-aunt-saw-Savile-abuse-school.html

https://www.thefreelibrary.com/My+seven+years+of+three+in+a+bed+love%3b+BY+THE+STREET’S+ALMA.-a092591040

link

link

Dan Davies writes about the Duncroft home in his book about Savile:

“Many of the 25 or so girls in its care at any one time came from comfortable backgrounds and included the daughters of ambassadors and BBC producers. As a Home Office-approved school, funding came from Social Services.

Regular guests at their parties included the actor James Robertson Justice, who was one of Britain’s leading film stars in the 1940s and 1950s and reportedly a close friend of the Duke of Edinburgh. Princesses Marina and Alexandra are said to have attended.

Among the former Duncroft girls to have come forward, one has said she was put in the isolation unit for ‘two or three days’ after loudly protesting when Savile groped her in a caravan on the school grounds. ‘For years we tried to report him,’ another confided to me. ‘We even had a mass breakout to Staines police station.’

link

article-2220802-15785516000005dc-383_320x307

Police cover up Savile’s claims to be friends with Queen’s cousin: Paedophile ‘visited (Duncroft) school at centre of abuse allegations with Princess Alexandra’

article-2550472-1b261e3100000578-94_634x411

Angus Ogilvy and wife Princess Alexandra

  • Paedophile Jimmy Savile mentioned first trip to Duncroft  school at centre of abuse claims
  • He said he was with Princess Alexandra, a patron of the school
  • Made claims during police interview, the transcription of which was edited
  • Information was removed by Surrey Police but has now been unveiled

jimmy-savile-sir-ogilvy-363573

Sir Angus Ogilvy, Princess Alexandra’s husband (left) with Jimmy Savile. All mention of the former DJ’s claims to friendship with the royal was initially omitted from police transcripts

In his 1974 life story Savile wrote: “Princess Alex is a patron of a hostel for girls in care. At this place I’m a cross between a term-time boyfriend and a fixer of special trips out.”

wald-duncroft-collect4.JPG

Jimmy Savile was a frequent guest at garden parties at Duncroft Approved School for Girls  and had his own room there

prince charles savile duncroft cover up poster

The Daily Star Sunday has asked the Information Commissioner’s Office (ICO) to investigate the redactions and consider the arguments any outside bodies made.

As we revealed in May, Government papers showing links between Savile and Prince Charles were redacted.

http://www.dailystar.co.uk/news/latest-news/346148/Royal-cover-up-Police-censor-Jimmy-Savile-interview-transcript


Duncroft – Closed Records for 85 years

duncroft20file20closed_zpsndzr0oh9

Duncroft  – 01/01/1963 – 31/12/1975  

Reports of visits by Home Office inspectors

This record is closed

Closed For 85 years
Opening date: 01 January 2061

http://discovery.nationalarchives.gov.uk/details/r/C6099703


 

The Walton Hop was situated only five miles from Jimmy Savile’s haunt the infamous Duncroft Approved School.

 Girls were also  allowed to attend the Walton Hop which was within walking distance and were sometimes provided with ‘escorts’

Walton Hop was  the hunting ground for convicted abusers such as Chris Denning, Jonathan King and Tom Paton – the latter of Bay City Rollers infamy.

The management must have been aware of this, permissions granted and ‘escorts’ arranged?

How was it that  the underage patients knew about the abuses, as did other visitors and yet, according to the statement Mind has issued, it would appear that staff and indeed Mind has no knowledge of this?

link


1968, Dr Joyce Galbraith suggested giving Haloperidol to every girl in the school, for 18 weeks.

Background on Springhead Park School for Girls

A major aspect of the cost of maintaining Springhead Park, Sheffield, and of many other CHEs, was that of the employment of large numbers of staff. This raised the weekly fees to a level that deterred many local authorities from using the service.

In Springhead Park, a CHE for 30 girls, there were a Principal, two Deputies, a Head of Education, three full-time teachers, two Group Leaders and a team of residential social workers, a field social worker, a bursar, two office staff, a cook, a handyman, a gardener and domestic staff. It is hardly surprising that at the time of its closure in 1986 the weekly charge was £423 per week per girl. Part of the explanation for the policy of providing a high child/ staff ratio was the belief that change in the child could be best achieved through effective interpersonal relationships.

http://www.thetcj.org/child-care-history-policy/the-reality-of-closure

springhead20home1_zpsd9kb0jkm

Springhead Park School for Girls age 14-16yrs – provided domestic training and instruction in gardening. 

The establishment also had facilities for the treatment of venereal disease!

springhead202_zpsbokhinca


 


http://www.childrenshomes.org.uk/RothwellAS/

richmond and springhead natl arch

 1965 Jan 01-1966 Dec 31 Springhead Park Approved School, Rothwell, near Leeds, Yorkshire: opening of the school by Her Royal Highness Princess Marina and speech by the minister of state

Springhead Park Approved School, Rothwell, near Leeds, Yorkshire: reports of visits

1965 Jan 01-1974 Dec 31

This record is closed

Closed For 78 years
Opening date: 01 January 2053

http://discovery.nationalarchives.gov.uk/details/r/C11133104

springhead barnados
1975 MIND’s Springhead Park School for Girls  was being considered  for take-over by Barnardos
http://mandatenow.org.uk/wp-content/uploads/2015/04/Operation-Outreach-29-4-2015-11186-link.pdf 

Richmond Hill School, Richmond:

richmond hill school 1

1950 Jan 01-1965 Dec 31

Richmond Hill Approved School, Richmond, Yorkshire: complaint of irregular punishment

http://discovery.nationalarchives.gov.uk/browse/r/h/C11133102

Richmond Hill Approved School, Richmond, Yorkshire: complaint of indecency

This record is closed

1965 Jan 01-1968 Dec 31

Closed For 93 years
Opening date: 01 January 2062

http://discovery.nationalarchives.gov.uk/details/r/C11133103

richmond20hill20school202_zpsvga0ksey


Kendall House

Kendall House home in Kent (above), where Teresa was brought as a teenager, has been closed

 Kendall House was a private children’s home for girls based in Gravesend, Kent.

Until 1986,it was run and funded by the Church of England, overseen by the Joint Council for Social Responsibility for the Dioceses of Rochester and Canterbury. Girls who were placed there were aged between 11 and 16 years.

link

Young girls at a Church of England children’s home were drugged, sexually abused and bullied for two decades, a shocking report revealed.

An independent review laid bare the horrors of the now-defunct Kendall House between 1967 and 1986 where girls as young as 11 were left “broken”.

What happened in Kendall House…

Consider this line from the inquiry: “We have found that every former resident…was in fact the victim of abuse.”

And: Concerns about the medication regime at Kendall House were raised in the 1970s and 1980s. All were either ignored, rebuked or belittled.”

Long-term institutional abuse on young vulnerable girls was perpetuated by staff and tolerated by the Church of England.

link

link


Image result for howarth and rantzen
rantzen-howarth
bishop-james
Rt Revd James Langstaff aka Bishop James

Brent placed girls in Kendall House & Bishop James invited the then Brent leader  Howarth 2 help find KH review panel

 

1980 London Boroughs Children’s Regional Planning Committee

Meeting to discuss Kendall House

Apologies were received from Dr Peri.

Take note Wandsworth didnt attend. I know what view they held on Kendall House. Def number 1. Wandsworth a heavy user of Kendall House

The drugging of children in care documentary and Kendall House 1980

Kent police… They played a part with CofE & Wandsworth. In it together.


Teresa Cooper in her three years at Kendall House in the early 1980s, she was drugged with tranquillisers 1,248 times despite having no history of violent behaviour. 

Wandsworth Council in London had first referred her to the home.

She was raped on several occasions. Fellow residents of the home have suffered severe ill health following their time there.

More frighteningly, she and more than 90 per cent of the Kendall House residents who have so far come forward had children with birth defects, which the church has privately acknowledged are a result of the drugs that were forced upon them.

The drugs were prescribed by consultant psychiatrist Dr Marenthiran Perinpanayagam, who referred to himself as ‘Psychotherapist to the Home Office,’ on his notepaper.

In 1980, his methods caused a sensation after being exposed in a TV documentary, yet somehow Kendall House was allowed to continue operating its shameful regime. Teresa left at 16 in 1984, traumatised and barely able to read or write. Two years later the home was closed down following a Government report that expressed ‘extreme concern’ at the ‘administration of psychotropic drugs’ and said girls were ‘stripped of basic human rights’.

Dr Perinpanayagam died in 1988. He was never prosecuted.


Kendall House: Girls drugged and abused at Church of England-run home

13 July 2016

Girls at a church-run children’s home were routinely drugged, locked up and physically, emotionally and sexually abused, a review has found.

Hundreds of girls were sent to Kendall house in Gravesend in the 1960s, 70s and 80s, before it closed in 1986.

It found girls were heavily sedated and placed in straitjackets.

The review found girls as young as 11 were “routinely and often without any initial medical assessment, given antidepressants, sedatives and anti-psychotic medication”.

Drugs were administered in dosages exceeding usual prescribed adult levels to control girls’ behaviour, placing them in a constant stupor, and restricting their ability to communicate, the report said.

The review found: “The effects of the drugs also increased their vulnerability to emotional, physical and in a smaller number of cases, sexual abuse”.

Concerns about the medication regime at Kendall House were raised in the 1970s and 80s by residents, their parents, by some social workers and some employees. “All were either ignored, rebuked, ridiculed or belittled by those in the position of authority in the home,” the report said.

Many of the women, including Teresa Cooper, say they were also sexually abused at the home, sometimes while they were unconscious from the drugs.

Two former residents reported being raped on the premises in the late 70s inside the “locked isolation room”, one allegedly by a male visitor to the home when sedated, the other, allegedly, by several male visitors on different occasions.

“I woke up to people abusing me more than once and I think it’s possible I was abused by men from outside the home as well as staff,” she said.

stream_img

The Home Office consultant psychiatrist in charge, Dr Marenthiran Perinpanayagam, has said in the past that the drugs used by the staff at the home were safe and did not have side effects.

Girls in his care were given pills designed for schizophrenics, psychotics and Parkinson’s sufferers…without having been diagnosed with any of these conditions and often held down and forced to take them.

Nearly 30 years later, the children of girls in his care have learning difficulties, cleft palates, water on the brain and brain growths.

One of the women, Teresa Cooper, 41, said: “They turned us into zombies with those drugs. But we’re only just starting to find out that it may have affected our children as well.”

During 15 years as consultant psychiatrist to Kendall House – run for girls with problems by the Church of England’s Council for Social Responsibility in Gravesend, Kent – Dr Perinpanayagam wrongly prescribed girls drugs.

Valium was given at four times the recommended dose for an adult male. When his methods were exposed on TV it caused outrage although it seems no action was taken.


About 2.5 billion pounds of the Church’s portfolio is invested in shares listed in Britain or overseas, including in drug companies GlaxoSmithKline (GSK.L) and AstraZeneca (AZN.L)


BLM Abuse conference – London, 24 Nov 2016

Those who are accused of abuse seek anonymity and fairness of process, arguing that they should not be named until charged or at the end of a trial. That debate is one currently voiced in the media in particular by those whose names are well known but it is as important an issue for anyone irrespective of fame or fortune.

Does limitation have a future? A draft bill in Scotland seeks to remove limitation as a defence in sexual abuse claims. What are the implications of that proposal?

All of these issues and topics will be considered and debated at the annual BLM conference. This year we are delighted to be co-hosting this event with 39 Essex Chambers. Speakers will include eminent guests as well as those from 39 Essex Chambers and BLM, including:

Harvey Proctor, former Member of Parliament for Basildon and Billericay
• Peter Skelton QC, Crown Office Row – counsel to the Accountability & Reparations
Investigation
• Anne Tiivas, Director, Child Protection in Sport Unit, NSPCC
Samantha Cohen, 9 Bedford Row chambers
David Greenwood, Director & Solicitor, Head of Child Abuse Department, Switalskis Solicitors
• Richard Scorer, Principal Lawyer, Head of Practice Improvement, Slater and Gordon Lawyers
• Jonathan Wheeler, Partner, Bolt Burdon Kemp
• Neil Block QC, William Norris QC and Bernard Doherty, 39 Essex Chambers
• Fintan Canavan, Frank Hughes, Paula Jefferson and Michael Pether, BLM

This conference is for anyone already or potentially involved in the Inquiry or facing or managing claims for compensation as a result of abusive behaviour.
Topics/learning objectives*

Delegates will learn about:

• Unfounded allegations/anonymity: ‘trial by media’ (panel debate)
• The Independent Inquiry into Child Sexual Abuse (IICSA)
• Consent (debate)
• Abuse claims update
• Supporting victims and survivors

Teresa Cooper ‏@teresacooper

BLMLaw insurance & risk law

http://www.blmlaw.com/1975/21156/objects/events/abuse-conference—london–24-nov-2016.html

Paula Jefferson partner v KH cases, dodgy Greenwood KH legal Sam Cohen KH panel

Thousands of solicitors in the UK,1 is a partner in BLM law, 1 is KH legal I cant stand for good reason & 1 is on the Kendall House panel

KH review independent? How close can they all be? Paula and Sam & David tagging along. The odds of that must be very slim

Wandsworth & their insurers blocked police access to existing records in child abuse, rape, forced ODs. The insurers crop up yet again.

link

link

link

link

link

link

link

link

Cassandra Cogno @CassandraCogno

Follow for deeper understanding of Church of England corporate defence structures, investments & where the profits go

Joe @seaofcomplicity

Thanks Cassandra. Hope to lift the veil a little. Not much awareness amongst CSA survivors of the corporate structures. Hope to change this.

Incidentally, part of the Church of England insurance group is main sponsor of the National Festival of Hunting.


  Gilo‏ @seaofcomplicity

£100million to CofE from insurer nexus in 6 years. Legally seperated but morally affiliated.

Teresa Cooper‏ @Teresacooper

Lloyd’s knew there was a conflict of interest and refused me an alternative insurer once we found out DAS were partners with Ecclesiastical


Church of England’s links with insurer undermines justice for survivors of clergy abuse

26 Jul 201

Anglican abuse victims believe the Church’s close links with its insurer results in lower settlements to victims. NSS executive director Keith Porteous Wood thinks they’ve got a point, and offers solutions to put things right.

An insurance company connected with the Church of England has been accused by abuse survivors of having unreasonably resisted financial settlements because it has too close an association with the Church itself.

Teresa Cooper and Gilo (surname withheld at his request) made the case powerfully on the BBC’s Victoria Derbyshire programme on Friday 21 July (recording starts 14 minutes in).

The painstaking and revealing research carried out by these survivors demonstrates why the close relationship between the CofE and Ecclesiastical Insurance Group (EIG) will tend to suppress the level of settlements and makes the already difficult process of obtaining compensation for victims even harder. The Church of England founded EIG and remains affiliated to it.

The Anglican Church receives massive grants – a dividend in all but name – from EIG through the charity Allchurches Trust. For the period 2014-2020 this is likely to amount to around £100 million, according to the research of these survivors.

Another concern is the numerous bishops and cathedral deans and head teachers of schools with abuse problems that have been directors on EIG’s board. They sit in a non-executive capacity despite being experts neither on insurance nor, as far as we are aware, on any other corporate area. The question is: why are they there and what effect does their presence have on payouts to abuse victims?

More here:

http://www.secularism.org.uk/blog/2017/07/church-of-englands-links-with-insurer-undermines-justice-for-survivors-of-clergy-abuse

 

 


http://www.bbc.com/news/uk-40668079


Misc

card2

Comments on Kent Messenger Report

merkava_bob wrote:
I’ll repost what I commented this morning because obviously someone’s delicate sensibilities were offended (Wouldn’t be from KCC Social Services by any chance?)

Psychiatrist Dr Marenthiran Perinpanayagam was a complete and utter quack and charlatan. I had a client (I was involved in advocacy so don’t want give names) who was a patient of his. He’s field was supposedly adolescent psychiatry. My client had been very badly bullied at school and at this stage was temporarily in care at Glebelands Home in Maidstone (now closed)

Despite having supportive independent evidence of the bullying. This clown used a very primitive skin galvanometer Lie Detector test on a vulnerable client without taking any form of consent from legal guardian (obviously sceptical because any teenager in the 1970’s in care was seen as troublesome and lying delinquent!) Like a lot of Psychiatrists of that era he thought he was God (or maybe even the creator of God?)

He was also very liberal with the dosages of major tranquillizers (anti-psychotics, regardless of whether a client was psychotic or not) His favourite “liquid cosh” was largactl (chlorpromasine) in way above the recommended daily doseage.

I would also be very interested to know if another psychiatrist, Dr Glaisher and child psychologist Mrs Absolom were involved. They were then based at the Child and Adolescent Psychiatry Team in Wrotham Road.

The social work team at that time were also extremely suspect. It’s no wonder that these poor young women were not believed because one of the social workers on the team at that time was Nicholas Rabbet. Rabbet it turned out later was a superintendent of care homes in Islington and was also a prolific child abuser (Subsequently struck off by his own professional body) This is documented as was the inquiry in London as was police involvement. He also had connections I believe with the infamous Haut de la Garenne care home on Jersey that was also visited by Jimmy Saville.

Fortunately Rabbet will not be abusing anymore young boys (that was his speciality) He was subsequently arrested in Thailand and charged with numerous child sex offences. He committed suicide whilst in custody.

My heart goes out to these young women and to those brave enough to speak out.

The Kent Messenger or other journalists ought to do some further investigations especially with regards to Mr Rabbets murky presence as KCC social worker. I personally think that Kendall House in Gravesend is the tip of a very nasty iceberg concerning care homes in Kent.


14/12/2016 1
Turpin wrote:
From 1966 to 1972 there was an unknown number of disabled child deaths, in Islington and Hackney care, at the Beeches Ixworth Suffolk. This is a village close to the Henniker estate (Later home of abusive Islington Suffolk project)

I have just asked Suffolk Police to report the Beeches and Ipswich Family Psychiatric Centre to Op Hydrant to seek an overview to include Aston Hall and Kendall House. Aston Hall and Ipswich Family Psychiatric Centre research activity has a common factor of Royal Medico Psychological Assn which also links to William Sargent at St Thomas. The Kendall House psychodabblers seem to link back to Aubrey Lewis and Maudsley whose influence was behind RMPA and Cambridge Uni research asset Fulbourn Mental Hospital Cambridge.

The head of psychiatric research at Medical Research Council was IIRC Dr Peter Elliot. Whether Stowe old boy attorney general Nicholas Lyell took this into account when he applied various secret public interest custodianship cover up early 90s also extended to protecting from police inquiry Old Stowe boys Leonard Cheshire, Lord Henniker and Hayman ???

link

pamela mason holloway

1985 Dr Pamela Mason – Holloway Prison/ David Mellor

http://pb.rcpsych.org/content/pbrcpsych/9/12/247.full.pdfd Hill

https://books.google.com/books?id=h1VFAQAAIAAJ&dq=Home+Office+Pamela+Mason&focus=searchwithinvolume&q=+Mason

Home Office:

Sir Charles Cunningham 1957–1966

He became Permanent Under-Secretary of State at the Home Office (1957-66) during which time he encountered

the likes of R A Butler (Duncroft visitor) and

Roy Jenkins, now Lord Jenkins of Hillhead, with whom he is said to have had a colourful relationship.

(“PIE was so deeply rooted in the realm of the social elite and the political establishment that it had extensive influence. To have these links fully examined now would lead to the exposure of many highly influential individuals as being either practising paedophiles or the promoters of paedophilia.

Roy Jenkins with convicted child abuser Frank Beck  ( Janner)

It has to be remembered that Roy Jenkins (Home Secretary & the “Architect of the permissive society”) expressed support for PIE. The organisation also came close to having a private members bill to have the age of consent reduced to just five years of age introduced into Parliament. PIE was also linked to the security services. Some speculate that the security services used PIE to entrap, for the purposes of blackmail, people of influence. I believe that there is now sufficient circumstantial evidence in the public domain to support this assertion.”

https://nationalinquiry.wordpress.com/2015/04/15/open-letter-to-justicegoddard-re-pie-savile-and-nationalinquiry-paedobritain-corruption-csa/)

Sir Charles Cunnigham went on to become chairman of the United Kingdom Atomic Energy Authority (1966-71), chairman of the Uganda Resettlement Board (1972-73), and was a director of Securicor Ltd from 1971-81.

link

Sir Philip Allen Home Office 1966–1972Chairman of the charity Mencap from 1982 to 1988

http://www.telegraph.co.uk/news/obituaries/1570841/Lord-Allen-of-Abbeydale.html

He was also a member of the Diplock security commission for 18 years (1973-91), investigating, among other things, the salacious circumstances which brought about the resignation of Lords Jellicoe and Lambton in 1973 and the spy scandals inside MI5.

link


1970  Responsibility for Springhead Park School –  NAMH

1970  Responsibility for Richmond Hill – Local Committee

link

Abuse at Aston Hall

Barbara O’Hare was a vulnerable 12-year-old when she was sent to Aston Hall hospital in Derbyshire. More than 40 years on she has uncovered a shocking legacy of illicit drug therapy and sexual abuse at the hands of the psychiatrist who was supposed to help her

Aston Hall in Derbyshire is an imposing white mansion, grade II listed, that’s been turned into high-end flats. Until recently, there were other buildings on this site too, less imposing, redbrick. Photographs taken before they were demolished reveal eerie abandoned corridors and derelict washrooms. It’s like the setting for a horror film. There are a few signs visible, such as “Drug Cupboard. Do Not Switch Off” – a clue to Aston Hall’s grim and now deeply questionable past as a psychiatric hospital for vulnerable, lost, so-called “mentally defective” children.

Back in the Fifties, Sixties and Seventies, troubled young children and teenagers, many from children’s homes all over the country and a great deal from the local remand home for girls, the Cedars, would be brought up Aston Hall’s drive, past the mansion, clueless to what was about to happen to them.

The cars that delivered them to the door were so often driven by their social workers. The “mentally defective children” – many of whom were simply badly behaved as a result of their early lives – were now under the care of the hospital’s medical superintendent, Dr Kenneth Milner, a psychiatrist who had worked at Broadmoor and Rampton hospitals, but who in 1947 transferred to Aston Hall, employed by the government. He had no history of treating minors.

Milner’s view was clear. Here, at Aston Hall, it was thought that all the troubles of the children’s pasts – their parents’ neglect, for instance, or their parents’ alcoholism, often their presumed sexual abuse – could be “cured”.

But evidence now being gathered by the Derbyshire Safeguarding Children Board and Derbyshire Constabulary, under the auspices of the nationwide Operation Hydrant, has revealed that if these children entered Aston Hall damaged and lost, they often emerged months later even worse – more confused and more broken down in even more profound ways. And this is because the very man – Kenneth Milner, now long since dead – who was supposed to help them had subjected the children to drug experimentation instead.

Barbara O’Hare, now 58 and a mother of 4 living in Liverpool, was admitted to Aston Hall in January 1971 and left 8 months later.

In a book published this month, The Hospital, the story she tells of what happened during this period is profoundly shocking: abuse, both medical and sexual, at the hands of a man who was supposed to protect her. It makes for grim and depressing reading.

Every night, she recalls, Milner would sweep up the drive in his car. The children, a mixture of girls and boys, would stand at the window waiting and then flee in terror. Each evening, a new name was read out for “treatment”.

With the help of some of the nursing staff, he “treated” the young children and teens by ordering them to be stripped naked bar a thick brown gown, binding their hands and feet, and making them lie on a mattress on the floor of a small room. Their faces were covered with a wire mask and a cloth soaked in ether. He would then lie down beside them. All this took place in a small, locked side room, and countless medical records reveal they would be injected with an exceptionally high dose of an irregular drug called sodium amytal, a so-called “truth serum” dating back to the early Twenties. This drug turned them into a “statue”, as O’Hare recalls, and was intended – on a sympathetic reading – to make them speak openly about the buried traumas of their past. While a recognised form of therapy called narcoanalysis, even by the standards of the Sixties and Seventies it was already outdated – and wholly inappropriate for children.

Today, the rigours of Barbara O’Hare’s hard life are etched on her face: alcoholism, family tragedy, mental breakdown. The pattern of how a broken, unloved childhood can shape adult life is a familiar one.

From the story O’Hare tells of her neglected childhood (a mother who left when her daughter was 11 months old; negligent father, though they’ve since reconciled; brutal foster mother; terrifying care home at 12), she was set on a terrible path from birth. But it is her memories of what happened at Aston Hall that are the most disturbing – and it is these, she says, that brought her down in adult life.

For years, O’Hare could not make sense of her patchy but distinct recollections of what had gone on inside that treatment room. Was she remembering it properly? Was she the only one? Was she crazy? Wrists tied? Metal muzzle on her mouth? When she tried to tell people, one said, “Crazy Barbara. You’ve always been crazy.” And at low points, she believed it.

She left Aston Hall after eight months and was transferred to a children’s home in Liverpool. She ran away to London and, after a spell living on the streets, got a job in a hotel. Her life, she says, has never had any sustaining relationships in it, aside from the love she feels for her four children.

For years, she chugged along, never seeking redress or thinking she had any rights. “When you’ve lived a life like mine, you learn to get on with it. You’ve got no option. What are you going to do? Sit down and cry? You’ve just got to get on. I wish I’d been adopted.”

But in 1995, her time at Aston Hall caught up with her. Triggered in part by the brickwork of her local fire station in Liverpool and in part by a police investigation into abuse at another care home for which she was a witness, she had a paralysing flashback to her time in the hospital. “Milner’s breath was here, right here above my head,” she says. “It was as if I could feel it again. I knew then it had been sexual, too.”

After “treatment”, which often saw an Aston Hall child, boys and girls, disappear for days, she remembered how he or she would finally return whimpering and broken. She remembered, aged 12, bleeding after seeing Milner, despite not having started her periods. But she couldn’t recall much else, except the flash of a camera going off. She remembered being bundled into the back of a van, too.

Now in possession of her full medical notes after a two-decade long attempt to make sense of it all, she recalls, for example, that on March 3, 1971, when Milner’s car screeched to a halt below where the girls watched at the windows, dreading his nightly visits, “The nurse appeared inside the door and called out a name. ‘Barbara O’Hare,’ she said, holding a clipboard.”

O’Hare was taken to a bathroom and made to sit down in a tepid bath, then given the thick gown and bound. When she became distressed, begging not to be bound at the ankles, the nurse smirked and said, “You know and I know your dad doesn’t care. If he did, you wouldn’t be in here. He can come and get you any time he wants, but he doesn’t care because he doesn’t want you … Just like your mother.”

When she finally came round, as she recalls, she was “swollen and wet … Someone had put something inside me to leave me so sore down below … Fluid continued to trickle out along the top of my legs.”

Questions only started to be asked about the events at Aston Hall last year. Today – despite O’Hare dealing with alcoholism, depression, family suicide, cancer and, at one stage, her own suicidal impulses – it is largely as a result of her persistence that Aston Hall has been brought under the remit of Operation Hydrant.

———-

The story of what happened to the children at Aston Hall at the hands of Kenneth Milner finally broke on February 24, 2016, after Isaac Crowson, a crime reporter at the Derby Telegraph, got a tip-off that allegations had been made.

For years, nobody had believed Barbara O’Hare’s memories. It sounded too far-fetched, too sci-fi. And, crucially, she had no evidence.

After that 1995 flashback, two different GPs didn’t believe her because she had no proof. More family tragedy hit (the deaths of two nephews, the collapse of her marriage); a spell of depression then left her suicidal. But the flashbacks to Aston Hall and the nightmares got worse and more frequent. “I remember going to my doctor and her saying, ‘Why are you going on the internet looking for it? As long as you carry on doing that, you are going to have flashbacks.’ ”

But in the run-up to her meeting Isaac Crowson – she was the first victim he spoke to – and that initial story, it was the internet that helped her. On a website called Project Mayhem, she saw pictures of a derelict Aston Hall, which for years she’d mistakenly thought was “Ashton Hall”. There was a comment below the story from a woman recalling her horrific “treatment” there.

“I couldn’t sleep,” O’Hare explains. “I put a comment under hers and thought, ‘Oh God, I hope she finds me.’ The next day she got in touch on Facebook and said she’d already got another lady in a different part of the country. Suddenly, there were three of us after all those years. I set up a Facebook support group for us, mostly so we could communicate. But I also felt that, if there were 3 of us, there could be 303. There was a real sense of, ‘I’ve got to do something.’ ”

O’Hare spoke to Crowson about Milner and his so-called truth serum, about the coma-like state he induced in the terrified children, about the abuse and the nudity and being made to lie down on a mattress.

Isaac Crowson, after “a lot of digging”, decided to run with the story of alleged abuse and drug experimentation. “Very quickly, we knew we had a very big story on our hands,” he remembers.

Within 24 hours of publication, 12 other victims contacted the paper. The following month, Amanda Solloway, the MP for Derby North, raised the alleged abuse in parliament. David Cameron shared her concerns. “It is vital the full facts are considered,” he replied.

By March 7, 35 people had been in touch with the Derby Telegraph. By the beginning of August, it was 50. “We had legal firms contacting us saying they were representing victims,” says Crowson, “and we managed to obtain a letter from the NHS which victims had been sent, saying, ‘We have no reason to doubt the allegations.’ ”

Derbyshire Constabulary is investigating (“We are seeking specialist experts,” runs the official police statement, “who can focus on the medical treatment at the time and cross-reference this with the accounts provided”), while Derbyshire Safeguarding Children Board, the body that co-ordinates all child welfare agencies, is working to ensure all the allegations are fully examined. The majority involve drug experimentation. The victims, however, feel in limbo. “It’s like the abuse all over again,” says Barbara O’Hare.

There are now 31 survivors in her own support group, independent from the Derby Telegraph’s 50. “A lot of them are very vulnerable,” she says. One man has tried to commit suicide.

Barbara’s lawyer, Stephen Edwards, is representing the 31 in her support group (other victims have different legal teams) in a civil case for compensation relating to the drug abuse, and has presented the claims to Jeremy Hunt, the health secretary.

“Some survivors are saying they were [sexually abused],” says Edwards, “some are saying they haven’t been, some are saying it’s more likely than not.

“There is a clear ring of truth,” he goes on, “because time and time again the victims coming forward are saying the same thing [about Milner’s treatment]. These are people from all walks of life who were at Aston Hall at different times, different years and are now scattered all over the country.”

———-

Sodium amytal (first synthesised in 1923) and narcoanalysis had been used as a possible treatment for shellshock in the Second World War and features in a 1946 documentary, Let There Be Light, about American soldiers who are suffering from emotional trauma and depression, directed by John Huston.

It had something of a revival in the US and elsewhere as part of recovered memory therapy – which, in at least one case of the mid-Nineties, involving Holly Ramona and her father, Gary, had devastating consequences. After being sued by his own daughter, at the time in her early twenties, for allegedly raping her between the ages of 5 and 16, Gary Ramona retaliated by suing the therapists who had planted false memories in her using the drug. In May 1994, he was awarded $500,000 damages against the two therapists.

In 1953, while working at Aston Hall, Milner gave a speech entitled Psychotherapy with high-grade mental defectives, in which he said, “One of the most difficult things to elicit was a history of cruelty in childhood. It was of vital importance to elicit such histories, however, for they often gave a clue to what was to come. If a patient gave a history of gross cruelty by alcoholic parents, it was very likely to be coupled with sexual degradation at an early age.”

Even were Milner using sodium amytal in some sort of groundbreaking experimental way, you’d expect to find plenty of research to back it up. But his “treatments” resulted in no publication of medical papers or trials in The Journal of Child Psychology and Psychiatry. Nor is there any trace of such research at the Royal College of Psychiatrists.

In the mid-Nineties Ramona case, the administration of sodium amytal was linked with false memory syndrome. At Aston Hall, it is alleged that, in some cases at least, the false memories of sexual abuse that Milner created in the children allowed him to become their abuser.

Last year, a few months after Barbara O’Hare made her allegations (implanting false memories is not one of them), Radio 4’s File on 4 took up the mantle. One survivor told the programme how Milner implanted memories of sexual abuse, taking her back to when she was 11, the age when she started going off the rails. She recalled him saying, “ ‘Whatever we talk about, you will be reliving it as though it’s happening again … Did your father touch you?’ And I felt as if I were being touched where I shouldn’t be touched, and he’s saying, ‘What’s he doing? What’s he doing?’ He’s touching me. I don’t like it. I don’t like it.”

Finally, after nine or ten sessions, she remembers Milner bringing her in to see him and saying, “We’ve got to the bottom of it. You were a hard nut to crack! I’ll tell you now what happened. Your dad was sexually abusing you.”

In the case of this survivor, the allegation is that while using sodium amytal to plant a false memory of parental sexual abuse in her, Milner himself was able to carry out sexual abuse. This survivor believed what Milner had told her. “I’ve tried so hard to visualise it,” she told the programme. “But I can only remember and visualise it from the treatment, and for 51 years I have been accusing my father of maybe doing something he did not do. And the worst part about it, I’ve got … If it didn’t happen, I’ve got to live the rest of my life knowing that I’ve told people he’s done this and accused him of doing it … I believe it was Dr Milner doing the abuse while I was under treatment.”

Milner died in 1976, so these allegations were never put to him. His family refute them and have pointed to a former patient whose life was helped by such treatment in the Fifties. This female patient continues to describe Milner as “wonderful” and says that he made her life “worth living”.

“Even though this is very shocking and horrendous,” says Barbara O’Hare, “you could even say unbelievable, we know the truth. We have our memories and we can’t all be having the same one. One member of my group dates back to 1957.”

A key voice in the campaign emerged last year when John Bull, the pioneer of community-centred children’s care in the Seventies, came forward to say that as a student nurse at Aston Hall back in the Sixties, he’d received training on the treatment but wasn’t involved in giving it. “I’ve seen the room,” he told File on 4. “From the outside when you were walking past the ward you would hear sometimes kids crying … He was the only person I know that gave the treatment.”

Isaac Crowson at the Derby Telegraph also interviewed an anonymous former staff member who remembered “how the staff regarded Milner as the expert and never once questioned him”.

Breakthroughs such as these have had a massive impact on Barbara O’Hare and her fellow survivors. “I don’t feel I’ve got anything to prove any more, which I always did feel. I remember passing my driving test more than 30 years ago and it breaking my heart. I never felt adequate; I never felt as good as anybody else.

“From the age of 12, I’ve carried a big black balloon of depression, of anger, of confusion, of hurt in my chest. For years, I’ve been trying to make sense of it.

“The decision to write this book was the best thing ever, because it deflated the balloon. It made some sense to me of what had actually gone on. It has given me the energy now that I need to help some weak and troubled survivors in my group, but the amazing thing is less than half of 1 per cent of us has a drug or drink addiction now. There are down days and days when we have mainly flashbacks or nightmares, but we are keeping each other strong.”

Aside from financial compensation, Barbara O’Hare has a clear view of what she wants to come out of any public acknowledgement of the abuse of and experimentation on the children of Aston Hall.

“I want every doctor in this country to have to carry his own portfolio, so that when you take your child to them, you can see what they have done. Dr Milner had had no experience working with children. There should be much more protection of children, and in particular more protection of children in care. I want social workers and foster parents to read this and learn from it. We messed up years ago. Don’t let us make the same mistakes for a new generation.”

http://www.thetimes.co.uk/article/abuse-at-aston-hall-d5gkn80xj?shareToken=869d2260c8e9da9084cb1b7d514b657a




image

LENNOX CASTLE: Disabled children given grotesque drug tests. #Scotland

DISABLED primary school-age children were subjected to “grotesque” drug testing in a Scots mental hospital

Sun Mar 20 2016

Such medical experimentation will form part of the SNP’s child abuse inquiry, with chair Susan O’Brien QC to launch the call for evidence in Glasgow this week.

The group of nine boys and three girls were subjected to testing while in the care of the state at Lennox Castle Hospital, near Lennoxtown, Stirlingshire in the late 1970s and early 1980s.

They were given droperidol, a tranquiliser which was banned as an antipsychotic in Britain and America in 2001 after being linked to heart problems and a number of deaths.

It is still licenced for use in hospitals to prevent nausea in post-operative patients, although the maximum dose for under-18s is 1.25mg.

The youngsters in Lennox Castle were given up to 60mg a day for up to 19 months, with the average dose 20mg a day.

Each patient was also given a cocktail of other drugs

link

Kendall House abuse

An interview with Stacey discovered in 2017 revealed a culture that enabled child abuse in the 1970s and ‘80s. In it, Stacey explained how he never reported staff who had been accused of abuse to the police, because he believed that children could be “incredibly manipulative” and that there was never a “serious case” worth reporting.

But in reality, during the time Stacey was head of Kent social services, staff at Kendall House, Gravesend, a Church of England-run children’s home in Kent, were drugging, straitjacketing, and physically and sexually abusing vulnerable girls.

The ordeals of dozens of young women came to light in 2016 after an independent report found that Kendall House had “normalised” cruelty and abuse. The recording was discovered in British Library archives by former Kendall House resident and well known campaigner, Teresa Cooper.

Cooper herself was drugged over 1200 times in 32 months at the institution, and went on to give birth to three children with birth defects. Cooper’s persistence across three decades led to the Kendall House review, which finally brought the full story of abuse to daylight.[4][5][6]

The Rev Nicolas Stacey obituary

Clergyman who became a social services director – director of social services for Kent from 1974 to 1985

14 May 2017

In 1971, Nick found his second vocation. Without any previous experience, he was appointed director of social services for Ealing

While at Kent, Nick attempted to revert to a former passion by applying for and getting chairmanship of the Sports Council, only to suffer the public humiliation of his appointment being blocked by Denis Howell, the sports minister. Nick left Kent in 1985 to run a project providing housing and sports facilities on the Isle of Dogs, east London, which was then abandoned when its sponsor withdrew. For a year he ran the small and now defunct Aids Policy Unit (he helped to found the National Aids Trust). But generally the post-Kent years were ones of voluntary work: he worked in various capacities for the church and as a voluntary prison chaplain to 200 sex offenders and chaired the East Thames Housing Group (1993-98).

Nick’s showmanship – he gave parties for his staff, one of which was attended by the singer Marianne Faithfull

Nicolas David Stacey, clergyman and social services director, born 27 November 1927; died 8 May 2017

https://www.theguardian.com/society/2017/may/14/the-rev-nicolas-stacey-obituary

Gilo‏ @seaofcomplicity

Important piece of the jigsaw of cultural complicity. Stacey cared alright … but it was for staff and reputation.

Teresa Cooper‏ @Teresacooper

Founder of L&Q my landlord, Church of England & director of Kent social services throughout Kendall House abuse.

@CassandraCognoyou really really need to listen to this. From 23 mins in through to at least 30mins in

And listen to his comment on rape :-/ Director of Kent social services throughout KH abuse.

Teresa Cooper@Teresacooper

another interesting revelation from Rev Stacey and names names.

There was one headmaster, a fellow called John Boyce, who was terribly good with the parents …And this other one, Willie Williamson, who went on to be headmaster after Ashdown, at Ashdown Forest where Princess Margaret sent her son there.

He was a genius with bright, attractive thirteen year old boys, to who I think – and absolutely never did anything that was the least bit improper- but I mean he was really an example of people who are attracted to boys of that age, are the most brilliant teachers and we all got, or practically everybody got scholarships to Eton and the school then, then the Duke of Gloucester-this was after my time-the Duke of Gloucester sent his children there

Cassandra Cogno‏ @CassandraCogno

#KendallHouseGrotesque dangerous assumptions for children in Kent’s care – Rev Nick Stacey – Kent Director of Social Services for 11 years


Teresa Cooper‏ @Teresacooper

Who was responsible for children in Kent social services care & socisl workers? Ive got Kent girls ss recs & abuse doc by KENT socialworkers

Rev Nicolas Stacey states his role in that interview and it is accurate with the KENT KH girls files whilst he was the director.

That letter writer re Kendall House is a Guardian newspaper journalist

https://www.churchtimes.co.uk/articles/2017/11-august/comment/letters-t


Don Brand, Director General Social Care Council (GSCC) Deve Project, funded Joseph Rowntree Foundation at National Institute for Social work


Interview with the Revd Nick Stacey sheds light on era of Kendall House abuse

7 July 2017

AN INTERVIEW with the Anglican priest who ran Kent Social Services at the time of the Kendall House children’s-home scandal shines a light on the culture that allowed children to be mistreated and abused in the 1970s and ‘80s.

The priest, the Revd Nick Stacey, who died earlier this year (News, 12 May), was the director of Kent County Council’s social services from 1974 to 1985.

At that time, staff at Kendall House, Gravesend, a Church of England-run children’s home in Kent, were drugging, straitjacketing, and physically and sexually abusing vulnerable girls. The ordeals of dozens of young women came to light last year after an independent report found that Kendall House had “normalised” cruelty (News, 15 July 2016).

A recorded interview that Mr Stacey gave for an oral-history project in 2006 is now held by the British Library. In it, he explains how his policy was never to report staff who had been accused of abuse to the police, because he believed that children could be “incredibly manipulative” and make such stories up.

In the course of a wide-ranging discussion, he describes his approach to managing social services.

“The other thing that I had was that nobody was to go to the police about accusations against staff without my approval,” he says. “And it is incredible the way times have changed. I could never begin to do that now, but children, especially children in care, are incredibly manipulative.”

Many accusations of abuse from children in care were invented to make trouble for care-home staff, he believed. “[Children] come back [late] at six or seven o’clock, probably either having sex in the churchyard with somebody or stealing at Marks & Spencer’s or both. And [the staff] would say, ‘You’re to go to bed without supper.’

“The kids would go into supper, the child would creep down and telephone Childline, saying, ‘I’m being abused.’”

Mr Stacey tells the interviewer with pride that he “never once” went to the police, because there was never a “serious case” worth reporting.

In reality, while he was responsible for all social services in Kent, girls at Kendall House were “caught in a regime that, in many ways, sought to rob them of their individuality, of hope, and in some cases of their liberty”, the independent report says.

Girls as young as 11 were routinely, and sometimes without any medical assessment, given antidepressants, sedatives, and anti-psychotic medication, and others were put in straitjackets or sent to a local adult mental hospital. There were at least two incidents of rape while girls were put in isolation as a punishment, as well as several pregnancies and cases of self-harming.

Those whose task was to oversee the Kendall House girls’ well-being “demonstrated little curiosity, challenge or questioning”, the report alleges.

Despite noting with pride that there were no “scandals” in Kent under his watch, Mr Stacey admits during the 2006 interview that he did on occasion force some care-home workers to resign and put their names on an “at risk” register.

“I would try and get them to go to counselling,” he said. “I actually fundamentally think that to put these people . . . Terribly sad if you’re sexually orientated towards children, you know, and it is a . . . So that was one thing.”

However, if “rampant abuse” on the scale of some Roman Catholic scandals had emerged, he would have gone to the police, Mr Stacey says.

He also recounts the story of how one care home worker hit a child “very hard” and was reported to the police. Mr Stacey ensured that the man got a high-flying QC to defend him and personally gave evidence in court in his defence.

“I went to court and I said ‘You’ve got no idea how these children wind care staff up. We expect care staff with small pay to look after some of the most . . . — admittedly tragically deprived, it’s not their fault that they wind people up — and they’re aggressive and somebody loses their cool and they do hit somebody once.’ I got [him] off.”

Mr Stacey became well-known as the Rector of Woolwich in the 1960s after writing in the press about the “failure” of strenuous efforts to attract working-class people into his congregation. He later left stipendiary parish ministry, and was deputy director of Oxfam before moving into social work, first in Ealing, and then in Kent.

Among the much copied innovations he made in the county were professional fostering for troubled teenagers, and care in the community for the elderly, instead of putting them in homes.

https://www.churchtimes.co.uk/articles/2017/7-july/news/uk/interview-with-the-revd-nick-stacey-sheds-light-on-era-of-kendall-house-abuse


 

Teresa Cooper‏ @Teresacooper

^ He doesn’t say he got the child off. He got the accused off.

Cassandra Cogno‏ @CassandraCogno

Rev Nick Stacey was in Ealing Social Services for 3 years

Mischief‏ @mischiefx

The Times, June 11, 1971 Controversy over Ealing post for Nicolas Stacey

Cassandra Cogno‏ @CassandraCogno

Nick Stacey on writing the obituary for Michael de la Noy, one-time Albany Trust director

Together with a whistle-blown House of Bishops document published last year, the image is of a church that pretends a ‘robust’ response whilst consciously operating a mirage. Instructions from the CofE’s legal head advised diocesan bishops to use “careful drafting” to “effectively apologise” without enabling victims to get compensation. The Church and insurer have in effect ran an ‘affiliated corporate hand-wash’ with both parts washing hands of responsibility for actions of the other. They maintain the pretence of separation. The Church wants to quietly have its cake and eat it.

Headmasters on EIG board of directors

In addition to senior CofE figures, three headmasters have also been on the board of the insurer. Ecclesiastical’s website states that it insures over 40% of independent schools. These three headmasters, across more than three decades, are listed on Companies House as having been directors (governors) of other prep schools in addition to headship of their own schools. More than half these have had abuse cases and media reports. One example is Caldicott. All three headmasters had governance of this school at different times – a school with a complex abuse history spanning decades and centred around its own headmaster. But many of the other schools too have been subject of abuse allegations:

Abingdon, Ashdown, Ashfold, Cothill Trust, Loretto, Millfield, Mount House, Radley College, Repton, Stoke Brunswick, Summerfields, Wellington College

Does the presence of headmasters, presumably representing the interest of all these schools, on EIG raise similar ethical questions? Have survivors from these schools been informed that heads/governors of their schools were part of the insurer possibly handling claims? Those I’ve asked had no idea and were shocked to discover these potential conflicts of interest. One Caldicott survivor told me that one of these had praised Peter Wright as the “finest prep school headmaster of his generation” at Wright’s retirement speechday. There’s no grounds for suspecting any of the three had prior idea that Wright had been subject of rumours from the late 1960’s onwards and across the decades. But these links between the worlds of private school, church and insurer are bound to raise questions for survivors. Has EIG insured all these schools? I asked a few. They were reluctant to say.

Tim Brinton MP – contemporary of Rev Nick Stacey

Member of Kent County Council since 1974.
Brinton was a Kent County Councillor from 1974 to 1981 and Member of Parliament (MP) for the marginal seat of Gravesend from 1979 (gaining the seat from Labour) to 1983, and, following boundary changes, for the new Gravesham constituency from 1983 until he stood down in 1987. In 2003, he became a member of the United Kingdom Independence Party (UKIP).[4]
Tim Brinton, a former newsreader, was Conservative MP for Gravesham during the Thatcher years between 1975 and 1987.
He joined the BBC as a radio announcer in 1951
During his time as MP he drew on his professional background in the media to help establish a scheme for media training at Conservative central office and also chaired the Conservatives’ backbench media committee.
Brinton’s television career was varied: he presented documentary features, ITV sport, Come Dancing, interviewed the Shah of Iran and became the first nude newscaster having appeared in a programme about Turkish baths.
He flirted briefly in the mid-Nineties with Sir James Goldsmith’s Referendum Party, which sought a referendum on Britain’s role in the European Union, but returned to the Tory fold in 1996.

Thatcher says no evidence on Rothschild

The Prime Minister said last night no evidence existed to suggest Lord Rothschild, former head of the Downing Street “think tank,” had ever been a Soviet agent.

Her brief statement came just 24 hours after she had stunned MPs by refusing to immediately clear the peer of allegations that he was the “fifth man” after his personal appeal.

Mrs Thatcher said: “I have now considered more fully Lord Rothschild ‘s letter in The Daily Telegraph yesterday, in which he referred to innuendoes that he had been a Soviet agent.

“I consider it important to maintain the practice of successive governments of not commenting on security matters. But I am willing to make an exception on the matter raised in Lord Rothschild ‘s letter.

“I am advised that we have no evidence that he was ever a Soviet agent.”

Lord Rothschild, who was a wartime M15 officer, was informed by Downing Street of the Prime Minister’s announcement shortly before it was made at 5pm.

Mr Tim Brinton, Conservative MP for Gravesham, who invited the Prime Minister on Thursday to protect Lord Rothschild ‘s reputation against false innuendoes and smears, said: “It was quite clear from her answer then that she needed time so that various people could consider the matter, rather than make a spot decision off the top of her head.”

1979 Speech to Conservatives in Gravesend

Thatcher:
So all of this people know, all of this we have to get across to them, and I believe, as Reg Prentice has done, that a large number of people who’ve never supported us before will be prepared to do so this time if we make contact with them. And I must say, they’ll have a jolly good Member in Tim Brinton when he’s returned to the House of Commons
MT Engagement Diary 1982
1915   Drinks for MPs [Robert Adley, Jonathan Aitken, Michael Ancram, Robert Atkins, Anthony Beaumont-Dart, Peter Bottomley, Tim Brinton, John Brown,
Kenneth Carlisle, The Hon. Alan Clark, Sir William Clark, Den Dover, Bob Dunn, Tim Eggar, Sir Peter Emery, Harry Greenway, John Hannam, John Heddle,
Sir Anthony Kershaw, Ivan Lawrence, John Lee, John Major, Dr. Brian Mawhinney, Robin Maxwell-Hyslop, Robert McCrindle, Fergus Montgomery,
Michael Neubert, Jim Pawsey, Tim Renton, Peter Rost, The Lord Sandys, Michael Shersby, John Stradling-Thomas, Anthony Steen, Ivor Stanbrook,
Teddy Taylor, Peter Temple-Morris, John Townend, John Ward, Ian Gow: THCR 2-6-2-99 f84]

Dined H/C IG [Ian Gow] and Chairman [Cecil Parkinson]
A service of thanksgiving for the life of Tim Brinton was held on Wednesday, July 15, at St Bride’s Church, Fleet Street.
Among others present were…
Mr Peter Bottomley, MP, Mr Roger Ordish,

 


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.

Church of England CSA VIP Cover ups… Bishop Garth Moore, Bishop Michael Fisher and Bishop Peter Ball etc


 There has been no apology from Justin Welby, the archbishop of Canterbury, to whom Joe reports writing 18 letters after the church began examining his case. He had one reply, from a correspondence secretary, assuring him that “the archbishop would hold him in his prayers”.

Dozens of Church of England officials ignored sex abuse victim ‘for decades’ despite being told of horrific abuse at hands of paedophile clergyman Revd Garth Moore

‘I told so many bishops‘: survivor tells of system that protected priest

15 March 2016

For almost 40 years, Joe has struggled to be heard by the Church of England over the sexual abuse that has blighted his life. The depression, anxiety and occasional suicidal thoughts that have dogged him since he was a teenager were, he says, as much the product of the church’s failure to listen to and act on his anguish as the original assault in 1976.

One of the earliest senior members that he told about the abuse  was Michael Fisher, the highly regarded leader of the Society of St Francis and later the suffragan bishop of St Germans in Cornwall.

Bishop Michael Fisher, who was then in his 60s and died in 2003, was acquainted with Bishop Garth Moore and was a close associate of Peter Ball, the former bishop of Lewes, who was jailed last October for sexual abuse.

According to Joe, then aged 18, Fisher “drew the full story out of me in confession. Immediately afterwards, he led me into an intensely romantic friendship with him”…kissing and caressing …This was not the right response to a young man who was seeking help,” says Joe. 

When Joe was 15, Rev Garth Moore, the chancellor of the dioceses of Southwark, Durham and Gloucester and the vicar of St Mary’s Abchurch in the City of London, was a family friend. According to Moore’s obituary, published in 1990 in the Ecclesiastical Law Journal, he was “the foremost canonist of his generation in the Church of England”.

Rev Garth Moore was a very senior figure in the establishment.

St Mary’s Abchurch in the City of London.

St Mary’s Abchurch in the City of London

http://www.theguardian.com/world/2016/mar/15/i-told-so-many-bishops-survivor-tells-of-system-that-protected-priest

Archbishop Carey accused of failing to refer to police detailed ’92 allegations against Peter Ball.

George Carey, who was archbishop of Canterbury at the time when police were investigating claims of sexual abuse by Ball, wrote in support of Ball to the director of public prosecutions and the chief constable of Gloucester police in February 1993.

http://www.theguardian.com/world/2015/dec/31/archbishop-and-mps-wrote-in-support-of-accused-bishop-foi-request-reveals

screen-shot-2015-10-17-at-18-57-481

Diplomat Robert Alston (right –  brother of  convicted paedophile, Richard Alston – left- partner of PIE’s Peter Righton and friend of PIE’s Charles Napier), was on the staff of Archbishop George Carey

http://www.world-traders.org/profileAlston.phphttp://www.world-traders.org/profileAlston.php

http://www.theguardian.com/world/2015/dec/31/archbishop-and-mps-wrote-in-support-of-accused-bishop-foi-request-reveals

 photo nott and queen_zpsombovitc.jpg

Another bishop who protected Peter Ball:
Peter Nott, Bishop of Norwich

 photo nott_zpsd1ilpaal.jpg

Sophie Rhys-Jones – One of her mum’s oldest friends- the former Bishop of Norwich Peter Nott

Sophie’s father was a master at Sherborne School


The former Heads of the CSA inquiry have something in common – The Church of England

Elizabeth Butler Sloss and Dame Fiona Woolf

Butler-Sloss Church of England hand picked.

She wanted to exclude some of the survivor’s allegations against Bishop Peter Ball, in a bid to protect the Church of England.

He says she told him she “cared very much about the Church”.

 http://www.bbc.com/news/uk-politics-28274882
More on Sloss:
Butler-Sloss was appointed by the government to chair the child sex abuse inquiry but she stood down after it was claimed that there was a conflict of interest because her brother, the late Sir Michael Havers, was Attorney General during the alleged cover-up of a previous pedophile scandal.

Butler-Sloss ‘kept claims of bishop Peter Ball’s abuse quiet

Child rapist jailed despite support of Lady Butler-Sloss
Lady Butler-Sloss criticised for giving evidence for defence in child rape trial

Elizabeth Butler Sloss is related to the  Sainsbury family

“The Hon. Sarah Sainsbury, daughter of John Davan Sainsbury, married to Hon. Robert Butler-Sloss, son of Elizabeth Butler-Sloss, Baroness Butler-Sloss

en.wikipedia.org/wiki/Sainsbury_family

Sainsbury Family were involved, along with bishop Peter Ball, in Derry Mainwaring Knight Satanist trial

The biggest contributor was Mrs. Sainsbury, who wrote checks totaling $116,000. Next came the chief magistrate and former high sheriff of East Sussex, a wealthy farmer named Michael Warren, who is reported to have given nearly $80,000.

Lord Hampden, Anthony David Brand Deputy Lord-Lieutenant for East Sussex contributed a Rolls-Royce with state-of-the-art communications equipment

The local bishop, the Right Reverend Peter Ball, of Lewes, a monk of whom the judge said, “You may think he is a little unwordly,” also agrees. “Father Peter,”… endorsed Mr Baker’s fund-raising with a note

http://www.nytimes.com/1986/05/04/world/devil-did-it-a-british-man-nets-313000.html

Derry Mainwaring Knight’s trial  … shocking testimony that would blow the lid off Satanic doings at the highest levels of English society.

He “outed” two Tory politicians (William Whitelaw, Enoch Powell) and one Labour MP (Leo Abse) as cult members.
He declared he would have no need to bilk money out of churchgoers, because he was a successful pimp.

Fomer Head of the CSA inquiry Dame Fiona Woolf


Fiona Woolf – Also, Church of England
Woolf  is a member of the Parochial Church Council of St Clement Eastcheap
A parochial church council (PCC) is the executive committee of a Church of England parish

https://ianpace.files.wordpress.com/2014/10/mail-261014-woolf-aide-linked-to-magic-circle-gay-sex-ring-claim.jpg?w=465&h=620

Marie Staunton/NCCL/PIE

Harriet Harman’s successor as legal officer, Marie Staunton, openly defended the affiliation in an astonishingly frank statement of September 1983, which reflected the continued hold of the sexual rights agenda.

The NCCL is campaigning to lower the age of consent to 14. An affiliate group like the Paedophile Information Exchange would agree with our policy.’

 photo staunton_zpswb4uplgu.jpg

Like so many others in NCCL/PIE  saga, Ms Staunton — now a CBE — has gone on to have an elevated public career, enjoying spells as the British director of Amnesty International and deputy director of Unicef in the UK, and head of the international charity Plan International. She is now chair of the overseas  charity Raleigh International.

 Dame Fiona Woolf DBE is a trustee of Raleigh International

Another of her Raleigh trustees is Former Unilever Vice President Patty O’Hayer

Leon Brittan had been a non-executive director of Unilever 2004 – 2010

raleighinternational.org/about-us/trustees-and-governance/

 Raleigh International and Save the Children (Patron Princess Anne) work together

a UK-originated youth and sustainable development not-for-profit organisation

Revealed: who is getting the most money at Britain’s biggest aid charities

2012 £90,001 to 100,000 Marie Staunton, chief executive

Marie Staunton, a trained human rights lawyer, was chief executive of Plan UK for a decade until late 2012. She had previously worked for as a deputy director at Unicef, a director at Amnesty International as as acting general secretary at Liberty.

Ms Staunton writes a blog on the Huffington Post and is also the British independent member on the management board of the EU Fundamental Rights Agency, which monitors racism and xenophobia across Europe.

http://www.telegraph.co.uk/news/politics/10223961/Revealed-who-is-getting-the-most-money-at-Britains-biggest-aid-charities.html


Our history

Prince Charles 1978

1978 – Operation Drake

Colonel John Blashford-Snell and HRH Prince Charles launched Operation Drake, running youth projects from ships circumnavigating the globe

http://raleighinternational.org/about-raleigh/our-history

August 2014

The Freemasons’ Grand Charity donate £50,000 to Raleigh International, in support of disadvantaged young people

http://raleighinternational.org/news-centre/press-releases

Raleigh International chosen as beneficiary of Lord Mayor’s Appeal

November 9th 2013

Raleigh International today announced that it is one of four charities which will benefit from funds raised during the 2013-2014 Lord Mayor’s Appeal. Alderman Fiona Woolf, CBE, elected today as Lord Mayor of London, is a Trustee of Raleigh International and has chosen Raleigh as one of the beneficiaries in the official role’s annual charity appeal.

http://raleighinternational.org/images/Raleigh International chosen as beneficiary of Lord Mayors Appeal.pdf


Enoch Powell and Jimmy Savile

Enoch Powell accused of satanic sex abuse

  • Late Tory MP was one of the most prominent politicians of the 20th century
  • He has been named in Church of England review into historic sex abuse

  • Claims relate to allegations of satanic rituals often involving abuse of kids
  • Powell’s name was given to police by Bishop of Durham Paul Butler

Powell is one of several high-profile names passed to Scotland Yard by Bishop of Durham Paul Butler, who is leading the review.

The Bishop has also handed detectives the name of Leo Abse, the flamboyant Welsh MP who died in 2008 aged 91.

Last night the Church of England confirmed that both names had been passed on to detectives from Operation Fernbridge, a Metropolitan Police inquiry into an alleged Westminster VIP paedophile network.

The Right Rev Butler was given the politicians’ names by Dominic Walker, former Bishop of Monmouth, who heard the allegations when he was a vicar counselling in the 1980s.

Mr Walker told senior clerics that Abse was named by three abuse survivors whom he counselled when he was a vicar in Brighton in the 1980s.

He also passed on the names of two former Conservative cabinet ministers, who have not yet been publicly linked to the scandal. Mr Walker was questioned by the Right Rev Butler after the discovery of a book from 1991 in which he described counselling sessions with adult survivors.

‘A number of survivors independently gave the name of a particular MP being involved,’ he said, adding. ‘I don’t believe there was any collusion in their stories.’

A Church of England spokesman said: ‘The name Enoch Powell was passed to Operation Fernbridge on the instruction of Bishop Paul Butler.’

http://www.dailymail.co.uk/news/article-3017207/Enoch-Powell-accused-satanic-sex-abuse-Bishop-Durham-gave-Met-detectives.html


Enoch Powell and Harvey Proctor –

Enoch Powell was an idol of Harvey Proctor

Harvey Proctor’s solicitors were Denby & Co – Sir Richard Denby AND Peter Jonathan Denby.

 

It is through Enoch Powell that another intriguing strand in the life of Harvey Proctor appears. This is his personal friendship with missing lawyer Peter Denby who used to work as an assistant to Enoch Powell.

Peter Jonathan Denby, a former aide to Enoch Powell and friend of Conservative Member of Parliament Harvey Proctor

https://spotlightonabuse.wordpress.com/2014/10/16/harvey-proctor-cottonrose-ltd-and-the-conservative-party/


Later he telephoned Proctor and left a message on his answering machine, saying: “I know I’m wanted but I can’t give myself up yet.” Proctor said he was “worried about him.”

While on the run after holding cops at gunpoint, Denby contacted Swinton Circle Bee Carthew, Powell … and Harvey Proctor!

Interesting that Bee Carthew worked closely with Denby, Proctor, Powell, GK Young and … John Tyndall from the NF.

Crafty muvva

He & Denby had just attempted (unsuccessfully) to sue the BBC. Elm Guest House very much happened & Leon Brittan was named, not by police, media etc, but by residents. The Times were alerted to it many years ago & chose to ignore. Lengthy coverup.

tinyurl.com/pgja7jp

karmic kick

According to Chief Supt Anthony Stevens

The incident was more likely to have stemmed from another crime that had gone wrong.

Dame Alun Roberts ‏@ciabaudo

denby-article

Jonathan Denby, Proctor’s solicitor, got off lightly for his crimes and is now running a hotel in the Lake District.

Fifty Shades of Grey known for its graphic sexual nature replaces bible at hotel and brings backlash for Damson Dene Hotel owner Jonathan Denby

link

Dame Alun Roberts ‏@ciabaudo

Sir Richard Denby, a former president of the Law Society like Fiona Woolf, lived in Leon Brittan’s old Yorkshire constituency?

Plus Savile & Jaconelli in Scarborough & all those Tories at Swinton College

via alun

Jonathan Denby and Barbara Hewson are first cousins.

Barbara Hewson, Leading Barrister, Says Age Of Consent Should Be 13 And Criticises Operation Yewtree

http://www.huffingtonpost.co.uk/2013/05/09/barbara-hewson-says-age-of-consent-should-be-13_n_3242798.html

 karmic kick

(Barbara) Hewson and her crew have been rabid about smearing Dickens and debunking the dossiers since the start of this.

Other interesting family links – Barbara Hewson’s mother, Kathleen Joan Denby, worked at Bletchley Park

link

link


 Barbara Hewson and Butler- Sloss/Havers links:

Barbara Hewson, Butler-Sloss & Helena Kennedy attending.

cte3deew8aaetpb


Barbara Hewson  sits on board (Justice Journal editorial advisory board) with Elizabeth Butler Sloss’ nephew Philip Havers QC:

Philip Havers QC – nephew of Elizabeth Butler-Sloss

justice journal hewson havers 2

justice journal hewson havers 2

Justice.org

Our people – England & Wales

helenakennedywomenyearluncharrivalsngq2o9nefirl

Chair of Council, Baroness Helena Kennedy of the Shaws QC

Council

hrh_hk

camillaparkerbowleseleanorcattonwinswgdynvkk9tjl

View image on Twitter


The Master and Fellows are delighted to announce that Baroness Elizabeth Butler-Sloss has been elected an Honorary Fellow of Corpus.

Baroness Elizabeth Butler-Sloss has many close connections with Corpus.  Her father, Sir Cecil Havers, was an Old Member, as were her brothers, Michael (m 1946) who became Lord Chancellor in 1986, and David Havers (also m 1946).  More recently, her son Robert (m 1981), and her nephew, Philip Havers QC (m 1969) have kept the Corpus link alive.

link


Misc

Mischief‏ @mischiefx

Kiddle, (convicted of indecent assault on a boy) is later appointed deputy priest in ordinary to The Queen

The Rev Mark Kiddle: to be a Deputy Priest in Ordinary to HM The Queen.

11 June 1993

http://www.independent.co.uk/news/people/church-appointments-1491165.html

The Times Feb 9, 1985

Vicar Kiddle admitted indecently assaulted a boy aged 15.

Image result for Rev Simon Phipps

Bishop of Lincoln Simon Phipps tells court indecent assault vicar Mark Brydges Kiddle to be given another parish. He had been “an extremely diligent, imaginative and energetic priest”.


The Rt Rev Simon Phipps

Confidant of Princess Margaret

Bishop of Lincoln Rev Simon Phipps – Bishop of Lincoln from 1974 to 1986
His father, a naval officer, had been appointed to the Royal Victorian Order. Phipps was educated at Eton and, while still a young subaltern, was picked out by the then Queen Elizabeth (now the Queen Mother) as a suitable escort for her younger daughter, Princess Margaret. He went on, in 1968, to be appointed Suffragan Bishop of Horsham, and, in 1974, to become Bishop of Lincoln.

He became a star turn in the Footlights review, and, in 1949, was elected the club’s president. His amateur theatricals appealed to Princess Margaret, herself no mean mimic, and, on one memorable visit to Balmoral, he was roped in to play charades by the then Queen Elizabeth, the future bishop being obliged to march around ahead of King George VI carrying an umbrella in imitation of a crozier.

After training for the ministry at Westcott House, Cambridge, Phipps was ordained in 1950, and served his title as assistant curate at Huddersfield parish church. In 1953, he was invited back to Trinity College as chaplain. This was the year when Princess Margaret fell in love with the divorcé Peter Townsend, and it was to Phipps that, during the next three years, while struggling with her conscience and the constitutional issues, the princess turned for spiritual advice. At one time, they were in almost daily contact. Later, he became godfather to her son, Lord Linley, after her marriage to Anthony Armstrong-Jones.

While still at Trinity College, Phipps also forged, with Mervyn Stockwood, one of his warmest episcopal friendships. He and his wife, Mary, remained loyal and loving friends to the future Bishop of Southwark throughout his lonely years in retirement.

In 1965, Phipps was made an honorary canon of Coventry, and three years later, with Princess Margaret in the congregation at Southwark Cathedral, he was consecrated as Suffragan Bishop of Horsham.
It was in 1973, while still in the Chichester diocese, aged 52 and seemingly a confirmed bachelor, that Phipps surprised and delighted his friends by getting married. His wife, Mary Welch, was a daughter of Sir Charles Palmer, of the biscuit manufacturers, Huntley & Palmer, the widow of a clergyman, and a practising psychiatrist.
He retired to his wife’s enchanting Sussex home, with views to Chanctonbury Ring, being invited, most unusually, to act as an honorary assistant bishop in two dioceses, Southwark and Chichester.
 Simon Wilton Phipps, clergyman, born July 6 1921; died January 29 2001
Member of the Coldstream Guards

Following the war, having read History at Trinity, he studied for the priesthood at Westcott House, Cambridge. A talented writer of lyrics, he was President of Footlights in 1949.

In 1953, after a short spell as a curate in Huddersfield, Phipps was appointed Chaplain at Trinity. That appointment was followed by ten years at Coventry as an Industrial Chaplain, during which time he lived in a small council flat on a new housing estate. The modesty of his surroundings did not prevent him from entertaining his long-time friend, Princess Margaret, “to the great interest of his neighbours”.[1]

https://en.wikipedia.org/wiki/Simon_Phipps_(bishop)

Not long after his ordination, when he was chaplain of Trinity College, Cambridge, his gifts were put at the service of Princess Margaret during the crisis that arose out of her relationship with the divorced Group Captain Peter Townsend. Phipps and the Princess were close friends, having met frequently through his father’s position as a Gentleman Usher to King George VI.

He often accompanied her to hunt balls and other social events, and it was sometimes suggested that they were involved romantically, but this was never the case, and his role was always that of counsellor.

His wife Mary, whom he married in 1973 and who predeceased him, was a psychiatrist and the widow of James Welch, a former Head of Religious Broadcasting at the BBC.

 

Included in the group were: The Lord Bishop of Lincoln (Rt. Rev. Simon Phipps), Mrs. Phipps, the Dean of Lincoln (V. Rev. The Hon. O. W. Twisleton-Wykeham-Fiennes), the leader of the Lincoln City Council (Cclr. Mrs. Bates) and officers of the Central Council.

The Lord Bishop of Lincoln (Guild Patron) said it gave him very great pleasure to be present at the gathering of so many bellringers from different parts of the country and he wished them well in their deliberations at their Conference next day.

 

http://www.methods.org.uk/archive/ccmr1975.htm

The Bishop of Lincoln with the Central Council Secretary (Mr. C. A. Wratten).
Simon Phipps, Cyril Wratten
1973 Twinning ceremony at Nelson, with the French town of Criel. Twinning committee – Chairman Rev Mark Kiddle
1980 Rev Mark Kiddle trades pulpits – residing at St. Mary’s Rectory   – St Mary’s Church in the Highlands, Cold Spring, New York

 photo har3_zpsc479171f.jpg

Harriet Harman & Marie Staunton CBE in Ghana

Rev Fisher was a Bishop to Her Majesty’s Prisons 1985


Church of England warned bishops not to apologise too fully to sex abuse victims  

“The approach to survivors is often a corporate model and this document supports that – it shows a church led by lawyers and insurers, you get the impression that these people are really their masters.

“A diocese is deferential to their bishop and the bishop is deferential to a bunch of lawyers.

“The Church will say ‘our hands are tied’ but they are paying the people who are tying their hands.

Survivors said it showed there was a culture of denial, dishonesty and “blanking” victims in ways which had heightened their pain and ultimately failed to tackle the roots of the abuse crisis.

It follows a damning independent review of the Church’s handling of sadistic abuse by Garth Moore, a priest and top canon lawyer, in the 1970s.

It highlighted how the teenager – known as “Joe” – revealed his ordeal to a string of leading clerics, three of them later ordained as bishops, who then claimed not to remember anything.

http://www.telegraph.co.uk/news/2016/08/21/church-of-england-warned-bishops-not-to-apologise-too-fully-to-s/

https://www.churchtimes.co.uk/media/5199289/garth-moore.jpg

Rev Garth Moore was a Speaker at Butlins Holiday Camp at Skegness


Butler Sloss’ brother Havers/ Sir Peter Hayman etc

Denby investigated for accepting a bribe from the Iranian State shipping Line?

troy

Peter Hayman heavily involved in shipping lines. CEO of Seatrade


The North Yorkshire aspect and Operation Spade

The North Yorkshire Enquirer believes that one of the paedophiles named in the dossier handed to Whitby MP Leon Brittan, when he was Home Secretary, by Mr Dickens in 1983, was Britain’s most successful and longest offending paedophile and rapist Peter Jaconelli, who was exposed by the NYE team.

It is entirely credible that Jaconelli was one of the prominent persons mentioned in the dossier that Mr Dickens passed to the Home Office. It is also possible that the dossier had information on Jimmy Savile, who was equally well-known for offending openly in Whitby, in joint enterprise with Jaconelli.

The West Yorkshire Police investigation into why it failed to arrest Savile was widely castigated as a whitewash.  So was the North Yorkshire Police investigation. NYE investigation here. As with the Home Office and MI5, intelligence files appeared to have conveniently disappeared

nyenquirer.uk/child-abuse-wanlesswhittam-report-published/

Satanists On The Prince’s Land

Daily Express (28th August, 2006)

http://www.westcoast-news.org/story-satanists.htm

link

1 Feb 2017

Archbishop admits Church ‘failed terribly’ over abuse revelations

The Church of England has tonight apologised unreservedly after a Channel 4 News investigation revealed that a prominent Anglican evangelical and former colleague of the Archbishop of Canterbury is alleged to have severely assaulted boys and young men for decades.

The alleged abuse was carried out by prominent QC and part time judge called John Smyth, who was chairman of the Iwerne Trust, a charity closely linked to the church which ran Christian holiday camps for public school students.

The Church admitted that it had “failed terribly”, after this programme learned that the Trust had discovered the alleged abuse in 1982, but failed to report it to the police.

Winchester College, where some of the young men met Smyth, was made aware of the alleged abuse, but also failed to report it to the police at the time. There is no suggestion that any abuse took place at the College or with the knowledge of its staff.

The Archbishop was a colleague of Smyth’s at the Iwerne Trust.

Smyth was never reported to cops.

He was instead allowed to move to South Africa after agreeing never to work with children again.

Neither the church or top Winchester College, were some boys went, told police 

The Archbishop and Smyth, who continued to ‘exchange cards’ even after he moved abroad.

Lambeth Palace said: ‘The Archbishop of Canterbury was a dormitory officer at Iwerne holiday camp in the late 1970s, where boys from public schools learnt to develop life as Christians. The role was to be a mentor to the boys, as was that of his now wife at a similar camp for girls.

link

His son PJ Smyth – of Covenant Life Church

Washingtonian Magazine – allegations that CLC’s members and pastors have been covering up child sexual abuse for decades and are continuing to handle sexual abuse problems internally instead of reporting them to the police.

Son of lawyer in ‘spanking’ documentary heads US ‘megachurch’ embroiled in sex scandal

link

link

Justin Welby worked as a dormitory officer at a camp where Smyth was one of the main leaders in the 70s

The Archbishop said he was first informed of the alleged abuse in late 2013 or early 2014.

He said: ‘I was told the Bishop of Ely – it fell within his diocese – had been informed by a survivor of what had happened and had written to the police so we checked that indeed the police had been contacted immediately as per the Church rules.

‘They had been, we keep an eye on it obviously, we kept in touch and found out what was going on.

‘As you know, John Smyth had moved to Zimbabwe in the early 1980s, I understand, and it was not in the police’s jurisdiction.

‘I have a vague feeling I may have had a Christmas card in the 1990s and when I was living in Paris he passed through a 

 They later exchanged ‘the occasional card’, Lambeth Palace said last night.
Mr Smyth, a moral crusader who made his name as a barrister representing the Christian campaigner Mary Whitehouse in a landmark prosecution against the Gay News newspaper, went on to live in Zimbabwe and South Africa.

The prosecuting counsel was John Jackson Smyth, Mary Whitehouse’s fellow traveller from the Festival of Lights

link

The Nationwide Festival of Light was a short-lived grassroots movement formed by British … The British pop star Cliff Richard was a leading supporter.

John Smyth QC Obscenity case:

“The prosecuting counsel was John Jackson Smyth, Mary Whitehouse’s fellow traveller from the Festival of Lights”

link

Mary Whitehouse (left) sings a duet with Judy Mackenzie at the Festival of Light Rally in London’s Trafalgar Square.  September 25th, 1971.
Whitehouse v Lemon is a 1977 court case involving the blasphemy law in the United Kingdom.

welby-and-symth

Conversion of an archbishop

The man who led Justin Welby to Christian faith

Justin Welby with ‘Bash camps’ founder Eric John Hewitson Nash, popularly known as ‘Bash’

Welby’s role was to be a mentor to the boys, as was that of his now wife at a similar camp for girls.

Much of Welby’s early grounding in Christian doctrine was also gained through the ‘Bash  camp’ network…

welby-and-bash

welby-bash

Welby was involved in the camps as an undergraduate and and again as a theological college student in the early 1990s.

link

Image result for Anthony Montague Browne

Sir Anthony Montague Browne arriving to visit Sir Winston Churchill in hospital with Dianna Churchill and Lady Churchill

Welby’s biological father was Anthony Montague Browne,   Churchill’s private secretary, who later worked for the Queen

Image result for Anthony Montague Browne and queen

In a statement the Archbishop said he had been friends with Smyth during the late Seventies, when he worked at the camps, run by the Iwerne Trust.

The Archbishop said he had kept in “occasional” contact with the barrister since.

He was made aware of the allegations in 2013 when the police were involved.

A statement from the Archbishop said: “The Archbishop of Canterbury was a Dormitory Officer at Iwerne holiday camp in the late 1970s, where boys from public schools learnt to develop life as Christians.

“The role was to be a mentor to the boys, as was that of his now wife at a similar camp for girls.

link

Many Royal visits to Winchester College

http://www.winchestercollege.org/UserFiles/pdfs/Royal%20VisitsFriendsLeaflet.pdf

charles-winchester-college

 Prince Charles was received in June 2000.
Winchester College, where some of the young men met Smyth, was made aware of the alleged abuse, but also failed to report it to the police at the time.
Edward, Prince of Wales (Iater EdwardVIII):
“Just as Westminster is the mother of British Parliaments, so Winchester is the mother of British public schools”.

The Titus Trust was set up in 1997 and took over fundraising from The Iwerne Trust.

In 2000 it took control of the running of the holidays from Scripture Union.

In 2014 that the board of The Titus Trust became aware of these allegations

The Titus Trust

Lymington Rushmore is part of the Titus Trust,  a non-denominational Christian charity. The Trust has been running activity holidays for young people since the 1930s (originally as part of the Scripture Union). It is responsible for four holiday groups –Lymington Rushmore Holidays serving a mixture of day and boarding schools in the South; Iwerne & Forres Holidays, for those at the larger boarding schools and associated prep schools in the South of England; Gloddaeth Holidays working with independent schools in the North of England; and LDN  Holidays for those at independent London day schools.

The Titus Trust continues to enjoy strong links with the Scripture Union and with a number of CPAS Ventures and holidays.

The Titus Trust is a registered charity (charity no. 1066751) and is only able to continue its work due to the generous gifts of its supporters.

https://www.lymingtonrushmore.org/titus-trust

Reverend David Fletcher, a vicar in the Church of England who as head of Iwerne decided not to report the abuse to the police, declined to comment to Channel 4.

 John Smyth QC right next to an advert regarding child sex abuse

Christian crusader in teen abuse scandal

A British lawyer who has been working for the inclusion of Christian values into South Africa’s constitutional jurisprudence has been accused of the “horrific” and “masochistic” beating of teenage boys in his care.

Currently based in Cape Town, John Smyth, a Queen’s Counsel and former acting judge in England, is alleged to have left a decades-long trail of bloodied bodies and broken spirits both in the United Kingdom and in Zimbabwe.

While in Zimbabwe Smyth ran a Christian mission, Zambesi Ministries, for 17 years. He was charged with the culpable homicide of 16-year-old Guide Nyachuru at one of the Zambesi Ministries’ summer camps held in Marondera in December 1992. Nyachuru’s naked body was found in the Ruzawi School pool — questions still hang over the circumstances surrounding his drowning. Smyth has always maintained it was a tragic accident.

Smyth was also charged with five counts of crimen injuria relating to incidents during a camp in April 1993 involving five boys from posh Zimbabwean schools.

The culpable homicide prosecution was discontinued when the then Zimbabwean Chief Justice, Anthony Gubbay, ruled the prosecutor in the case had a conflict of interest. Smyth moved to South Africa soon afterwards in 2001.

The allegations of abuse — ritualised beatings to “repent” for sins such as masturbation — surfaced this week following an investigation by the United Kingdom’s Channel 4 News, An Ungodly Crime?, which screened on Thursday February 2 in Britain.

The alleged pattern of behaviour appears contrary to Smyth’s public image in South Africa as a moral crusader and the executive director of the Justice Alliance of South Africa (Jasa). This week Jasa shut down its website.

Smyth and Jasa have been involved in Constitutional Court cases arguing against same-sex marriage, teenage sex, abortion, pornography and euthanasia. He also submitted draft legislation to the department of home affairs to limit access to pornography.

Senior evangelical Anglicans appear to have known of Smyth’s behaviour, which An Ungodly Crime? suggests they appear to have sought to cover up. In the late Seventies and early Eighties, Smyth was chairperson of the Iwerne Trust, an Anglican organisation with close ties to The Church of England. Iwerne organised Christian holiday camps for boys from Britain’s poshest public schools (called private schools in South Africa).

An internal report written by the Iwerne Trust in 1982, in which it acknowledges the “horrific” scale and severity of the alleged beatings by Smyth involving 22 young men since 1978.

The investigator interviewed 13 of the 22 alleged victims. In one of the first reported incidents a 17-year-old claimed that instead of a shoplifting incident being reported to his parents, Smyth offered him the choice of a beating to repent.

“He chose the beating, which was given with a cane in the summer house,” the report stated.

According to the report the beatings “continued with four 17-year-olds, on the bare bottom with a gym shoe (because it leaves less evidence) but was voluntarily accepted as a deterrent to masturbation. Beatings varied from a dozen to 40 strokes.”

The report acknowledged the beatings were “technically all criminal offences” but the organisation appears not to have reported these cases to the police at the time. The report suggests the practice was part of the “sanctifying of young men, and the blessings of fatherly discipline” but noted that a psychiatrist “describes it as suppressed masochistic sexual activity”.

From 1979 the beatings are alleged to have escalated in frequency, severity and the number of teenagers involved. About half of the victims attended Winchester College, England’s oldest public school, where Smyth appeared to have access to students.

While there was no overt sexual activity, the report said: “There was a very frequent association with sexual sins of a comparatively minor kind (masturbation and impure thoughts) and too many sexual overtones”.

The teenagers said the beatings were followed by “embraces”, with the survivor laying on the bed while it is claimed that Smyth “would kneel and pray, linking arms with him and kissing him on the shoulder and back”.

Smyth was not charged, and, instead, left for Zimbabwe in 1984.

There, he continued to source boys from top-end schools, like Bulawayo’s Christian Brothers College and Prince Edward School in Harare, for camps where the psychological manipulation and abuse allegedly continued.

http://mg.co.za/article/2017-02-02-christian-crusader-in-teen-abuse-scandal

31st August 1995 Prince Edward shares a laugh with students from Prince Edward High School in Harare

harare-murer

link

Doctors For Life

Doctors for Life – Legal Team – Shadrack Mafutsa, Martus de Wet, Adv Kemp SC, Dr Van Eeden and John Smyth QC,

http://www.doctorsforlife.co.za/pg/175/

Executive Board of the Justice Alliance of South Africa

This consists of an attorney, three Pastors of different churches, a financier and John Smyth QC, the Honorary Director.

  • Grant Gunston (Chairman)
  • Stephen van Rhyn (Vice-Chairman)
  • Tendai Musikavanu
  • Linda-Jane Tippoo – see photo, right
  • Nigel Desmond
  • Quinton George
  • John Smyth (Honorary Director)
John Smyth,QC  practised law as a barrister for many years in Britain; aged 37 he was appointed Queen’s Counsel, and he sat as a part-time judge for 5 years. Part of his practise was constitutional matters and parliamentary drafting.
In 1984 he was invited to Australia to assist Parliament with drafting their legislation to restrict video pornography and gratuitous violence.

After running a mission in Zimbabwe for 17 years, John and his wife Anne have made their home in South Africa. In the third season of their lives Anne and John weave together their experience of their earlier years. John combines his legal skills with pastoral work and is supported by Anne in both spheres of work.

John has been involved with moral issues in Parliament, the courts and media for 5 years now. He has a proven track record having addressed the Constitutional Court as amicus curiae in person, and as architect and author of the successful challenge to Parliament by Doctors for Life in respect of the Abortion Amendment Bill 2004. John writes, lectures and frequently appears on radio and TV. John’s website is www.jjs.za.net.

link

John and Anne were married in 1968. They have 4 grown up children and 7 grandchildren.

John was educated in the UK and Canada and gained MA and LLB degrees at the University of Cambridge.

He was called to the Bar in 1965 and practiced as a Barrister (Advocate) for 19 years. In 1978 he was appointed a part-time judge, and in 1979 Queen’s Counsel.

One of Mr Smyth’s daughters, who asked not to be named said

that teenage boys were “often” at their family home for barbecues and pool parties and she never saw any abuse.

The alleged assaults came to light in the early 1980s after one of the victims, a 21-year-old student at Cambridge University, reportedly attempted to kill himself after he was told to submit to another beating.

A report by the charity, the Irwerne Trust, in 1982 called the practice “horrific” but the claims were not reported to police until 2013.

A vicar, Mark Ruston, carried out the report for the charity, which has now been seen by Channel 4 News and the Daily Telegraph.

It reported that after identifying the boys, mostly from public school Winchester College, Mr Smyth took them to his home in Hampshire and carried out lashings with a garden cane in his shed.

http://www.bbc.com/news/uk-38838113

John Smyth was appointed a part time judge in 1978

In 1984 John and Anne moved with their family to Zimbabwe to do mission work. After two years with African Enterprise they founded Zambesi Ministries which they directed for the next 15 years until John reached 60.

Anne and John now make their home in Cape Town. John is available as a consultant in constitutional law and serves Doctors for Life International and the Justice Alliance of South Africa.

link

  • 2007-08-08
Discipline of Children

https://web.archive.org/web/20161119000735/http://justicealliance.co.za/download/archive/sp-2007-08-08%20Discipline%20of%20Children.pdf


Welby said he had only had fleeting contact with Smyth since. “I have a vague feeling I may have had a Christmas card in the 1990s and when I was living in Paris he passed through and I shook hands with him. That was the limit.”

https://www.theguardian.com/world/2017/feb/02/justin-welby-church-england-john-smyth-abuse-claims

Archbishop Welby, was a colleague of Smyth’s at the Iwerne Trust

link

Image result for welby bash

Archbishop Justin Welby with Rabbi Laura Janner-Klausner, the daughter of Greville Janner. JANNER PART OF WORLDWIDE RING

Justin Welby (left) in Baghdad in 2003, with MI6’s Sir John Sawers (right).
 

Justin Welby “has a secret past smuggling in cold war Europe, briefing US state department officials on rebels in the Niger Delta and chatting to the future head of MI6 in Baghdad.”

MI6 spy – Archbishop of Canterbury

link

John Smyth

Holmer United Charities (226243)

None of the news report state his age – odd.

Based on the following he is

I am a retired member of the Bar of England and Wales, and was appointed  Queen\u2019s Counsel in 1979.

https://www.scribd.com/document/7040441/Smythe-Affadavit

John Smyth,QC  practised law as a barrister for many years in Britain; aged 37 he was appointed Queen’s Counsel
So he was born in 1942 approx. and is age 75.

John Smyth’s son:

Covenant Life Church

Why is Pastor P.J. Smyth Comfortable Enabling Child Sexual Abuse At Covenant Life Church?

link

A Current Member of Covenant Life Church Has Been Arrested For Multiple Counts of  Child Sexual Abuse. P.J. Smyth has not commented on this issue despite being the Church’s Senior Pastor-Elect.

New Allegations of Child Sexual Abuse Affecting Children

Is P.J. Smyth a Naive Opportunist or Just Someone Comfortable Indirectly Enabling Child Sexual Abuse

P.J. Smyth, a self-proclaimed (he does not appear to have formal Ministry training) Pastor from South Africa, has declared that critics of Covenant Life Church’s (CLC’s) decision to harbor pedophiles are part of a Satanic attack to stop his Godly Ministry per an undisputed statement about his comments at a recent Church meeting below:

link

PJ was born in the UK in 1971. When he was 13 his family moved to Zimbabwe where his parents took up missionary work for many years. PJ and Ashleigh met at high school in Harare (Zimbabwe’s capital city), married straight after college (1993), and for their first few years of marriage, both taught high school.

In 1997, they started River of Life Church in Harare with a few friends

Q: Where has PJ lived?
A: In the UK until age 13 (1971-1984); in Zimbabwe until age 33 (1984-2004); then in South Africa (2004-2016) until age 45. PJ and family relocated to Maryland in December 2016.

Q: What is his citizenship?
A: PJ is a UK citizen, who enjoyed the status of permanent residence in Zimbabwe, and then in South Africa. Ashleigh is a South African citizen.

Q: Describe PJ’s educational background.
A: PJ attained ‘O’ Levels (aged 16 years) and ‘A’ Levels (aged 18 years), and university degrees from Cape Town University and the University of South Africa in Biblical Studies and Church History.

Q: Describe PJ’s spiritual background.
A: PJ came to faith as a young boy, although he feels he properly owned his faith at age 15. Because he was at boarding schools from ages 8 to 18, PJ’s first genuine experience of local church life came during college. He attended His People Church in Cape Town throughout his university years, and during that time felt God speak to him about one day leading a church.

PJ reflects on three primary shaping spiritual influences. First, his parents. John and Anne Smyth (who live in Cape Town), led PJ to faith and instilled in him a love for God’s Word and for leadership. Second, His People Church in Cape Town. His People taught PJ about the importance of faith, courage and excellence in ministry. Third, Newfrontiers. Terry Virgo, and other Newfrontiers men and women, taught PJ about the importance of the local church, the Holy Spirit and the grace of God.

Q: What are the churches PJ has led in Africa?
A: River of Life Church in Harare, Zimbabwe. GodFirst Church in Johannesburg, South Africa.

link


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.

 

Cambridge-educated deputy head of St. Benedict’s Catholic private school jailed for horrific stash of porn images featuring children as young as two

 photo 8641cc1d-e8ca-4b49-b942-b4e688ff9dc2_zpswfj204at.jpg

 photo patten patron_zpstu8at6wv.jpg

BBC chairman Chris Patten is facing claims he helped cover up key evidence about the Jimmy Savile sex abuse scandal.

http://www.dailymail.co.uk/news/article-2521976/BBC-chairman-Chris-Patten-Patten-accused-cover-BBC-Savile-probe-blunder.html

Lord Patten, previously from the paedophile-infested BBC is Patron of the paedophile-infested school where Allott has worked since 2004

The school has been dogged by scandal after one teacher was convicted of nearly four decades of sexual abuse of children and another priest is still on the run from a child abuse charge.

The school and its linked Benedictine monastery, Ealing Abbey, was condemned four years ago for a ‘lengthy and cumulative failure’ to protect pupils in its care from child abuse.


Who on earth would feel safe their children were safe at that school?

No statement from patron Chris Patten on the abysmal governance at his school.

Patron:

One that supports, protects, or champions someone or something.  

A noble or wealthy person in ancient Rome who granted favor and protection to someone in exchange for certain services.

 photo st bene_zpsjakuhppb.jpg

Allott – Hi flyer, Cambridge-educated, former Tory councillor, member of David Cameron’s “Big Society” initiative is a member of “paedophile ring”


1/6/2016

Update

Patrick Rock, former aide to David Cameron, has been convicted of five counts of making indecent images of children.

link


Wonder if Peter Allott has any connections with Patrick Rock ?… another of David Cameron’s policy people charged by police over child abuse images and who has also worked under Chris Patten


Cameron brought Rock back into Downing Street in 2011, appointing him deputy head of the influential No 10 policy unit.

http://www.theguardian.com/uk-news/2014/mar/04/patrick-rock-tory

Rock was deputy head of David Cameron’s policy unit at the time of his arrest and they have known each other since the late 1990s.

Patrick Rock became an advisor to various Ministers during the 1990s, including Michael Howard and also Chris Patten

Patrick Rock is due back in court this month – big secret as to the exact date – no mention in msm.


At the time of his arrest, Allott was the deputy head teacher at St Benedict’s


He was identified after intelligence was received that an individual had been using video conferencing facilities to share indecent images of children with other paedophiles around the UK.


Judge Peter Hillen said :

…engaged in public service and political service. Someone who has engaged in charity work. Someone who was a high flyer

  ‘It was at the drug parties that you became aware of, and addicted to, indecent images of children. I use the phrase of a PAEDOPHILE RING, that’s precisely what that was.


Allott, a former Tory councillor, who served on the Perivale ward from 2006-2010

Peter Allott, 37, worked at £15,000-a-year school in London but now jailed for 33 months

When detectives from the National Crime Agency’s specialist child abuse team arrested Allott in December last year, they found nearly 700 illegal images and videos of children and extreme pornography.


The deputy head of a scandal-hit Catholic private school was jailed today after admitting getting hooked on child pornography blowing £600 a week on paedophile drug parties.

The Cambridge–educated deputy headteacher became addicted to child sex images and Class A drugs after being introduced to both at ‘chemsex’ parties organised on gay dating app Grindr.

He amassed nearly 400 horrific images of children as young as two, which he kept on his iPhone and on a hard drive in his office at the £15,000-a-year St Benedict’s School.

The private school in Ealing, West London, which counts comedian Julian Clary, Tory peer Chris Patten and actor Andy Serkis amongst its alumni, has been dogged by scandal after one teacher was convicted of nearly four decades of sexual abuse of children and another priest is still on the run from a child abuse charge.

The school and its linked Benedictine monastery, Ealing Abbey, was condemned four years ago for a ‘lengthy and cumulative failure’ to protect pupils in its care from child abuse.

The  scandal led to five monks and three former teachers being linked to child abuse.

 Allott was working at the school at the time of the abuse

Allott, originally from Barnsley, swapped images with a notorious paedophile, who used the internet name ‘Londonpaedo’ through Zoo. The internet sharing facility allows for an online conference call where perverts could chat and exchange images.

He studied history and politics at Hull University and gained a second degree in theology at the University of Durham. 

He became an economic and politics teacher at St Benedict’s when aged 25, and was elected to Ealing Council for the Conservatives in 2006. 

After a stint studying in Cambridge, Allott returned to St Benedict’s and was at the time of his arrest studying for a doctorate. 


Paedophile Peter Allott left for a year in 2011 to work as a research associate for a project on the Prime Minister David Cameron’s “Big Society” initiative and Catholic social teaching at Cambridge University.

Allot’s published work on Cambridge website

<script><script><script><script><script><script><script> <script><script><script><script><script><script><script><script><script>

 photo allot_zpsnv9qshwi.jpg

http://www.polis.cam.ac.uk/about-us/publications-from-polis-1/publications-from-polis-2013


Allott, taught at St Benedict’s  from 2004  and was promoted to deputy head in 2012


Allott, a former Tory councillor, who served on the Perivale ward from 2006-2010…engaged in public service and political service. Someone who has engaged in charity work. Someone who was a high flyer.

Michael Shaw, for the prosecution when asked about the fate of the children in the images, he said: ‘I would be surprised if some of them were still alive.’

Allott admitted possessing 25 ‘grossly offensive’ images on a hard drive and sharing the images with other offenders

http://www.stbenedicts.org.uk/governors

http://www.dailystar.co.uk/news/latest-news/480283/Ealing-private-school-st-benedicts-deputy-charged-child-abuse


St Benedict’s Fr Laurence Soper

Sept 2016

Soper Trial

soper-sept-19-2016-trial


link

Child abuse inquiry set to drop investigation into Ealing Abbey monks

Lawyers will propose next week that no evidence be called about decades of abuse of pupils at Ealing Abbey and its adjoining independent school, St Benedict’sTimes Newspapers Ltd

An investigation into one of the worst scandals to afflict the Catholic Church in Britain is set to be dropped from the public inquiry into child abuse.

Next week lawyers for Alexis Jay, chairwoman of the Independent Inquiry into Child Sexual Abuse (IICSA), will propose that no evidence be called about decades of abuse of pupils at Ealing Abbey and its adjoining independent school, St Benedict’s.

Victims were furious and accused Professor Jay of backtracking on her previous promise not to reduce the scope of the inquiry. They said the move undermined the credibility of the inquiry, which has lost three chairwomen, cost more than £20 million and shown little tangible progress since it was set up by Theresa May in 2014.

More on Ealing Abbey here

 


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.

 

Murdered Bodies on Royal Estates/Prince Philip and Jimmy Savile/Records Sealed for 100 years

160227savileletter

Truthseeker1 ‏@thewakeupcall09

Why are the records of murdered 7 year old Christine Butcher closed till 2047 ?

Unsolved murder of Christine Vivian Butcher (7 years) at Windsor, Berkshire, on 8 July 1951.

This record is closed

Closed For 74 years
Opening date: 01 January 2047

http://discovery.nationalarchives.gov.uk/details/r/C10887911

Was there a member of the royal family or friend of the royal family involved?  Why would those files from a murder in 1951 be closed for so long?

Who is being protected?  What is being covered up?


July 1951

Boxer Sugar Ray Robinson, a 3-to-1 favourite, trained in the shadow of Windsor Castle.

A strange thing happened the day prior to the bout: a young girl named Christine Butcher, aged only seven years, went missing while venturing off to visit Robinson at his camp only 30 metres away, kicking off a feverish police search.

En route to the weigh-in on Windmill Street in London, the streets were so choked with people that Robinson’s Cadillac was literally pushing its way through the crowd. Traffic was stopped in all directions at Piccadilly Circus, with reports stating it was the biggest crowd of people to take to the streets of London since V Day — the day when the Allied powers celebrated victory over the Axis powers six years earlier. Robinson was a half-hour late to the weigh-in because of the traffic.

An A.P. report out of Windsor read: “Christine had a doll that she imagined looked like Sugar Ray. She set off yesterday to show the doll to the champion. No one has reported seeing her since.” It was little more than an afterthought among the more pressing news, like how much heavier than the champion Turpin would scale, but it would later become haunting.

As the two men were toiling inside the ring, an investigation was underway;

The body of young Christine Butcher had been found not far from Windsor and “a white man in a grey suit” was sought for questioning. Her murder kicked off six weeks of similar crimes.

She was murdered on Sunday 8th July 1951 and found on 10th July.

 

 photo ed55cac1-63b9-4746-b905-d8e5b4abfa34_zpsdmtbqnos.jpg

It’s interesting that Christine was on her way to meet Sugar Ray Robinson:

Robinson was a high-ranking mason, and was for a time in a relationship (some sites say married) to Mary Ann Degrimston, co-founder of the (CIA-linked) satanic Process Church, which famously interviewed Savile for the “Sex” issue of their magazine.

Degrimston later worked as an escort in London and may have been involved with the Profumo scandal.

link

Sugar Ray Robinson was a Prince Hall Freemason

http://www.masonrytoday.com/index.php?new_month=5&new_day=3&new_year=2015

http://www.theguardian.com/music/2014/jul/02/secret-jazz-freemason-history-duke-ellington-sun-ra


The body of 7 yr-old Christine Butcher (who had been violated before and after her murder) was found in Stephen’s Field of Windsor Park

Stephen’s Field is in the grounds of the castle.

 The Festival of Britain floats on their way to Stephen’s Field...In September 1951 at the time of the procession everyone in Windsor knew where it was because just two months earlier, on 10th July, the body of 7-year old Christine Butcher was found there. The papers were full of it. The crime was never solved.

 

The Windsor Forest Bowmen (Patron Prince Philip) give their location as St Stephen’s Field, Home Park.

They say that it is at the far end of Romney Lock Road, past the rugby club and cricket club, next to some very large trees.

theroyalwindsorforum.yuku.com/topic/1368/St-Stephens-Field-including-1951-Festival-of-Britain?page=2#.VxQsw3pGQpo

Windsor Forest Bowmen

Windsor Forest Bowmen was formed in 1951 and was granted Royal Patronage with His Royal Highness the Duke of Edinburgh, Prince Philip, accepting the appointment of Club Patron.

We are a target archery club catering for Recurve, Compound and Longbow. We also cater for traditional (hunter type) and barebow styles as some of the club members branch out into field archery. We enter winter and summer postal shoots as well as going to various competitions in the local area and sometimes further afield.

We are fortunate to have sole use of St Stephen’s Field, part of the Windsor Home Park Recreation Ground for our shooting activities; Windsor Castle providing a fitting backdrop.

www.vanzyl.co.uk/wfb/abouttheclub.htm

webcache.googleusercontent.com/search?q=cache:xEBN74km7mkJ:www.boxingmonthly.com/stories/robinson-turpin-i/+&cd=3&hl=en&ct=clnk&gl=us

Jimmy Savile was desperate to take part in the first Tour of Britain, organised as part of the Festival of Britain celebrations and sponsored by the Daily Express . A race of twelve stages covering 1,403 miles over 14 days, it would take riders from London to Brighton, along the south coast and into the West Country, up into Wales, the north-west and the Lake District, before arriving at its most northerly stop in Glasgow. From there, it would head back south to Newcastle, on down the eastern side of England and finish in London. The prize fund totalled a princely £1,000.

 

A place in the four-man team representing Yorkshire could only be secured with a strong performance in one of the major stage races leading up to the Tour. The inaugural Butlins Holiday Camps 7-Day race, which saw competitors racing between camps in the north, was significant not only because it was where Jimmy Savile earned his ride in the Tour of Britain but also as the moment he chose to unleash his brand of jack-the-lad showmanship on an unsuspecting public. ‘Even though I was nobody at the time nationally, I worked by instinct,’ is how he described it to me. ‘In the Butlins Race, he would get to the start dressed in a tuxedo,’ said Ken Russell some 60 years later. ‘And then he would arrange for somebody to come with a tray and mirror and a brushing comb.’ Doug Petty, a young bike builder, gave exactly the same account of Savile’s bizarre antics.

‘Oscar’ was invited to become a race commentator:

‘When the Daily Express stopped sponsoring the Tour of Britain, which would have been about 1954, I remember seeing him on television maybe a year or two afterwards. The BBC was showing Silverstone motor racing and who should be there but Jimmy Savile; it was sponsored by the Daily Express . I often think that’s what made him, really. I think the Daily Express really helped him, they kind of adopted him.’

In Plain Sight: the Life and Lies of Jimmy Savile Dan Davies

The 1951 Festival of Britain celebrations… St Stephen’s Field, where the procession in 1951 ended up

Here is a facsimile of the programme for the local parade celebrating the Festival of Britain in September 1951 following a summer of events around the country. It was a major event by all accounts, with all the local schools, military and clubs taking part.

Royal Windsor Parade – Stephen’s Field 1951

^ Lots of youth organisations involved e.g. Girl Guides Association

and the Windsor Archery Club, Windsor and Eton Amateur Boxing Club, Star and Garter Riding School participating


Savile’s whereabouts in 1951

He competed as Oscar ‘The Duke’ Savile Aug 1951 Tour of of Britain cycle race

1951 – Age 24, Company director, Leeds Olympic,

4th Ayr-Carlisle 1951, known as “The Duke”

2nd Edinburgh-Newcastle 1950,

link

link

1951 Film: A Boy, a Girl and a Bike with Diana Dors  and Honor Blackman

Jimmy Savile also had a part in  A Boy, a Girl and a Bike

A Boy, a Girl and a Bike. Jimmy Savile can be seen on the right of the picture - just next to the man in the flat cap and smoking a pipe.

Jimmy Savile can be seen on the right of the picture – just next to the man in the flat cap and smoking a pipe in

A Boy, a Girl and a Bike.

http://www.yorkshirepost.co.uk/what-s-on/cinema/sir-jimmy-a-bike-blue-skies-hot-dinners-and-the-dream-time-1-3937514

Speaking in 2006, aged 80, Jimmy Savile was remembering his first brush with showbiz. It was spring 1948, and director Ralph Smart was on location in Skipton making the romantic drama A Boy, a Girl and a Bike, starring Diana Dors and Honor Blackman.

Dors by Diana p. 77 in Love Sweet Love she talks of filming at Hebden Bridge

The film is regularly screened at the Hebden Bridge Picture House to a full house.

link


 

1950’s, H,R,H,Princess Margaret (second right) pictured at the Dorchester Hotel, London with her sister Princess Elizabeth, (Queen Elizabeth II) the Duke of Edinburgh and Lord Montagu of Beaulieu, right

Lord Montagu is DEAD once went on trial for CSA against a boy scout

manchester guardian 17/10/1953

 

Shirley Bassey’s husband !

 

Yep her father was an abuser as well

Diana Dors pops up too – have you a link for info re Bassey’s father please?

 

Bob Monkhouse gives account in his autobiog of flat near Marble Arch – the 2 way mirror from Dors’ place there ended up in

 

she said it was broken by then !

 pleasure & business – Savile, Dors & Honor Blackman nexus very strange back to 1948 Hebden Bridge & endures into 1970s

31 

 ok will look out for that, didnt know of that nexus. Hamilton i think it was was v v controlling

31 

Hebden Bridge 1948 Dors, Blackman and Savile – Rank Charm School

31 

 thanks for that , nearly all new to me. I must revisit calderdale. had a few posts part done

 https://twitter.com/alisongway/status/638607814458515456

Savile was a regular visitor to Hebden Bridge.

 


Archbishop of Canterbury criticises BBC’s handling of Jimmy Savile sex abuse scandal’

30 Sept 2017

http://www.telegraph.co.uk/news/2017/09/30/archbishop-canterbury-criticises-bbcs-handling-jimmy-savile/

Enough Abuse‏ @EnoughAbuseUK

what a remarkable comment given the ourtrageous abuse over decades by C of E church men on innocent children.Put your own house in order !

Dame Alun Roberts‏ @ciabaudo

Justin Welby, why beholdest thou the mote that is in thy Beeb’s eye, but considerest not the beam that is in thine own eye?

Truthseeker1‏ @thewakeupcall09

St John the Baptist Newsletter Dec 2011 /Jan 2012 3/3

Savile, St John the Baptist’s In the Wilderness, Cragg Vale & Hebden Bridge

St John the Baptist in the Wilderness

Cragg Vale, St John's In the Wilderness

Cragg Vale, St John’s in the Wilderness

Savile had ties with Calderdale. He often used to visit St John’s Church, Cragg Vale, for which he raised thousands of pounds, and was an honorary church warden. He was a popular figure in the Calder Valley right up until his death. In the 1970s he had a caravan parked outside the Hinchliffe Arms Cragg Vale. [‘Savile acted ‘unacceptably’ with dead bodies in hospital mortuary, report claims, Halifax Courier, 26 June 2014]

 

In 1967 Savile became Honorary Churchwarden of St John in the Wilderness at Cragg Vale, despite the fact he had only come to the church to help fix a job for a vicar as reported in the Halifax Courier:

“I first came down here to help the church find a vicar and soon after was appointed church warden for my efforts.”

Who had asked Savile down to find a vicar in the first place? And who appointed him Honorary Churchwarden?

In 1960 Rev. David Bennett was ordained and the following year he joined the Victory Lodge in Halifax as a freemason, going on to become one of the most decorated Freemasons in the county of Nottingham in his later career

Having been appointed as ‘Priest in Charge’ of St John the Baptist in the Wilderness in 1967 Rev. Bennett was to eventually have a 25 year long working relationship with Jimmy Savile in youth support and development.

 

Sir Jimmy began fund-raising there in 1967 when his friend, the Rev David Bennett, enlisted his help to raise £8,000 for a new vicarage. The veteran presenter returned regularly to lead 10-mile sponsored walks in aid of the church and other good causes in Calderdale until the late 1970s” (St John’s mourns for honorary church warden Sir Jimmy Savile Halifax Courier – 01 November 2011)

https://bitsofbooksblog.wordpress.com/2014/08/08/savile-and-st-johns-in-the-wilderness/

http://www.hebdenbridgetimes.co.uk/news/crime/savile-acted-unacceptably-with-dead-bodies-in-hospital-mortuary-report-claims-1-6695764


Sir Jimmy Savile during a visit to St John's church, Cragg Vale

Sir Jimmy Savile used to stay in a caravan at nearby Cragg Vale but was never interviewed by police.

Calls for investigation into murder of girl, 13, who was dumped in a canal in 1994 just miles from where shamed Jimmy Savile used to take holidays

  • Lindsay Jo Rimer was murdered in Hebden Bridge, West Yorkshire
  • But the case remains unsolved after 19 years
  • It has emerged that Savile would often holiday just miles from her home

Police have said they do not know Savile’s movements in November 1994

He made no public appearances that month and was not making programmes for the BBC.

Lindsay’s family lived at Lower Rough Head Farm, near Savile’s holiday spot before moving into Cambridge Street, Hebden Bridge, before her disappearance.

http://www.hebdenbridgetimes.co.uk/news/local/vicar-backs-police-investigation-into-possible-jimmy-savile-links-to-hebden-bridge-and-schoolgirl-murder-of-lindsay-rimer-1-6167522

http://www.dailymail.co.uk/news/article-2468322/Calls-investigation-murder-girl-13-dumped-canal-1994-just-miles-shamed-Jimmy-Savile-used-holidays.html

 

Savile was never interviewed by police, despite being a regular visitor to the area, and despite having ‘a police record’.

http://www.dailymail.

http://aangirfan.blogspot.com/2013/10/did-savile-murder-13-year-old-girl.html

Officers had been deployed during Hebden Bridge’s traditional bonfire night celebration, on the basis that Lindsey might have met her killer at last years event, held two days before she vanished.

The Guardian London, Greater London, England Monday, November 6, 1995 – 4



Truthseeker1‏ @thewakeupcall09
Honorary church warden Jimmy Savile

Savile and the high ranking Freemason W Bro David Bennett

St John’s mourns for honorary church warden Sir Jimmy Savile

The Rev James Allison said he had attended a service there as recently as six months ago and would talk proudly of his honourary role.

“He never announced he was coming, I would just look up and there he’d be in all his glory, usually wearing a shellsuit and everything,” he said.

He was lovely – a really nice man. We are very sad to have lost him. He was a good friend of the church.”

Sir Jimmy began fund-raising there in 1967 when his friend, the Rev David Bennett, enlisted his help to raise £8,000 for a new vicarage. The veteran presenter returned regularly to lead 10-mile sponsored walks in aid of the church and other good causes in Calderdale until the late 1970s.

His lengthy TV career had its roots in Calderdale, with one of his first stints on screen in the 1947 film A Boy, A Girl And A Bike, about a fictional cycling club based in Hebden Bridge.

The late Sir Jimmy Savile was an honourary warden at St John’s church, Cragg Vale, which he raised thousands of pounds for over the years. He is pictured outside the church on September 28, 1991.

Read more at: http://www.halifaxcourier.co.uk/news/st-john-s-mourns-for-honorary-church-warden-sir-jimmy-savile-1-3925067

Sir Jimmy, then a racing cyclist with Leeds Olympic Club, appeared as an extra alongside members of Halifax Road Racing Club.

Derek Browne, honorary president of the Halifax club, said: “This was possibly his first taste of being involved in show business.”

http://www.halifaxcourier.co.uk/news/st-john-s-mourns-for-honorary-church-warden-sir-jimmy-savile-1-3925067

pgs 14-15

Freemason Rev David Edward Bennett

Rev David Bennett procurer of children for Savile ?

The MP for that area is Ken Clarke.
1970  Jimmy Savile co-founds The Kingfisher Project in N.Notts (Retford)

Transport.

A coach travels from Retford gathering organisers and children from agreed points. The coach stays with the party for the week in the Gower. Most of the volunteers travel the day before the children by mini bus and a Transit van full of equipment. The “advanced” party prepare the premises prior to the arrival of the children.

Staffing

A multi-disciplinary team of teachers, social workers, youth workers and students. No member of the team is paid for his/her services.

Cost to children and their families

Talk by
W. Brother Reverend David E. Bennett, Provincial Grand Chaplain
entitled:
The Kinghts of Columbus & the Knights of St. Columba. The Influence of Freemasonry.

Meeting followed by an informal finger-buffet lunch.

Any brother wishing to attend should contact the Lodge Secretary no later than 7 days prior to the meeting.

W. Brother David was born in London, and in due course received an MA from Cambridge. He completed his National Service as a sergeant in the RASC-Parachute Regiment. He attended the Wells Theological College, and was ordained in Wakefield Cathedral .

His first Ecclesiastical appointment was as curate of Halifax Parish Church

David spent much of his early working life involved in education in the West Riding of Yorkshire, moving to North Derbyshire, to County Durham, and Northumberland.

He became an Educational Inspector for Nottingham County Council, and appointed Chaplain to the Lord Mayor of Nottingham in 1988.

David was initiated into the Craft in 1961 into Victory Lodge and in due time became an active Provincial Officer has also been WM of Notts. Installed Masters and gained Provincial and Grand Ranks in Mark, Red Cross, Knights Templar, Allied Degrees. 30o Rose Croix, and past Z in Royal Arch

Last year was the 50th anniversary of David’s Ordination, and this year marks his 50th year in Freemasonry

As can be seen David has had a very active and distinguished career in Freemasonry and his dissertation on the Knights of Columba and Columbus should prove to be very interesting and enlightening.

 

CABINET minister Ken Clarke was dramatically dragged into the Jimmy Savile scandal yesterday.

It emerged that BBC pervert Savile was “given the keys” to Broadmoor secure hospital around 1988 — when Mr Clarke was Health Secretary.

Mr Clarke was last night forced to defend himself, saying: “I have no
recollection of ever having met Jimmy Savile and no recollection of these events.

“The Department of Health are now investigating to establish the facts.”

Rev David bennett of Nottingham Gunthorpe high street met Savile after his mining accident in LEEDS where they apparently bonded. before he/they went on the prowl

Bennett & pierce procured little children for their little DEVIL Savile!!! in 1970s fund raising runs at Holme pierpont

THE SNUFF MERCHANT Blunt, with, Wilson, Heath, The Famous 5, Christine Keeler, & Co. & all The Other Perverts. Savile has Opened The Gates. Of Buck House, in More Ways Than One, & Blunt’s Legacy is the Blazing Trail, Leading Right To The Heart of The BRITISH ESTABLISHMENT.
It is No Good Them Burying Their Heads in The Sand This Time, as Too Many People are Equipped With Spades, to Dig Them Out, & Expose Them & Their Evil Practices.
My interest in this at the Time was Blunt,who was The Third Man in The Spy Ring, & why he was never prosecuted. This lead me on to him having recruited Savile, as a Procurer, & User. This gives a Tie in to Buck House
http://st-edmunds.org.uk/sir-jimmy-savile-obe-1926-2011/
maybe a small jigsaw piece but TRUE. This was an Anon. Comment sent to tapThere is also his buddy “Rev David Bennett” of Main street Gunthorp Nottinghamshire (partner in deviant crime) friendship with Jimmy, from 1968 currently underground.
partnered Savile in running a highly publicised Nottinghamshire charity run with children.
Bennett procured under age children as jimmy’s (50+years) personal chaperones where they were abused.
ex priest in charge of St. Edmund’s Church, Holme Pierrepont, a parish church in the Church of England .
Holme pierrepont parish church 70s, 80s to 90s
Was is a Mason & School inspector!! so well placed to fantasize or even abuse?
Such an unsavoury person even his 2 children have diss-owned him & so deluded with his version of Christianity have turned their backs & become christadelphians? or other, even moved travelled away.
His retirement created a full twin page local hero spread in the Nottingham post a few years ago, pals in high places!!!
I know he personally groomed a small girl he had his eye on in the church of a local family over a few years where he eventually made out she had fallen for him. he propergated a rumour they were a item and even his family thought he was going to leave his wife for her. “A total dreamer” leaving the girl with no where to turn to for help. as he held so much weight in the community and what was she but a small girl, horrified in the mess she found her self in. he was waiting for her to come of age to pounce the ponce.
his buddy in crime was Cannon pierce of the R-O-T Saint Marys church main street Radcliffe-o-trent whilst married carried affairs with impunity.
http://www.openstreetmap.org/index.html?mlat=52.946389&mlon=-1.041667&zoom=15&layers=B000FTF
I personally remember a salivating pervy pedo jimmy savile visiting the Rushcliffe School W/B Notts. in approx 1974 where he had the command of a massive hall rammed with little children to talk too? he must have been so drunk on his good fortune that day.

Diana Dors’ wild parties

Glimpsing orgies at 11 and offered drugs aged five, Diana Dors’ son reveals how wild parties were the norm in his childhood home

http://www.dailymail.co.uk/femail/article-2296497/Diana-Dors-son-Jason-Dors-Lake-reveals-wild-parties-norm-childhood-home.html

Diana Dors and Stephen Ward

https://forum.davidicke.com/showpost.php?p=1061804030&postcount=76958

What did Max Clifford witness at Diana Dors’ libidinous parties?

Max Clifford told Southwark Crown Court that he attended the sex parties in his ‘younger days’.

http://www.dailymail.co.uk/news/article-2592006/So-did-Max-Clifford-witness-Diana-Dors-libidinous-parties.html


Diana Dors held wild parties and drugs were offered to her 5 year old son at one. Bob Monkhouse was a regular attender … drug and sex orgies …in the 60s and beyond.

http://www.dailymail.co.uk/femail/ar…hood-home.html

https://forum.davidicke.com/showpost.php?p=1061804030&postcount=76958


Actress Honor Blackman lends support to the Liberal Party as she joins Johnnie Savile, brother of broadcaster Jimmy and candidate for Battersea North, London, on a canvassing tour of the constituency.

Honor Backman and Johnnie Savile

23rd February 1974: Actress Honor Blackman lends support to the Liberal Party as she joins Johnnie Savile, brother of broadcaster Jimmy and candidate for Battersea North, London, on a canvassing tour of the constituency.

http://liberalengland.blogspot.com/2012/11/jimmy-saviles-brother-was-liberal.html

link

On one occasion Savile sent Johnnie away with Eager on a foreign trip with underprivileged children from a home in Manchester. Eager said Johnnie Savile turned up at the airport wearing a T-shirt with ‘I’m Jimmy Savile’s brother’ emblazoned on the front. They went to Mamaia in Romania. Although Eager claimed not to remember when the trip took place or the name of the Manchester children’s home, he did recall that the home was subsequently embroiled in a scandal.

In 2014, the Department of Education announced it was launching an inquiry into Jimmy Savile’s activities at schools and children’s homes.

Among the institutions listed was Broome House in Manchester. Ronald Hall, a former warden of Broome House, was Assistant Director of Manchester Social Services when he was arrested by Manchester detectives in 2001. He was jailed for 11 years for 21 counts of sexual and physical abuse. His deputy at Broome House, Ian Gray, was given a 14-year sentence for serious sexual offences. Soon after Education Secretary Michael Gove commissioned the inquiry, a former resident at Broome House told the Manchester Evening News 4 how Ronald Hall had driven him from the home and delivered him to Jimmy Savile at Piccadilly Station. He said Savile plied him with alcohol and he woke up on the floor of his flat in Salford. He also stated that Savile visited Broome House on a number of further occasions.

In Plain Sight: the Life and Lies of Jimmy Savile Dan Davies


Diana Dors and Prince Philip also involved in Profumo affair

Prince Philip and a delicate question: Why HAS ‘sensational’ Profumo file been buried for another 30 years?

More than 50 years after the scandal, there is clamour to release a file

http://www.dailymail.co.uk/news/article-2550297/Uncovered-The-secret-two-way-mirror-gave-bedside-view-Profumo-affair-flat.html

Prince Philip with Jimmy Savile wearing a Tea-rific shirt

During 1974 and 1975 Savile was holding annual fundraising events ‘Tea-rific’ for NAYC and while writing his autobiography (published in 1974) referred to himself as Vice-President to Angus Ogilvy’s President.


He always told me that when it came to the royal family he had taken the oath of omertà , which was apt given that he was prone to referring to himself as ‘the Godfather’. However, on this particular evening he’d already touched on his friendship with the Duke of Edinburgh and was just beginning to tell me a story about Earl Louis Mountbatten

In Plain Sight: the Life and Lies of Jimmy Savile Dan Davies

Truthseeker1‏ @thewakeupcall09:

Lord Louis Mountbatten former chauffeur Norman Nield exposed him

Meanwhile, in New Zealand, there have been such newspaper headlines as, “‘Uncle Dickie’ the Sex Pervert” (N.Z. Truth, Sept.  8, 1987), since Mountbatten’s former chauffeur, Norman Nield, started revealing details of the late Lord Mountbatten’s alleged sexual exploitation of boys.

Paedophile Lord Louis Mountbatten


Image result for mountbatten on boat

Edward Prince of Wales and his cousin Lord Louis Mountbatten “relax” in a canvas swimming pool on board H. M. S. Renown during their 1920 Empire Tour.

Lord Louis was a great grandson of Queen Victoria and the uncle of Prince Philip (consort of Queen Elizabeth II). Mountbatten was also a promiscuous bisexual who was famously rumored to have had an affair with Edward VIII (who was Prince of Wales at the time) when he accompanied him on his Empire tours (see photo above).

link

Related image

Image result for mountbatten and queen elizabeth

The Queen. Like any human being, she is subject to the influence of those around her. While he lived, Lord Mountbatten was a persuasive counsellor, and he formulated the plan for Prince Charles’s unusually rigorous education.

http://www.nytimes.com/1981/07/26/magazine/an-informal-look-at-the-royal-family.html?pagewanted=all

Princess Diana, in intimate confessions recorded on video by her voice coach,   described her sex life with Prince Charles as “odd, very odd”. 

http://www.independent.co.uk/news/uk/home-news/princess-diana-parents-earl-spencer-never-loved-her-sex-tapes-channel-4-remarriage-countess-footage-a7870856.html


British Boys Boxing World

Prince Philip Patron of FEDERATION OF LONDON BOYS’ CLUB BOXING

 

<script><script><script><script><script><script><script>

<script><script><script><script><script><script><script>

 photo boxing philip_zpsyix6wt0c.jpg

The Duke of Edinburgh, who has become patron of the Federation of London Boys Clubs, watched their boxing finals at the Royal Albert Hall.

Julian Gibbs Vice-Chairman of the London Federation of Boys Clubs in 1971

On 22 October 1974

Gibbs had hosted a fundraising and networking evening for  PIE-linked Albany Trust, attended by Rev. Michael Butler, David Barnard and Antony Grey.

https://bitsofbooksblog.wordpress.com/tag/sir-harold-haywood/

Julian Gibbs

1951-53 2nd Battn. Green Jackets, 2nd Lieutenant. 1953-55 Queen’s Westminster Rifles (T.A) Lieutenant.

(^2nd Battn. Green Jacketssame battalion as Lord Edwin Bramall)

(Julian Gibbs on the Livery of the Grocers’ Company 1961. Vice-Chairman London Federation of Boys Clubs 1971. Chairman of the PM Club since 1970. Governor of the Royal Victoria Hall (Old Vic) since 1974. Vice-President of the Insurance Institute of London 1972.

Clubs: Carlton, Beefsteak, Pratt’s.

Julian Gibbs’ mother:

Helen Margaret Leslie CBE

Various posts with the Girl Guide Association, including County Commissioner, Herts. (1938-46)

She gave special support to the National Society for the Prevention of Cruelty to Children NSPCC

link

link

http://www.aparchive.com/metadata/youtube/ac6724248bbe4f39912937eacfbbdc93

1973 Variety Club Run – all sorts involved…boxers, Savile etc…guest of honour Prince Philip

 photo philip savile_zpspgtuisdl.jpg

https://books.google.com/books?id=EuQ_CgAAQBAJ&pg=PT207&lpg=PT207&dq=jimmy+savile+broadmoor+patients+windsor&source=bl&ots=F6hsvqjdjy&sig=uj2Q5LwlxQgh67YM4Nd7qmnqw_A&hl=en&sa=X&ved=0ahUKEwjq-KK11JjMAhXDeT4KHZ5VCGMQ6AEIXjAJ#v=onepage&q=jimmy%20savile%20broadmoor%20patients%20windsor&f=false



“Savile did whatever he wanted at Broadmoor and nobody could stop him.”

As accusations against the shamed star last night continued to mount, the Daily Mirror can also reveal

 Savile arranged for 60 patients, including convicted murderers, to be granted early release.

 

The Guardian 2 Jan 1989

savile-broadmoor-currie-patients

Savile helps 60 Broadmoor patients to move out.

A new management team was established at Broadmoor last year by the then junior health minister, Mrs Edwina Currie (who knew that Sir Morrison as a “noted pederast).

But for the patients who remained, Savile used his trusted status at the hospital in Crowthorne, Berks, to organise day trips for patients to the Queen’s back garden at Windsor Great Park and aboard a luxury boat on the Thames.

 

 PRINCE IN SAVILE COVER-UP Daily Star Sunday 12-05-13, p6

PRINCE IN SAVILE COVER-UP Daily Star Sunday 12-05-13, p7

He also invited bands into the hospital grounds, then home to patients including Yorkshire Ripper Peter Sutcliffe and gangland boss Ronnie Kray, to stage exclusive concerts.

A former employee at Broadmoor, who knew Savile but asked not to be named, said: “He had access to all areas.

http://www.mirror.co.uk/news/uk-news/jimmy-savile-child-abuse-sexual-1380981

‘Child perverts soon become child killers’: Jimmy Savile was questioned by police over Yorkshire Ripper murders

Savile was questioned by detectives comes after it was reported that the body of Sutcliffe’s third victim Irene Richardson was discovered just yards from Savile’s flat.

http://www.independent.co.uk/news/uk/crime/child-perverts-soon-become-child-killers-jimmy-savile-was-questioned-by-police-over-yorkshire-ripper-8290236.html


Broadmoor

HC Deb 11 July 1985 vol 82 cc533-4W 533W  §

Mr. Peter Bruinvels asked the Secretary of State for Social Services

(1) if he will take steps to prevent patients at Broadmoor from being allowed out on visits; (2) why patients from Broadmoor were recently allowed to visit Windsor; and if he will make a statement.

clarke20award_zps6kvd6nbk

§ Mr. Kenneth Clarke

Visits outside Broadmoor hospital and the other special hospitals are an important element in patient rehabilitation programmes. The visit to Windsor to which my hon. Friend refers took place in July 1984 without any complaint from anyone at the time. Decisions on patient outings or other visits are matters for the clinical judgment of responsible medical officers. In the case of restricted patients, absences from the hospital require the approval of my right hon. and learned Friend, the Home Secretary. (Leon Brittan – 1985)

Patients taking part in group outings are escorted continuously by nurses from the hospitals. I am quite satisfied that there is no unacceptable degree of risk to the public from such visits.

2-21439039

The Royal Windsor Horse Show and the Windsor Rose Show take place within the Windsor Park.

link

link

Broadmoor paedophile ring (In 1986 & 1997)

Savile had been working as a volunteer at Broadmoor since the 1970s and would have been working there at the time of the 1986 allegations

Savile – Broadmoor & Necrophilia

https://spotlightonabuse.wordpress.com/2013/12/06/there-was-evidence-of-a-broadmoor-paedophile-ring-in-1986/


Sugar Ray Robinson and the Process Church

Let’s play 6 degrees of separation with Annie Besant, Charles Leadbetter, Charles Manson, Mary Ann MacLean, Mary Tyler Moore and Sugar Ray Robinson… the connections are diabetes, animal rights, cults and people who travel with an entourage.

“Sugar Ray Robinson was the pioneer of boxing’s bigger-than-life entourages, including a secretary, barber, masseur, voice coach, a coterie of trainers, beautiful women, a dwarf mascot and lifelong manager George Gainford. When Robinson returned to Paris in 1962—where he was a national hero—to get him to cross the seas the French had to promise to bring over his masseur, his hairdresser, a guy who whistled while he trained, and his trademark pink Cadillac.

The Process Church of the Final Judgement was founded by Mary Ann MacLean and Robert DeGrimston Moore. Several sources report her as having once been married to Sugar Ray Robinson

link

https://goodnessandharmony.files.wordpress.com/2016/08/8de73-jsinterview.jpg?w=436&h=606

The satanic Process Church, which famously interviewed Savile for the “Sex” issue of their magazine

A Strange Hub: What Were UFOs, The Process Church, Roman Polanski, David Litvinoff, the Krays, Eric Clapton, Jimmy Savile, & Whitley Strieber Up To in 1968 London?

Savile was interviewed for a 1969 issue of The Process magazine, the “Sex” issue. The piece was called “The Natural Life of Jimmy Savile.”) This places Savile in the same circle as the Krays, the Cammells, the Claptons, and The Process

link

Roman Polanski ‘should not receive special treatment in child sex case’, judge hears

Roman Polanski 'should not receive special treatment in child sex case', judge hears
Prosecutors have called for the Oscar-winning director to return to the US to be sentenced.
20 March, 2017

Oscar-winning director Roman Polanski should return to the US to be sentenced for child sexual abuse and not receive special treatment as a “wealthy celebrity”, prosecutors have said.

A judge in Los Angeles is considering whether the long-running case involving the French-Polish film-maker – who has spent nearly 40 years on the run – should be drawn to a close.

Polanski, now 83, pleaded guilty to having unlawful sex with a 13-year-old girl at actor Jack Nicholson’s house but fled the US on the eve of sentencing in 1978.

Lawyers for the director say he is willing to return to America from France if he is assured he will not serve more jail time.

But prosecutor Michele Hanisee told a court hearing on Monday that Polanski was asking for “special treatment” and for the court to “completely abandon legal principles”.

“The People simply do not believe it is in the best interests of justice to give a wealthy celebrity – and that’s what Mr Polanski is – different treatment than any other fugitive from justice,” she said.

“If Mr Polanski returns, the People are confident he will get a fair hearing here in this court.”

Polanski’s lawyer Harland Braun said his client’s crime was “indefensible” but he fled at the time because he was “lied to” by the court about the sentence he would receive.

Roman Polanski
Polanski with the Palme d’Or for his film The Pianist

“This is a very unique case,” Mr Braun said.

“He is an 83-year-old man with a 40-year-old case that he wants to wrap up.”

Mr Braun told the court that the sentence at the time of Polanski’s offence was a maximum of two years in prison with 50% credit – meaning he would have spent 12 months in custody “at most”.

Polanski had already served 10-and-a-half months in custody in the US and Switzerland, he added.

Polanski fled the US after spending 42 days in an American jail when he feared a now-deceased judge would extend his sentence.

“He knows what he was promised,” Mr Braun said.

“We know he has served eight times what he was promised.”

The lawyer told the court the victim in the case said she wants “this thing over with”. He also called for a warrant issued for Polanski’s arrest to be dropped.

After hearing arguments from both lawyers, Judge Scott Gordon said he would issue a written ruling at a later date.

http://www.irishnews.com/magazine/entertainment/2017/03/20/news/roman-polanski-should-not-receive-special-treatment-in-child-sex-case-judge-hears-970931/?param=ds441rif44T


Savile told hospital staff he performed sex acts on corpses in Leeds mortuary

Former TV presenter said he posed with bodies in lewd positions and stole glass eyes, Broadmoor nurse tells investigators

Jimmy Savile told hospital staff he interfered with patients’ corpses, taking grotesque photographs and stealing glass eyes for jewellery, over two decades at the mortuary of Leeds general infirmary.

The late Top of the Pops presenter had free access to the mortuary from the late 1970s to the mid-1990s, an official investigation has found, concluding that Savile’s interest in the deceased was “not within accepted boundaries“.

Savile was said to have been best friends with the chief mortician of Leeds general infirmary, who is now dead, and had regular unsupervised access to the mortuary from the late 70s until the mid-90s.

Massive Cover-ups – Prince Philip

There are at least 27 D-Notices in place to prevent details of Philip’s sordid predilections getting into the public domain. The notices last for a staggering 100 years.

According to the Mirror:

SECRET files about Prince Philip’s private life are to remain locked behind closed doors for 100 years.

Most confidential Cabinet documents relating to relating to the royals and government are covered by the “30-year rule”.

But at least 27 royal files in the vaults of the Public Records Office at Kew, West London and many of , are considered so delicate they are labelled: “Closed for 100 years“.

More than 10 concern astonishing MI5 and Scotland Yard reports on the Duke Of Edinburgh’s private life.

As an explosive new biography of the Queen hints that the Greek-born Prince was unfaithful to the Queen, we can reveal that Buckingham Palace courtiers and security chiefs were once so concerned about Philip’s non- royal activities that they ordered round-the-clock surveillance.

They feared the Royal Family would be compromised and that there would be a constitutional crisis if news leaked out of how the Prince was behaving.

He was known to be “letting his hair down” with celebrities of the day at weekly meetings of the Thursday Club above exclusive Wheeler’s Restaurant in Soho.

One senior detective, now retired, who was attached to the Prince’s protection team, said: “It’s true we had to report back on where we had been and who had been present.”

But he refused to discuss the Prince’s private visits.It is not known what details of Prince Philip’s private life were made known to the Queen or the Privy Council. But it will not be until the years 2052 to 2060 that they will be released – if then.”

https://thecolemanexperience.wordpress.com/2014/02/02/prince-philip-filthy-secrets-princess-diana-jimmy-savile-and-the-100-year-d-notice/


Jimmy Savile Takes Young Girl To Prince Philip in Buckingham Palace.


Another murdered girl is found on the grounds of  a different royal family estate – Sandringham – the castle where convicted establishment paedophile Jeffrey Epstein visited and hunted.

 photo sandringham murder_zpshter0vvt.jpg

Murdered girl found near royal stud farm

British police said that a young woman’s body was found in the forest at Sandringham and that they are treating it as a murder case.

Queen Elizabeth II and her family gathered in rural splendor to celebrate Christmas and New Year’s.

Sandringham has long been one of the queen’s favorite residences, especially during the holidays.

The royal family also typically enjoys horseback riding and shooting parties at Sandringham

Buckingham Palace officials are staying mum about the murder case.

http://www.nbcnews.com/id/45850427/ns/world_news-europe/t/murder-inquiry-after-female-remains-found-uk-queens-estate/#.VxToYnpGQpo

It is one mile from the entrance to Sandringham House and half a mile from the Sandringham Stud where the Queen breeds racehorses.

Prince Philip normally leads shooting parties on the estate and has previously been seen with his gun in the field next to the wooded area.

http://www.dailymail.co.uk/news/article-2081529/Sandringham-house-Human-remains-dog-walker-Queens-estate.html

An inquest into the death of Lithuanian teenager Alisa Dmitrijeva will take place more than two and a half years after her body was found on the Sandringham Estate

The last positive sighting of her was in Friar’s Street, King’s Lynn at 12.15am on Wednesday 31 August 2011, where she was seen in a green Lexus car with two men.

Despite extensive enquiries and tests, police have been unable to confirm exactly how or when Alisa died.

They are also appealing for anyone with information about her black LG GM360 phone which is also missing.

The last signal her phone gave out was at the nearby Sandringham estate.

Despite the inquest today the case of Alisa’s death does remain open

http://www.itv.com/news/anglia/2014-09-15/inquest-into-death-of-latvian-teenager-found-on-royal-estate/

WHAT IS WITH THE ROYAL FAMILY & DEAD BODIES?

https://spidercatweb.wordpress.com/2015/10/02/what-is-with-the-royal-family-dead-bodies/

Prince Philip loves “blood-sports”

The now-frowned upon custom of a royal hunt was, at the time, a popular past-time amongst royals and wealthy

In 1961, Prince Philip went ahead with the hunt despite protests from British and Indian politicians.

On the same trip he is said to have killed a crocodile and six mountain sheep.

Critics of the Duke’s fondness for hunting claim he has shot at least 30,000 pheasants in Britain alone and has also killed deer, rabbit, wild duck, pigeon and partridge.

http://www.express.co.uk/news/royal/595424/Queen-Prince-Philip-pose-dead-tiger-50-years-before-Cecil-lion-controversy


Visit: Epstein was hosted by Prince Andrew at Sandringham,The Queen's home in Norfolk

Visit: Paedophile Jeffrey Epstein was hosted by Prince Andrew at Sandringham,The Queen’s home in Norfolk

Jeffrey Epstein ‘kept a diary of his under-aged victims

The Duke of York’s billionaire paedophile friend kept a secret journal, described as “The Holy Grail” by lawyers, which listed his alleged under-aged victims and the celebrity guests he entertained at his Florida mansion.

Jeffrey Epstein and Ghislaine Maxwell at Sandringham in 2000 Photo: ALBANPIX


Jeffrey Epstein and Ghislaine Maxwell were among guests on this pheasant shoot, attended by Andrew (right), at Sandringham, Norfolk, after the Prince and the US businessman became friends

link

The billionaire financier, who attended The Queen’s birthday party in 2000, was sentenced to 18 months in prison in 2008

Prince Andrew’s billionaire convicted paedophile friend, Jeffrey Epstein, given permission to land his private jet at RAF base for visit to Sandringham

The flight log of Epstein’s Gulfstream revealed it touched down at RAF Marham on December 7, 2000, before he was hosted by the Andrew at the Queen’s Norfolk residence.

Civil aviation authorities called the situation ‘unusual’.

He is alleged to have used his fleet of private aircraft to traffic under-aged girls around the world for sex.

Entries in the Gulfstream’s flight log reveal he regularly flew alone with Virginia Roberts, who has claimed she was used as a ‘sex slave’ by Epstein from the age of 15. Roberts was photographed with the Duke.

www.dailymail.co.uk/news/article-1364742/Jeffrey-Epstein-Prince-Andrews-billionaire-paedophile-friend-visit-Sandringham.html

The Palace has declined to say, for example, why Andrew was in the company of a 17-year-old masseuse working for Epstein at Maxwell’s home.

The Palace also refuses to answer questions about Andrew’s friendship with Epstein, or confirm the several occasions the two men appear to have partied together.

Those reported encounters between Epstein and Andrew, some of which appear to be corroborated by flight logs for Epstein’s private planes, which have been reviewed by the Guardian, stretch back more than a decade.

They include parties at Windsor Castle and Sandringham, the Queen’s Norfolk estate,

an exclusive dinner in St Tropez and a holiday in Thailand…

Indeed, the Palace has never offered a public explanation for Andrew’s most controversial meeting with Epstein, which occurred in New York in 2011. That was two years after Epstein had been released from prison. He was, by then, a registered sex offender, and though some celebrities were still willing to be seen with him, he’d been abandoned by many of the more influential figures he previously called his friends.

www.theguardian.com/world/2015/jan/10/jeffrey-epstein-decade-scandal-prince-andrew

SANDRINGHAM AND JEFFREY EPSTEIN

aangirfan.blogspot.com/2012/01/sandringham-and-jeffrey-epstein.html


 

Let’s reveal millions of royal secrets

“It begs the question: what have they got to hide? Help us find out.”

Graham Smith, Republic’s CEO

 

Millions of secrets

Did you know the royals are more secretive than the CIA or MI5?  That’s according to historians who have tried to uncover secrets held in the royal archives.

Millions of official papers, including letters to and from prime ministers and international figures, are locked away in Windsor Castle.  Why?  Because they’re documents held by the royal family, and instead of being transferred to the National Archive they have been retained by the royals and put in the Royal Archive.

That means the official record of Britain’s head of state – evidence of exactly what’s been going on behind closed doors for decades – is kept a closely guarded secret.

Hidden past

The Royal Archive, created in 1914, is treated by the royals as private and personal.  Unlike the National Archive in Kew it is not subject to official regulations that allow widespread disclosure. Yet these are the official records of Britain’s head of state.

There is no systematic releasing of letters and documents under the 30 year rule, no access under Freedom of Information laws – there isn’t even a publicly accessible catalogue of the material the archive holds.  None of the standards and rules applied to government documents are applied to the records of the Queen, her predecessors or her family.  The history of the monarchy is hidden away from public gaze.

Not just hidden, but often destroyed.  So determined the royals are to hide their secrets the King sent a courtier to Germany in 1945 to retrieve letters from the archives of relatives there. Credible reports suggest that the royals have since destroyed thousands of documents from the 1930s and 40s.

https://www.republic.org.uk/royal-archives


 

Myra Hindley exposed as a ‘practicing WITCH’ whose occult links lead to Jimmy Savile

30th July 2017

MOORS murderer Myra Hindley has been accused of being a practicing witch who worshipped the occult alongside Ian Brady while the duo carried out their evil crimes.

At Ian Brady’s side, monstrous Hindley was responsible for the murder and torture of at least five children in the 1960s.But now it has emerged that the evil pair were versed in the occult, and took their child victims to Saddleworth Moor to carry out sadistic rituals.Hindley has been accused of taking on the look of the witch while Brady behaved as the alchemist, according to Moors murder expert Erica Gregory.Speaking exclusively to Daily Star Online, she said: “Myra was given a high status by Brady from the start.“This was his way of manipulating her into doing exactly what he wanted.“Myra took the role of the persecuted women in history while Brady was taking on the role of alchemist – they even found books on witchcraft in their house when police arrested them.“We have found evidence they were doing rituals on the Moors – we’ve seen knotted ropes, hare and sheep bones with evidence of large fires lit up around oak trees.”

Gregory even believes that the the murders were meticulously planned for ritualistic purposes – with the evil duo choosing to kill their victims on dates important within the occult calendar.“The murders were separated by four months – I believe Brady chose dates and times for his rituals,” she said.“Tommy Rhattigan, for example, was taken in November 1963 – the same day Margaret Murray died – who was a famous witch.“I believe her death, and the fact it was the anniversary of the Battle of Sheriffmuir was a trigger for Tommy to be picked up.”

It is no secret that witchcraft and satanic worshipping were big in the 1960s – with several high-profile Hollywood films airing in the era.And the Moors murderers even had links to infamous Alex Sanders – who rose to notoriety for attempting to raise a dead body in Alderley Edge and was a known friend of Jimmy Savile.“Brady and Hindley sought out Sanders when he worked at the John Rylands Library in Manchester which held books on occultism.“Sanders went on to work on films with Sharon Tate and he was friends with Savile, too – so there’s a clear link.”

This comes after Daily Star Online exclusively revealed that Brady was accused of selling child pornography to the shamed former DJ.Hindley and Brady were given life sentences in 1966.Together, they killed Pauline Reade, John Kilbride, Keith Bennett, Lesley Ann Downey and Edward Evans between July 1963 and October 1965.At least four of them, including Bennett, were sexually assaulted.It comes after Daily Star Online exclusively revealed Ian Brady’s evil map that could cryptically lead to the location of Keith Bennett’s body – which has never been found.

http://www.dailystar.co.uk/news/latest-news/632592/Moors-murders-Myra-Hindley-witchcraft-Ian-Brady-Jimmy-Savile-Saddleworth-Moor-Manchester

Erica Gregory – who has devoted years of her life investigating the Moors murders – believes they even formed a twisted “paedophile ring”.

she said: “I believe they went to the BBC studio regularly to make a fuss and try to get in with Savile.

“Alongside David Smith, Brady was selling photographs of children to make money at this time – I believe Savile could have been one of his customers.

“It is well known that Savile visited them both inside. I believe they were in a ring of some sort.”

It doesn’t stop there, though.

In 2014, Dan Davies noted that Savile chillingly replied “I am the Myra Hindley story” when asked on his opinion of it.And Gregory believes that Savile continued to communicate with the killers after their incarceration – visiting them and using songs played on the radio to transmit coded messages.“Savile could have been using his radio for secret messages,” she said.“Brady used music in tapes and songs that he stated reminded him of the Moors.“And Savile knew that if he played a song at a certain time then those listening would get the message.”http://www.dailystar.co.uk/news/latest-news/624549/Moors-murders-Jimmy-Savile-Ian-Brady-Myra-Hindley-paedophile-child-killers-Saddleworth-BBCDavid Smith allegedly and conveniently committed suicide:

  • Judge closes case against Smith

Savile’s convicted paedophile BBC driver found dead on day he was due to stand trial for sex crimes uncovered in Yewtree probe

David Smith, 67, was chauffeur to Savile and other celebrities in 1980s

Apparent suicide on the eve of his court appearance

 

  • Officers found him dead at his home in Lewisham, south-east London
  • Smith had 22 previous convictions for sexual abuse against young boys
  • Judge closes case against Smith

link

Brady letters will remain classified until 2051.

http://www.mirror.co.uk/news/uk-news/love-letters-between-ian-brady-10326571

Sir Tony Hetherington, the DPP is dead, Cyril Smith andLeon  Brittan are dead, as is Willie Whitelaw who had, while Home Secretary in 1980, allegedly blocked a police investigation into a Westminster paedophile ring.

However, former Met boss Sir David McNee is still with us.

Smith had been investigated by Lancashire police at least four times by then, going back to the Sixties. The investigations were all halted.

http://www.dailymail.co.uk/news/article-3004934/Ex-chief-constable-says-Cyril-Smith-cover-went-right-top.html

Image result for cyril smith and david steel nominated him
Lord David Steel (left) put Rochdale MP Cyril Smith (right) … for a knighthood, despite being told of abuse allegations against him.

The politician, now Lord Steel, was made aware of the reports that Smith had sexually abused young boys in his hometown of Rochdale, Lancashire, in 1979.       

But dismissed the allegations – claiming: ‘All he seems to have done is spanked a few bare bottoms’.

http://www.dailymail.co.uk/news/article-2566158/Lord-David-Steel-paedophile-MP-Cyril-Smith-forward-knighthood-told-abuse-allegations.html

Image result for david steel and cyril smith


Related?.. Another MP, like Ted “Ed” Heath, linked with a satanic child rapist…

Pervert MP Cyril Smith was pals with satanic child sex monster

Victim Michael Roberts reveals his devil-worshipping stepdad Michael Horgan organised abuse

Sept 3 2014

Paedophile MP Cyril Smith was in league with another appalling child sex abuser who set up satanic rituals and raped children as young as TWO.

Victim Michael Roberts, 40, today bravely puts aside his right to ­anonymity to tell for the first time how he was only six when he was sexually abused by 29-stone politician Smith.

michael-horgan

Michael Horgan, who has also used the name Shaun O’Donnell, became known as the High Priest of Satan.

He organised outdoor “parties” for these activities on Saddleworth Moor, where child killers Ian Brady and Myra Hindley had buried their victims.

Youngsters from two to 13 were drugged, tortured and sexually abused during the satanic “ceremonies”.

He was jailed for 10 years and placed on the sex offenders’ register after he was found guilty of six sex abuse ­charges in 1992

The shock revelation over the satanist and MP’s friendship raises questions over any role Smith and Jimmy Savile may have played in Horgan’s paedo ring.

Horgan was also pals with Raymond Hewlett, the child rapist questioned in relation to the disappearance of Madeleine McCann.



 

Royal Family, Paedophilia, Satanism & Murder

Aug 29th, 2017


DISCLAIMER: THE POSTING OF STORIES, COMMENTARIES, REPORTS, DOCUMENTS AND LINKS (EMBEDDED OR OTHERWISE) ON THIS SITE DOES NOT IN ANY WAY, SHAPE OR FORM, IMPLIED OR OTHERWISE, NECESSARILY EXPRESS OR SUGGEST ENDORSEMENT OR SUPPORT OF ANY OF SUCH POSTED MATERIAL OR PARTS THEREIN.