Keith Vaz, Charities, Friends etc (Updated)

Police probe Vaz misconduct claims

11 Sept 2016

Police are examining allegations against the Labour MP Keith Vaz involving potential abuse of office and personal misconduct dating back 25 years.

Four witnesses, including a former lord mayor of Leicester, last week confirmed they had been interviewed by Leicestershire detectives. The inquiries have been going on for at least a year.

http://www.thetimes.co.uk/edition/news/police-probe-vaz-misconduct-claims-rk8p5h6pk

 

Mooted attempt to oust Keith Vaz at yesterday’s Labour NEC never happened. Instead, I’m told, he got a round of applause as he entered room

……………………………………………………………………………

Andrew Bridgen & John Mann  re: Vaz ?


Senior MP accused of child sex abuse: Two MPs report same serving Labour politician to police over sex attacks and corruption claims

  • Labour MP John Mann one of the informants to pass information to police 
  • A fortnight ago a Conservative MP told police about the same politician 
  • Unnamed MP is accused of offering political favours to a brothel owner
  • Also claimed they were arrested for indecency in public place with a minor 

A senior Labour MP has been reported to police by two fellow MPs over claims of child sex abuse, The Mail on Sunday has learned.

One of the informants, Labour MP John Mann, passed details about the prominent individual to officers earlier this year.

Then, a fortnight ago, a Conservative MP went to the same police force armed with information about the same individual, some of which had been provided to him by a former Government Minister.

It is believed to be the first time that a sitting MP has been scrutinised by any of the ongoing police investigations into child abuse, representing a further extension of the ever-widening sphere of historic sex allegations.

Mr Mann handed his information over to an ongoing criminal investigation into another public figure, which included links between that figure and the Labour MP.

The Conservative MP’s allegations about the MP, which date back to the late 1980s, include claims that the MP had been arrested for indecency in a public place with a minor – during which he is said to have assaulted the arresting officers.

It is claimed the MP had performed political favours for the owner of a brothel in his constituency in which men consorted with underage males.

The Conservative MP also made further allegations about drink-driving, assault and corruption involving the Labour MP.

A BBC News team, headed by a journalist who specialises in reporting on sex abuse crimes, is also understood to have had access to the information. The team, which has been granted significant resources by bosses, has already started interviewing potential witnesses about the MP. Director-general Tony Hall has been made aware of the special project.

http://www.dailymail.co.uk/news/article-3166708/Senior-MP-accused-child-sex-abuse-Two-MPs-report-serving-Labour-politician-police-sex-attacks-corruption-claims.html

 

vaz-mann

 


Keith Vaz is good friends with The Purdews of Champneys – and the Purdews were good friends with Jimmy Savile.

link

16514-small1

Dr Venu, Keith Vaz MP, businessman Stephen Purdew and Michelin chef Sriram Aylur

Stephen Purdew… is certainly close to Keith Vaz, the prominent Labour politician who enjoys being in the company of rich men and is not himself a stranger to allegations of sleaze.

vaz-bercow-purdew

Keith Vaz, speaker John Bercow and Champneys’ Stephen Purdew

 

Mr Bercow is regarded as being on warm terms with Mr Vaz.

Royal Wedding - Wedding Guests And Party Make Their Way To Westminster Abbey

John Bercow:

Sarah Westcott, a young journalist at the Press Association, went out with John Bercow a few times in 2000. He was nearly 40 at the time, yet seemed more like a clumsy schoolboy than a middle-aged MP.

‘He was a bit funny with women. One night, I kissed him on the cheek and he was terrified.’

The lack of a girlfriend was becoming a curse, as local associations tended to look favourably on those who were married or at least had a respectable girlfriend to help with fund-raising coffee mornings.

Not wanting to lose out, Bercow came up with a solution: he borrowed other people’s girlfriends or co-opted friends to take along to selection meetings.

One friend was so confused by the fake girlfriends that, to this day, he believes Bercow is gay.

 sq58ug

Lord Tebbit was John Bercow’s hero.

Norman Tebbit admits he heard rumours top Tory was paedophile a decade before truth revealed

Norman Tebbit admitted he had been told Sir Peter Morrison was a paedophile more than a decade before the truth about the notorious Tory was exposed.

link


Background on Bercow:

At 18 Bercow became secretary of the Monday Club when it favoured bans on coloured immigration and “properly financed voluntary repatriation”.

Bercow became national chairman of the ultra-right Federation of Conservative Students in 1986, a year after it disgraced itself by indulging in riotous vandalism at Loughborough.

link

article-2566489-1bc2ca4400000578-288_634x465

The 12-year-old John Bercow appeared on the BBC in Crackerjack in 1975.

Bercow’s father drove minicabs for a living and John Bercow went to Finchley Manorhill comprehensive school in north London.

(A bizarre 50-year feud started when his father, Charlie, and his uncle Samson – Alan Bercow‘s father – fell out over the ownership of the family minicab company in Finchley, North London. The feud between John Bercow’s father, Charlie, and Alan Bercow’s father, Samson, dates back to the 1950s and involved a successful minicab company in Finchley, North London, set up by Charlie.)

Bercow’s paternal grandfather, Jack Bercowitch, was from Romania who worked first as a gas fitter and then as a furrier, and in due course opened a shop.

bercow-motors

1970 link

Two of his sons, Ralph and Charlie, set up a business called Bercow Motors, in Warren Street in central London, which prospered until the late 1960s, when the council painted yellow lines on the road outside their showroom. Charlie Bercow married Brenda Bailey, a legal secretary and in 1963 she gave birth to their son, John Simon Bercow.

link

 

Mr Bercow first became involved in politics as a teenager while attending a school in the Margaret Thatcher’s Finchley constituency.


mondayclub_logo

 

John Bercow and his Monday Club colleagues:

Bercow joined not only the Young Conservatives but the Monday Club, where very soon he was promoting the voluntary repatriation of immigrants.

The Monday Club had various study groups  including:

  • Immigration and Repatriation:

  • notable chairmen being  George Kennedy Young* CB, MBE; Harvey Proctor MP Jonathan Guinness; (John Bercow, now an MP and Speaker of the House of Commons, was committee secretary 1981-82);

 

via WW:

young_george_kennedy1

George Kennedy Young

John Mann said Monday Club member “ George Kennedy Young was ‘key’ to paedophile claims”

Labour MP said GK Young, ex-deputy director of MI6 took part in ‘dubious’ activities

Mann added Mr Young was a ‘manipulator’ who controlled groups of people within which there were paedophile rings in the 1970s or 1980s.

Dickens Dossier:

In a Westminster Hall debate, Mr Mann said Mr Young, who died in 1990, had been named in the first line of the document.

He said: ‘This is an original, I have spoken and met and got a copy from the person who personally handed it to Geoffrey Dickens who then personally gave it to Leon Brittan.

‘And what it says is, first line – GK Young heads up a Powellite faction known as Tory Action. GK Young, George Kennedy Young, was deputy director of MI6 in the past, long dead.

‘The allegations are that he manipulated a group of people and that within that there were paedophile rings. And it goes into detail – who it’s alleged were involved and where.

‘I won’t give all the locations because some would be I think sensitive and would potentially identify people – but London is one, Greater Manchester is another, North Yorkshire is a third one.’

Mr Mann said GK Young may be key in finding out what happened to the dossier.

http://www.dailymail.co.uk/news/article-3304214/Ex-deputy-director-MI6-named-MP-key-figure-manipulated-Westminster-VIP-paedophile-ring.html

 

gk-young-unison-ross-mcwhirter

George Kennedy Young, Ross McWhirter Unison Committee for Action

https://i2.wp.com/www.book-of-records.info/images/redwood1.jpg

Sara Morrison, February, 1967 wife of Charles Morrison, MP for Devizes. (Peter Morrison’s brother) and the McWhirters. Sara performed the opening of the print works for the Guinness Book of World Records

Image result for charles morrison brother of peter morrison

[linked image]

Gyles Brandreth was warned several times that the late Sir PeterMorrison was a “disgusting pervert.” A former Bryn Estyn resident said he saw Morrison visit the Welsh care home and drive away with one of the boys.

28 Sept 2016

Gordon Anglesea trial:

A police commissioner has told a jury that he used to drive a senior officer, Gordon Anglesea, accused of sexually abusing boys to Bry Estyn children’s home.

He used to give Anglesea lifts in a police vehicle when asked. He said: “The only place I recall taking him was to Bryn Estyn children’s home. If he wanted to go to Bryn Estyn he would ask me and I would take him.”

link

image

McWhirters

The Society for Individual Freedom, which is described as a British Intelligence front involving George K. Young, Ross McWhirter (both with UK intelligence connections) and Gerald Howarth.

Gerald Howarth MP for Cannock and Burntwood from 1983 to 1992

Conservative Sir Gerald Howarth, defence minister until 2012, has mounted an extraordinary defence of a Tory MP who organised a Nazi-themed stag do – saying he was the victim of a ‘disgraceful witch hunt’.

And he tried to justify the MP’s involvement in such a distasteful event, claiming ‘we’ve all done it’.

http://www.dailymail.co.uk/news/article-2551933/Ex-minister-targets-Press-exposing-MP-Nazi-theme-party.html

gerald-howarth

Carter-Ruck’s champion Gerald Howarth MP talks gibberish on paedophilia

Here are some choice clips of Gerald Howarth sharing his wisdom on paedophilia with Chris Morris’s Brass Eye back in 2001

link

link


The Freedom Association was founded in 1975 as the National Association for Freedom (NAFF) by the Viscount De L’Isle, Norris McWhirter, Ross McWhirter and John Gouriet. Ross McWhirter had drawn up a fifteen-point Charter of Rights and Liberties before being assassinated by the Provisional IRA in November 1975. NAFF was renamed The Freedom Association in the winter of 1978
PIE member / convicted paedophile Charles Napier – his half-brother John Whittingdale was involved.
freedomassociationlogo
freedom-association

Back to the Monday Club…other members included:

Sir Rhodes Boyson, Sir Peter Bottomley, Neil Hamilton,  Sir James Goldsmith, Victor Montagu, Alan Lennox-Boyd, Derek Laud

Alan Lennox Boyd-prior owner of Henlow Grange (later owned by the Purdews) – “Churchill protege Alan Lennox-Boyd, who married sisters, Guinness heiresses, but enjoyed riotous homosexual adventures behind the scenes. Lennox-Boyd had a distinguished ministerial career in several governments…”

link

https://i1.wp.com/cdn.c.photoshelter.com/img-get/I0000BOZ0NaYgSPo/s/860/860/Lennox-Boyd-Mark-19871039MLB2.jpg

Alan Lennox Boyd’s son: Mark Lennox-Boyd (above) invested in Proctor’s Cottonrose shirt shop and and was Mrs Thatcher’s private parliamentary secretary.
link

link


https://i0.wp.com/dontpaniconline.com/media/magazine/body/2015-03-30/images/enoch.jpg

Enoch Powell and Jimmy Savile

https://i0.wp.com/impiousdigest.com/wp-content/uploads/Enoch-Powell-accused-of-satanic-sex-abuse1.png

John Bercow’s admiration for Enoch Powell was unbounded.

Harvey  Proctor was also a devotee of Enoch Powell.

 


mirror210587a

Harvey Proctor/his solicitor Jonathan Denby (cousin of Barbara Hewson)/ Enoch Powell

 

Jonathan Denby’s cousin Barbara Hewson:

https://goodnessandharmony.files.wordpress.com/2016/09/fdb03-barbara-hewson.png?w=474

Barbara Hewson’s cousin – fugitive solicitor – Jonathan Denby was PPS to Enoch Powell and was Harvey Proctor’s solicitor:


b_wgw3yweaehqqn

Dame Alun Roberts@ciabaudo

Bee Carthew was extremely close to GK Young, recently mentioned in connection with Dickens Dossier given to John Mann.

Why would a spook and right-wing nutcase (Carthew) write in great detail to a senior politician Enoch Powell and his wife

to tell him that Harvey Proctor’s London solicitor (Denby) is on the run after forcing policemen to lie on floor at gunpoint was hiding in Home Secretary’s (Leon Brittan) constituency (Richmond) whilst being search for by Crimewatch. Isn’t that weird?

link

link

https://en.wikipedia.org/wiki/London_Swinton_Circle#Bee_Carthew

Former fugitive, Jonathan Denby, Harvey Proctor’s solicitor, got off lightly for his crimes and is now running a hotel in the Lake District.

Hotel owner, Jonathan Denby, has replaced the handy Holy Bible in nightstand drawers for  S&M porn  “Fifty Shades of Grey.”

link

link


bercow-lambeth

Councillor John Bercow of Lambeth

link

bercow

 1986 -1990  : Bercow, age 23 – Conservative councillor in Lambeth

Bercow served as the youngest ever deputy leader of the Tory group in Lambeth.

Lambeth:

Paedo MP cover-up claim: Top cop removed from sex abuse probe after naming politicians as suspects

There’s another reason why Scotland Yard were so keen to close the investigation down.

In November 1997 the South London Press ran a story about a ‘sex chamber’ hidden in the basement of Lambeth Police Station with bedding, a red light, and a manacle. Was Lambeth Police Station being used by the paedophile ring to abuse children and produce child pornography?

link

Lambeth1

The Lambeth Police Station ‘Sex Chamber’

The Mirror have reported on the cover-up of an investigation of a paedophile ring in Lambeth council children’s homes. It’s suspected that the reason for the cover-up was the involvement of politicians, including at least one MP.

link

My Sweet Landlord ‏

Lambeth District Housing Office is next door to Lambeth Police Station!

Lambeth Child Sexual Abuse Basic Timeline

 

LAMBETH CHILD ABUSE; HANGED BOY; TOP PEOPLE

Bercow gave up a political lobbying job with the Tories’ favourite ad agency, Saatchi and Saatchi, to work for Jonathan Aitken, after previously spending a brief period in the City, working as a merchant banker for Hambros.

After Aitken was jailed for perjury and perverting the course of justice, and he was forced to resign as a cabinet minister,

Bercow went to work for Virginia Bottomley, by then National Heritage Secretary, moving on at the 1997 election when her career as minister ended and he began his as an MP.

Virginia Bottomley

https://i0.wp.com/chrisspivey.org/wp-content/uploads/2013/03/ab.jpg

Image result for bottomley and queen

The Bottomleys’ links to Lambeth

link

henrybottomley

Henry Bottomley

Peter Bottomley’s brother Henry was a Lambeth councillor at the same time as John Bercow (1986-90) and Virginia Bottomley worked at Maudsley Hospital (Brixton and Camberwell Child Guidance Units) as psychiatric social worker 1973-84 and was chairman of Lambeth Juvenile Court 1981-84

v-bottomley-whos-who

The World of Who’s Who of Women 1992/93

Peter Righton was a founder of PIE, Napier its one-time treasurer. Righton, incredibly, was also one of Britain’s leading child protection specialists when Virginia Bottomley was Health Secretary

 


bottomley-ill-sue

Sir Peter, who is married to the former Conservative Cabinet minister Virginia Bottomley, told Radio Four’s Today programme that people were also now wrongly suggesting that he may have visited the Elm Guest House, in Barnes, south-west London, which is at the centre of some of the current claims.

The Elm Guest House is alleged to have been the scene of paedophile activity and sex parties attended by politicians and other prominent figures in the 1970s and 1980s. Visitors are said to have included the late Liberal MP Sir Cyril Smith.

http://www.dailymail.co.uk/news/article-2683533/I-ll-sue-links-untrue-paedophile-claims-says-Tory-grandee-Peter-Bottomley.html

cyril-smith

http://www.telegraph.co.uk/news/politics/liberaldemocrats/10775341/Cyril-Smith-the-predatory-paedophile-protected-by-establishment.html


Back to Peter Bottomley’s fellow Monday Club member John Bercow…

Like his friend Keith Vaz, Bercow also married late in life

https://i2.wp.com/l7.alamy.com/zooms/0fbad43f88c54330b01282dd915bd584/john-bercow-wedding-g645d3.jpg

Bercow, age 39, married Sally Illman in 2002

.

lewis

^His good friend, Julian Lewis, the future shadow cabinet member was best man at his wedding.

link

link

julian-janner

Julian Lewis- supporter of Greville Janner’s HET

bercow-het

John Bercow – supporter of Greville Janner’s HET

Holocaust Education Trust Reception

Greville Janner – HET

link

 

young_monday_clubbers

Other Monday Club members – John Remfrey  Pinniger (far left) was a leading activist and political adviser in the right-wing Conservative Monday Club during the early 1980s

Three of the Young Members’ Group at a Club Conference at Chilham Castle, 1980: John R. Pinniger (YMG Chairman), Richard Turnbull, & Gregory Lauder-Frost.

John R Pinniger  –  former Conservative councillor for  Lambeth 1990

He was also a leading activist and political adviser in the right-wing Conservative Monday Club

Pinniger worked closely with the Conservative Member of Parliament Harvey Proctor, who was then Chairman of the Monday Club’s Immigration & Repatriation Committee.

He co-authored papers with Proctor including:

”Immigration, Repatriation, & the Commission for Racial Equality”, by Keith_Harvey_Proctor, M.P., John R. Pinniger, M.A., with a foreword by Sir Ronald Bell, Q.C., M.P., published by the Monday Club, 1981, (P/B).

Pinniger was a director, along with Derek Laud of

LUDGATE LAUD LIMITED

https://companycheck.co.uk/director/904390291/MR-JOHN-REMFREY-PINNIGER/companies

John Pinniger was a “research assistant” to Harvey Proctor MP and to Sir Charles Irving MP and Pinniger worked at Harrod’s menswear shop in between his parliamentary duties.

vis Troy@snowfaked

 

twitter.com/ciabaudo:

Sir Charles Irving

See Pinniger also worked for Charles Irving who offered steady ‘stream of advice’ to CHE

Clive Froggatt Clive Froggatt, a leading physician in England, and a favorite of prime minister Margaret Thatcher and a very senior government health adviser to both Margaret Thatcher and John Major, was addicted to heroin, allegedly taking up to eight fixes a day.

link

this is the doctor who has been a guru to a succession of former Health Secretaries including Ken Clarke,now Chancellor;

Virginia Bottomley, now Heritage chief;

and William Waldegrave  – special advisor to Patrick Rock.

William Waldegrave, the health secretary, giving details of the two enquiries launched in the aftermath of the case, described Beck as evil. He said that the Commons had shown its support for Mr Janner.

Keith Vaz, Labour MP for Leicester East, condemned the ”cowardly attacks” on Mr Janner. Michael Latham, Tory MP for Rutland and Melton, said that Mr Janner had been the target of ”vile allegations and lies”.

link

As Beck was sentenced, William Waldegrave, the former health secretary announced two inquiries. One would investigate the selection of staff in Britain’s children’s homes. The other, chaired by Andrew Kirkwood QC which is reporting today, would find out why staff at one of Britain’s biggest social services departments failed to act on warnings which would have lead them to the discovery of a catalogue of abuse. Allegations of physical and sexual abuse were first made in 1980 – seven years after Beck started working as an officer in charge of a children’s home. They continued over the next six years, from children and social workers, and on four different occasions were passed on to police. After one investigation, police charged Beck with assault. However, he was subsequently acquitted after a crown court trial in 1982. Despite these allegations, Beck continued working at The Beeches, Leicester Forest East, where he had been officer in charge since 1978. He had spent the previous five years working at The Poplars – a home in Market Harborough – before moving to Ratcliffe Road children’s home. He eventually resigned in 1986 after he was suspended following an allegation of sexual harassment by a fellow member of staff. However he was given references which enabled him to take jobs with Brent and Hertfordshire social services. He also worked with charities.

link

Froggatt also worked on a Tory health service think-tank with MP David Willetts, who was forced to resign for trying to nobble a Commons committee probing sleaze.

Froggatt, an advisor”on heroin movie Eyes Wide Shut starring Tom Cruise and Nicole Kidman, publicly claims he is now “clean”.

Sir Charles Irving

When arrested, he claimed he was using the drug as a painkiller for his close friend and Tory MP for Cheltenham Sir Charles Irving, who he said was dying of AIDS

(Cheltenham – GCHQ & GCHQ Freemason Lodge and PIE member Keith Harding area)

Froggatt was brought into the Conservative fold in 1983 by Sir Norman Fowler and quickly became an adviser to the powerful Downing Street policy unit.

He developed a close friendship with Virginia Bottomley and frequently dined at her house.

Froggatt even told friends that he advised her on everything from how she enters a room to how she does her hair.

Ken Clarke once asked him to stand in for him at an Oxford Union health deb

When he had an idea, he rang Tory ministers and they listened.

link

Currently Pinniger is director  of:

  • Harris Edge Consulting Ltd
    2012 – Present (4 years)London, United Kingdom

    International business and public relations specialising in francophone West Africa, the Balkans and Western Europe

  • Representative of the Guild of Travel and Tourism

  • Member of the Franco-British Society, the Anglo-Belgian Society and the City Swiss Club

pinniger

 

link

link

link

link

http://media.gettyimages.com/photos/jonathan-guinness-paul-simonon-shaun-leane-and-daphne-guinneess-an-picture-id117732456

Jonathan Guinness (far left) attends an exclusive party to celebrate the completion of ‘Contra Mundum’ or ‘Against The World’, a one of a kind diamond glove created by his daughter Daphne Guinness on June 30, 2011.

Image result for jonathan guinness

Jonathan Guinness

Image result for jonathan guinness

Jonathan Guinness of the Monday Club was from 1970 to 1974 he was a Leicestershire County Councillor

Frank Beck convicted child sex offender associated with Janner was employed by the Leicestershire County Council as the officer-in-charge of several children’s homes in Leicestershire, between 1973 and 1986.

Greville Janner was MP of Leicester

https://images-na.ssl-images-amazon.com/images/I/51SitdQ6iWL._UY250_.jpg

http://www.dailymail.co.uk/news/article-2455171/Unity-Mitford-English-debutante-staged-Nazi-orgies-Hitler-lost-virginity-Oswald-Mosley.html

Jonathan Guinness is the elder of the two sons of Bryan Guinness, 2nd Baron Moyne and his first wife Diana Mitford (later Lady Mosley).

News from The National Archives

Document reference: KV 2/1363-1364

Lady Diana Mosley (1910-2003) was one of the daughters of Lord Redesdale, and had the reputation of being the most beautiful and dazzling of the ‘Mitford girls’. She married the heir to the Guinness company, Brian (later Lord Moyne), at the age of 18, but subsequently left him and then married the British fascist, Oswald Mosley. She was introduced to Hitler by her sister, Unity, and maintained a life-long admiration for him and his political beliefs.

http://www.nationalarchives.gov.uk/releases/2003/november14/mosley.htm

Unity Mitford was even once called 'a perfect specimen of Aryan womanhood' by the Fuhrer himself

Unity Mitford, according to a startling new biography of the aristocrat’s daughter who scandalised Thirties Britain by becoming a member of Adolf Hitler’s most intimate circle.

these Nazi-themed orgies were devised by Unity and carried out with Hitler’s connivance

http://www.dailymail.co.uk/news/article-2455171/Unity-Mitford-English-debutante-staged-Nazi-orgies-Hitler-lost-virginity-Oswald-Mosley.html

Jonathan Guinness’ aunt, Debo Mitford, was friends with Jimmy Savile and Prince Charles.

alun:

The Guinness family seems to have had many points of contact with abuse circles.

https://i2.wp.com/cdn.images.express.co.uk/img/dynamic/1/590x/secondary/204277.jpg

Debo and Prince Charles

From Jimmy Savile’s auction:

A collection of Christmas greetings cards, including from members of the Royal Household, four from Princess Alexandra (1936- ) The Honourable Lady Ogilvy and Sir Angus Ogilvy (1928-2004); and two handwritten postcards from Deborah (1920- ) Duchess of Devonshire, signed ‘Debo’.


Provenance: From the estate of Sir Jimmy Savile. OBE, KThe eldest of John Morrison’s sons, James , married Sophia Cavendish, daugher of the youngest of the Mitford sisters, Deborah.

Deborah Mitford is also known as DEBO.CSG, LLD (1926-2011)


John Granville Morrison, 1st Baron Margadale

John Morrison’s grandson, Alastair John Morrison, 3rd Baron Margadale DL,

Alastair Morrison married Lady Sophia Cavendish, daughter of Andrew Cavendish, 11th Duke of Devonshire and  Deborah Mitford

The Mitford sisters were heavily influenced/influencing of Oswald Mosley, who may have been the influence for the political stance of THE MONDAY CLUB.


Sir Charles Morrison was the brother of Peter Morrison, who became MP for Chester, while his sister, Dame Mary Morrison, has been a Woman of the Bedchamber to Queen Elizabeth II for over fifty years.

Sir Charles Morrison (1932–2005) sat as Conservative MP for Devizes from 1964 until 1992.

Sir Charles Morrison was one of the investors in the Proctor’s shirt shop Cottonrose in Richmond. MP Harvey Proctor,Tory MP for Basildon 1979-1983 and Billericay 1983-1987, was forced to resign following his activities involving a rent boy/spanking.

Sara Morrison, Charles Morrison’s wife has been described as Edward Heath’s friend and important political confidante and she was with him when he died.

The daughter of Viscount Lang and the Duchess of Marlborough, Sara Morrison was a director of the influential program, Fourth Channel TV, and one of the principal organizers of the Conservative Party, said to be a close confidante of Prime Minister Margaret Thatcher.

The Morrison family

thatcher-morrison-brittan
hague-morrison-known

The third son of John Granville Morrison, 1st Baron Margadale, was Sir Peter Morrison (1944 –1995), was Conservative MP for Chester from 1974 to 1992 and died aged 51 in 1995.

He was Margaret Thatcher’s parliamentary private secretary and deputy chairman of the Conservative Party.

In October 2012 it was alleged that evidence has been seen that linked Peter Morrison to the North Wales children’s homes case, in which up to 650 children in 40 homes were sexually, physically and emotionally abused over a 20 year period.

It has also been alleged that Sir Peter was protected …and that his behaviour was covered up by senior party members and the media.

Morrison is now named in connection with a fresh inquiry into these allegations, which could also implicate the late DJ and TV presenter Jimmy Savile.

John Morrison’s daughter, Dame Mary Morrison, was a Woman of the Bedchamber to Queen Elizabeth II for forty years.

link


2016 – Bercow is accused of a cover-up re: Keith Vaz

 

John Bercow is accused of a ‘cover up’ after a Tory MP called for Keith Vaz’s suspension ONE YEAR before rent boy claims surfaced

‘These events had all the hallmarks of an establishment cover-up.’

 

382d4da000000578-0-image-a-39_1473546853613

 

  • Andrew Bridgen wrote to John Bercow to ensure Keith Vaz was suspended
  • He didn’t want Vaz to be chairman of the Home Affairs Select Committee 
  • But the Speaker refused and Mr Bridgen believes it was a ‘cover up’

 

Three weeks after Mr Bercow sent his letter, he was pictured with Mr Vaz in the directors’ box of Leicester City Football Club.

cr_tvbpwyaal3il

a letter from John Bercow, the Speaker, warning Andrew Bridgen MP it would be “inappropriate” to raise allegations against Vaz in the Commons.

When Mr Vaz appeared in the Commons last Monday, the day after the scandal broke, he was called to speak twice by Mr Bercow in the chamber.

The following day Mr Bercow was seen giving Mr Vaz a pat on the back and leaning over to squeeze his wrist during a conversation in the Commons.

link

Dame Alun Roberts CH@ciabaudo

Tory MP Andrew Bridgen claims Keith Vaz was already being investigated by police

 

Tory MP was stopped from making allegations about MP a year ago

10 Sep 2016

Andrew Bridgen was told not to use Parliamentary privilege to raise the matter in a Commons debate 

“To the casual ­observer these events had all the hallmarks of an establishment cover-up.

Andrew Bridgen, Tory MP for North West Leicestershire – 15 miles from Mr Vaz’s Leicester East constituency – wrote to the Speaker on September 3 last year.

Mr Bridgen said that should the ­allegations be substantiated then Labour’s Mr Vaz should be suspended as chair of the Home Affairs Select Committee.

Five days later Mr Bercow replied that he had no power to remove a select ­committee chair and warned Mr Bridgen not to use Parliamentary privilege to raise the matter in a Commons debate.

link

link

 

bercow-silver-star

John Bercow, with his wife Sally, opened the new Silver Star centre with Keith Vaz

12 Apr 2013

 link

Bercow launched the charity offices used by Daniel Dragusin, Vaz aide’s charity

Dan Dragusin who paid for Keith Vaz’s alleged sex party had ties to a network of parliamentarians.

The charity offices used by Daniel Dragusin, who gave £150 to two rent boys who visited the Labour grandee in his flat, were opened by John Bercow, the Speaker of the House of Commons.

link

Vaz’s charity chief, Dan Dragusin

gave £2,500 to Commons Speaker Bercow

trafalgar-square-460x250

At the request of the diabetes charity Silver Star, Mr Speaker John Bercow lit up the Elizabeth Tower, blue.

^ Wonder if Bercow charged for that? *innocent face*


As ever, the dots are all there – just need to be joined together. Start with the Bercow / McAlpine saga.

 

http://aangirfan.blogspot.com/2012/11/lord-mcalpine-innocent-others-are-not.html


why-is-lord-mcalpine-trending

untitled-1_2399731c

On 24 May 2013, the High Court of Justice ruled that her tweet, “Why is Lord McAlpine trending? *innocent face*”, was libelous. The two parties agreed to a settlement, and McAlpine donated the damages awarded to Children in Need.

In 2013, it was revealed McAlpine had owned the artwork of convicted paedophile Graham Ovenden – artwork that depicted naked children.

https://www.theguardian.com/uk/2013/apr/02/graham-ovenden-artist-1970s-decadence

link

Lord McAlpine denies North Wales child abuse claims

link

beqf9fsiqaa3qlz

McAlpine and Thatcher

http://aanirfan.blogspot.com/2014/11/john-allen-bigger-picture.html

 

Timing…

The Vaz saga is unfolding just as the Gordon Anglesea trial gets underway:

via WW

It all comes at the same time as Gordon Anglesea jury is sworn in at Mold – and Anglesea and Bryn go to the heart of much of this – and the westmonster links…


In December 1991 — eight months after Anglesea retired from the North Wales Police — the Independent On Sunday wrote about the police investigation into allegations of child abuse at the Bryn Estyn children’s home in North Wales.

The front page article stated:

“According to former residents of Bryn Estyn, Gordon Anglesea, a former senior North Wales police officer, was a regular visitor there.”

“He recently retired suddenly without explanation.”

link

The Jillings report, North Wales VIP child-abuse, William Hague, Leon Brittan, Ian Greer, Westminster Council, Operation Pallial and the Dolphin Square connection

link

hague-morrison
hague-morrison-known

Hague faces cover-up row over Thatcher ally’s link to care home abuse scandal: Former foreign secretary said to have been made aware of Sir Peter Morrison’s connections while working as Welsh secretary

  • Hague expected to be criticised in new report on Wales care home scandal
  • As many as 650 children were raped or assaulted in the 70s and 80s
  • Then-Welsh Secretary Hague ordered an inquiry into the abuse in 1996
  • New Whitehall inquiry expected to accuse Welsh office of mishandling it

 

link

Operation Pallial was set up in response to allegations regarding Tory peer Lord McAlpine – that he had abused children in North Wales care homes.

RETIRED NORTH Wales Police superintendent Gordon Anglesea was arrested on suspicion of historic physical and sexual assaults against children in December 2013

Anglesea was detained at his Colwyn Bay home in December by officers of the National Crime Agency.

Anglesea was the 18th person to be arrested as part of Operation Pallial, based at North Wales Police headquarters.

link

anglesea_cutting-e1390557036417

 

A former police chief visited a house where youngsters were plied with drink before men “picked a boy they wanted”, a court has heard.

Boys were abused there, in a caravan or taken to the pub, jurors were told.

The witness described the house as a “centre of paedophile activity”

He said the property in Brymbo, Wrexham, was used by a paedophile ring.

http://www.bbc.com/news/uk-wales-37472576

 

Gordon Anglesea trial: police officer was driven to children’s home, court told

28 Sept 2016

A police commissioner has told a jury that he used to drive a senior officer accused of sexually abusing boys to a children’s home.

Arfon Jones, the police and crime commissioner for north Wales, said he drove Gordon Anglesea to the Bryn Estyn children’s home in Wrexham.

Jones said he would not go into the home with Anglesea but just drop him off and carry on with the other duties that he had. He did not know how or when Anglesea would leave.

“I have no idea. I have no recollection of collecting him,” he said.

link

4221396001_4405502722001_gordonnnnnn

Jury in trial of ex-police chief Gordon Anglesea sworn in

5 Sep 2016

At Mold Crown Court a jury panel of 40 was first brought to court and members were told that the trial was listed for six weeks, although Judge Geraint Walters said that he expected it would take less than that.

Ex-police chief Gordon Anglesea ‘threatened abused boy’

14 Sept 2016

http://www.bbc.com/news/uk-wales-37361745

link

link

Macur Review

The Macur Review is an independent review, chaired by Lady Justice Macur, DBE. It’s a review of Sir Ronald Waterhouse’s inquiry into the abuse of children in care in the former Gwynedd and Clwyd council areas of North Wales between 1974 and 1996.

The Government have redacted, as we have heard, huge swathes of the Macur review, removing in particular the names of individuals who have been the subject of speculation and who have national recognition.

For example, the name Peter Morrison has been redacted from the report, but puzzlingly, other names—Greville Janner, Lord Gareth Williams—have not.

Mr David Jones (Clwyd West) (Con): If I may correct the hon. Gentleman, Peter Morrison’s name does appear in the body of the report. It is important that the hon. Gentleman clarifies that, because it is not redacted.

Ian C. Lucas: It appears in one part of the report, but it is also redacted in other parts of it. His name appears in the introduction, I believe, but in the part that relates to establishment figures, his name is redacted.

Mr David Jones: The point I was seeking to make is that his name is not wholly redacted, and since the hon. Gentleman is making a speech that covers very important matters, it is necessary to clarify that point.

Ian C. Lucas: I am grateful for that clarification, but in the chapter that relates to establishment figures, the two names that I referred to are not redacted, whereas Peter Morrison’s name is. It is very difficult to deduce a line of principle to see why someone made that decision. I think we need to have that information

http://www.publications.parliament.uk/pa/cm201516/cmhansrd/cm160322/halltext/160322h0002.htm


 

Back to Vaz – his friends and “charity colleagues”…


vaz-pudrew-and-bercow

^ Purdew, Bercow and Vaz


1473163787_kieth-vaz


Keith Vaz and old friend Stephen Purdew of Champneys:

stephen-purdew

The silken-voiced Vaz and the rougher-sounding Purdew, who is worth in the region of £50 million, are old pals.

exterior-of-champneys-springs-health-resort-near-ashby-de-la-zouch-a7b7hb

Cambridge-educated Vaz says their friendship goes back 20 years, and, indeed, it appears to have started after Purdew’s company took over Springs Hydro in Ashby-de-la-Zouch in Leicestershire (Vaz is the MP for Leicester East).

It was soon publicised that Vaz was among those patronising the gymnasium. Vaz’s daughter Anjali was a bridesmaid when Purdew, 52, married blonde former model Isabele Cave, 30.

Purdew’s son by an earlier relationship, Robert, 19 — who recently did 10 days work experience in Vaz’s office — was best man.

http://www.dailymail.co.uk/debate/article-2016259/Sir-Paul-Stephenson-Champneys-Stephen-Purdew-friends-high-places.html

Stephen Purdew and Isabelle Cave Wedding

Jimmy Savile at Stephen Purdew’s wedding in 2009

Keith Vaz also  attended  Purdew’s wedding where other guests included former News International chief executive Rebekah Brooks, Frank Bruno,  Liam Gallagher, Piers Morgan…

savile and dorothy

Paedophile, member of the establishment, Sir Jimmy Savile O.B.E. with friend Dorothy Purdew O.B.E. of Champneys, a friend and “charity colleague” of Keith Vaz.

b1339f2b-6e2e-4a98-b74b-0806b4317ee4_zps6d41f09c1

vaz d purdew silver

Dorothy Purdew, Vaz and the Silver Star Bus

Champneys Charity bought in 2010.


Esther Rantzen D.B.E.

 keith-vaz-and-esther-rantzen-launch-silver-star-appeal

Keith Vaz and Esther Rantzen – patron of  Silver Star Charity

VARIOUS - 1988

silverstar patrons

vaz cherie silver

Cherie Blair, Dorothy Purdew launching the Silver Star bus

 

article-2487217-1930674500000578-886_634x441

Savile and Blair

 




amitabh-bachchan-poses-samantha-cameron-who-hosted-silver-star-charity-reception-speaker
Amitabh Bachchan poses with Samantha Cameron, who hosted the Silver Star charity reception. Speaker of the House of Commons, Rt Hon John Bercow MP (R), presented the award to Amitabh Bachchan.
Amitabh Bachchan was the guest of honour for a charity event by Leicester-based Silver Star that campaigns to create awareness about diabetes. The actor is the international patron of the charity, known for its mobile diabetes units. The charity event was hosted by Prime Minister David Cameron’s wife, Samantha Cameron, at their office at 10, Downing Street.

Bachchan described David Cameron as “gracious” and “patient” and revealed how Cameron knew him.

“He had heard and knew about me…through the Nanny to his child,” the actor concluded.

Amitabh Bachchan the actor and philanthropist was greeted by British Prime Minister David Cameron at his iconic home at 10 Downing Street.
“….what an honour, a most rare opportunity to be there.  …And a rare visit to the Monarch’s bedroom! Where the to-be- Coronated King or Queen spends the night before the crown is put on,” he added.

NINTCHDBPICT000264362659

Watchdogs facing calls to investigate if cash from Keith Vaz’s diabetes charity, Silver Star was used to pay for sex with rent boys

  • Leicester East MP Keith Vaz set up diabetes charity Silver Star
  • Two £150 deposits paid last month into account by man linked to charity

link

 The charity says its funds were not used to pay the rent boys, but no one has explained why Mr Dragusin paid them.

An associate said Mr Vaz and the Romanian trusted each other. ‘It was always as if Keith was really looking after Daniel, not a normal employer-employee relationship,’ he told The Times. ‘They seemed to be quite close, put it that way, in the sense that Daniel was doing a lot of work for Keith, and Keith was looking after him.’

From 2008 to 2010 he worked as a chauffeur for Express Rent-a-Car. He later became Mr Vaz’s driver, and was occasionally allowed to borrow a ‘fancy car’, said the associate. ‘He was often driving Keith’s car when he was not on duty.

link

 Silver Star deny this and have retained Carter Ruck, firing off letters to several newspapers complaining how unfair it is to have their name linked to this sordid affair. Carter Ruck usually charge £500 an hour. That’s a very expensive law firm for a relatively small charity…

link

 


 

 Vaz’s lawyer: Mark Stephens

330px-mark_stephens_january_2012

Mark Stephens, a solicitor at Howard Kennedy law firm

Since 2011 Stephens has been listed on the SpearsIndices Reputation Management Index as an expert in reputation management, Winning the award in in 2015 and being mentioned in its top category “éminence grise” in 2016.link

– licensed to practise before the Judicial Committee of the Privy Council

(Cherie) Blair attracts a lot of attention in the legal world, just as she did during her time at Downing Street. Lawyers tend to be coy about talking publicly about her. But one of the best known human rights lawyers in the UK, Mark Stephens, a senior member at Howard Kennedy, knows her and prefaces his remarks by saying she is “nothing like the Daily Mail caricature, that she is grasping and slightly bonkers”.

represented Bob Monkhouse who had been “charged with defrauding film distributors in relation to a film and television archive”.

Monkhouse

In his autobiography, he admitted to hundreds of sexual liaisons and affairs, including one with a transsexual, but claimed that he only undertook this course of action because his first wife was unfaithful. 

His lovers before his second marriage included the actress Diana Dors, about whose parties he later commented after her death: “The awkward part about an orgy, is that afterwards you’re not too sure who to thank.”

– Other cases he took on in 1992 involved representing the families of victims of the Lockerbie bombing

  • In 1993 Stephens helped the MP Clive Soley to draft a parliamentary bill on press regulation. Stephens commented that people thrust into the public light needed protection from the press

– represented the leaders of the miners’ strike of 1984–85 and James Hewitt when allegations of his affair with Diana, Princess of Wales first emerged.

In 2010, he represented Julian Assange,

Stephens has sat on many charitable, regulatory, government and academic committees

He has also assisted politicians in their drafting of legislation, in the UK in the 1990s regarding the regulation of the press and in Romania in 2005 regarding freedom of information laws

  • he represented several other artists and art dealers in cases over freedom of expression, including an art gallery that was displaying earrings made by Rick Gibson from human foetuses.

On 23 July 1988, Gibson ate the flesh of another person in public

link

Mark Stephens – Co-trustee of Bianca Jagger Charity – Helena Kennedy

link

Mark Stephens was appointed by Lord Irvine to be a Champion of the Community Legal Service.

link

irvine-rantzen-and-vaz

Lord Irvine and Esther Rantzen.  Keith Vaz photo on back of Community Legal Service brochure

in January 2010, he was appointed to a working group on libel laws, set up by the then Justice Secretary, Jack Straw, which published a report in March 2010

In July 2011, it was reported that Stephens had been one of a group of high-profile lawyers who may have been the victim of the News International phone hacking scandal

https://en.wikipedia.org/wiki/Mark_Stephens_(solicitor)


576125556

Bob Purdew, Jimmy Savile, Stephen Purdew and Dorothy Purdew of Champneys

Savile frequently stayed at Henlow Grange, so much so that a wing at the spa was named after him.

1979205492

A WOMAN has spoken out about repeatedly being molested by Jimmy Savile at Champneys.

link

The nearest Catholic church was the one in Shefford, which was part of the boys home.

Savile regularly visited Shefford home of Catholic boys – the home is near Champneys

Shefford’s St Francis Boys Home abuse inquiry files missing

2 July 2013

link

link

”Jimmy was a regular visitor at Champneys health spa in Henlow, first visiting in the 1960s. He became a close friend of the owners, Stephen Purdew and his mother Dorothy. When a new bedroom wing was opened in 1985 it was named after him.

Stephen Purdew said: ‘He was a very significant family friend loved by everyone.

“Many people in the Henlow area will have very fond memories of this great man. My mother and I will miss him dearly.’”

 

[Farewell to top TV Presenter, Biggleswade Today, 5 November 2011]

https://bitsofbooksblog.wordpress.com/2014/09/11/savile-and-henlow-grange-champneys-health-spa/

link

 


article-2687979-1f4e07bf00000578-265_634x455

Champneys: Stephen Purdew, whose family runs the luxury health spa in Tring

Phone hacking: Keith Vaz links to Champneys spa, behind Metropolitan Police Commissioner Paul Stephenson resignation

Sir Paul Stephenson  is likely to be grilled over his decision to accept hospitality at the Champneys health resort in Hertfordshire, and his connections to Neil Wallis, the spa’s former PR adviser and an ex-News of the World executive who was arrested over the phone hacking scandal last week.

 

Mr Vaz, the Labour MP for Leicester East, has a long-standing connection to the Purdew family, who own Champneys, including charitable and business links in addition to a close personal friendship.

 


World Premiere of Kerala Tourism Film at London’s Saatchi Gallery

September 22, 2010

Kerala Tourism will debut its ‘Your Moment Is Waiting’ global campaign at a red carpet event on Tuesday 21 September, at the Saatchi Gallery to a select audience of London glitterati, literati and business leaders

vaz-and-purdew-plus-2

Dr Venu, Keith Vaz MP, busineman Stephen Purdew and Michelin chef Sriram Aylur

In one of its biggest marketing coups ever, Kerala Tourism unveiled its latest destination campaign film, Your Moment is Waiting, to a star studded audience at the Saatchi Gallery in London.

“It is a bold step for Kerala Tourism to launch the campaign in London to the world’s most sophisticated audience” by Keith Vaz MP

Dr Venu, Secretary, Kerala Tourism who played host to over 150 guests said it was fantastic to see so many celebrities taking the time to attend a Kerala event and endorsing the film.

http://www.indiaprwire.com/pressrelease/travel/2010092262952.htm

eshta_logo

 

vaz-eshta

The latest disclosure centres on Mr Vaz’s links to an exclusive new development in Kerala, southern India, called Eshta. The resort of premium villas and apartments, set in 60 acres of waterways and palm forests, describes itself as “a haven of luxury and decadence” for “the cream of society”.

 

The directors of the development project include Arjan and Mitesh Vekaria, brothers who own Vascroft Contractors Ltd, a company that worked on several state school building projects in London.

Celebrity endorsers of this monument to housing decadence for the “privileged few” are patrons of Keith Vaz’s very own healthcare charity, Silver Star Diabetes.  Bollywood actress Shilpa Shetty and Bollywood legend Amitabh Bachchan

 

Mr Vaz and Dorothy Purdew, the owner of Champneys, have given testimonial endorsements for the 88-page Eshta development brochure. In the document, Mr Vaz praises the “super-quality” project as an example of the growing business potential of southern India, while Mrs Purdew is quoted as recommending Kerala as “the perfect escape”.

eshta-purdew

In January 2007, Mr Vaz launched the Silver Star Appeal, a diabetes campaign, which now has a branch in India and has become the Eshta project’s nominated charity. Donors to Silver Star can enter a competition for the chance to win a“lifetime” villa retreat at the resort.

The charity also has close ties with Champneys. Mrs Purdew is listed as a Silver Star patron and a new mobile diabetes assessment unit has been named “Dorothy” in her honour.

Mr Vaz is understood to have spent one night at Champneys after attending the engagement party of his friend, Stephen Purdew, co-owner of the spa. Mr Purdew is also godfather to one of Mr Vaz’s children, who is believed to have undertaken work experience in the MP’s office.

A spokeswoman for Mr Vaz said he has no financial connections to Eshta or its directors and had “never” received hospitality from the resort or visited Kerala.

http://www.telegraph.co.uk/news/uknews/8646241/Phone-hacking-Keith-Vaz-links-to-spa-behind-Stephenson-resignation.html

eshta-bachan

http://eshtagroup.com/testimonials.html

Amitabh Bachchan – The actor’s name was reportedly mentioned in the Panama Papers that contained details of secret offshore accounts [101]

He was a friend of Rajiv Ratna Gandhi – Prime Minister of India, serving from 1984 to 1989.

 

World Tamils Forum: London Conference, 26 March 2009

Has-been dj Sir Jimmy Savile – speaker??  Who chose him to speak?

Keith Vaz was also a speaker.

image002

World Tamils Forum: London Conference, 26 March 2009

The delegates were addressed by distinguished speakers including American civil rights campaigner Rev. Jesse Jackson and Des Browne MP, the British Special Envoy to Sri Lanka and former defence secretary. Other guests included Lord Falconer, Siobhan McDonagh MP, Simon Hughes MP, Keith Vaz MP and Sir Jimmy Savile.

https://www.tamilnet.com/art.html?catid=13&artid=28854


 


csbbz3gwgaqjwfr

2 male escorts have told how Vaz offered to fly them around the world


Vaz’s wife:

‘He wanted to kill himself twice – once as Europe Minister [when he was embroiled in a scandal over passports] – and again now. He just wanted to die,’ Ms Fernandes said.

link

 via WW:

Vaz’s wife concerned about his mental health? Surely he’s not fit  to be a MP then?

 


 

csbiepnweaaavjq

 

57cd21d1160000ef1bc0096f

Slippery MP smeared with 30 years of sleaze – from expenses scandals to poppers and sex with male prostitutes

6 Sept 2016

Throughout his 29-year political career the veteran MP has been caught up in sleaze and cash scandals

https://www.thesun.co.uk/news/1723784/who-is-keith-vaz-labour-mp-has-enjoyed-political-success-as-well-as-attracting-controversy/

interview20keith20vaz

keith vaz of the rent boys, poppers + brothels, sleaze, dodgy bank accounts, visas and paedo apologist



Revelations about Keith Vaz are “a storm in a teacup” says Peter Tatchell.

link

Peter Tatchell sticks up for Keith vaz. Hmm

tatchell1

tatchell-9

link

Joanna Lumley Patron of Chelsea and Westminster Swimming Clubthe father of paedophile Andrew Picard/Boeckman is chairman of the Chelsea and Westminster Swimming Club

 

Jim’ll Fix It : Keith Vaz and Joanna Lumley


Surprise, surprise: Vile paedophile Slade was mate of Keith Vaz:

HAPC Charity

 

cmskuofxgaep0qj

 

 

Paedophile Derek Slade funded by Keith Vaz

image

Jeremy Corbyn , Keith Vaz and Bob Litherland

 

cshhm0bxgaeuqn6

Keith Vaz prostitution scandal ‘is a private matter’, says Jeremy Corbyn

Jeremy Corbyn won’t suspend Keith Vaz from Labour NEC during investigation

keith-vaz

london-uk-7th-february-2013-labour-backbencher-jeremy-corbyn-member-d34b27

7th February 2013. Labour Backbencher Jeremy Corbyn, Member of Parliament giving a speech after receiving his award for the Labour Backbencher of the year at the Asian Voice Political and Public Life Awards 2013 held in The Member’s Dining Room, House of Commons, Westminster, London. On the left is Valerie Vaz, Member of Parliament.

download

Jeremy Corbyn with his former agent Derek Sawyer

Does  Corbyn’s lenience towards Vaz has anything to do with Sawyer’s relationship with paedophile Derek slade:


cths182wgaa2ipi

 

‘An Abuse of Trust’ 

Derek Sawyer was for a time Jeremy Corbyn’s constituency agent and the programme details the very close relationship Sawyer had with notorious paedophile Derek Slade over many years.

Perhaps, readers should watch Roger Cook’s ‘An Abuse of Trust’ again which highlights Derek Sawyer activities.

link

link

vaz-and-lord-mayor

Keith Vaz and Abdul Osman

(2012) Leicester Lord Mayor (Abdul Osman) was pursued for crimes of Derek Slade at school in Gujarat, funded by Help a Poor Child HAPC

 

709-jon-ashworth-mp

 (left to right) Jon Ashworth MP (former Spad to Paul Boateng, former adviser to Gordon Brown and head of party relations for Ed Miliband),  Councillor Abdul Osman, Liz Kendall MP (she has worked for Patricia Hewitt as well as Harriet Harman. and inheritor of her Leicester West seat, the one previously held by Greville Jannerand Keith Vaz MP

 

Councillor Abdul Osman, 

a founder of Leicester Gujarat Earthquake Relief Fund,

 

is facing claims for compensation from eight boys who say they were sexually abused by Derek Slade while he was their head teacher at a school in India.

 

He said he had helped raise £15,000 to set up the school and had done fund-raising to help it with running costs.

 

The claim the Official Solicitor is bringing is to obtain compensation from the three defendants because it is the victims’ case that the defendants between them “ran” the school, and employed Slade.

link

link

St George’s School/ Derek Slade

 

cywzamvwmaawhvc

Andreas Baader

Derek Slade was Headmaster at time (also of the Help a Poor child charity HAPC & Anglo-Kutchi Medium school in Gujarat):

St George’s School teacher Gerard Singer jailed for sexually abusing boys

9/9/16

Former headmaster Derek Slade, who died in March, was jailed in 2010 for abusing 12 boys, while maths teacher Alan Brigden was jailed for five years in 2012.

 

In 2011 another teacher, Alan Williams, killed himself after being arrested on suspicion of sex assaults at St George’s.

http://www.bbc.com/news/uk-england-suffolk-37312298

 

 

exp7910

image002_0008

Their innocence torn from them , their expectations crippled because of perversion, cruelty, greed and enabling of acts so outrageous upon a child it sickens one and yet it took 30 years for the children to finally be heard.

link




Gerard Singer found guilty of ‘systematically’ abusing boys at St George’s School

Gerard Singer, 69, was found guilty of abusing former pupils at St George’s School, based in Norfolk and then Suffolk, between 1978 and 1981.

‘Awful events’

Suffolk Police began an investigation in 2009 when former pupils of St George’s made allegations about abuse during their time at the school.

Former headmaster Derek Slade was found guilty in 2010 of abusing 12 boys and was jailed for 21 years. He died in March.

Alan Brigden, who taught maths at the school, was jailed for five years in 2012 after admitting 14 sex crimes against two boys.

In 2011 another teacher, Alan Williams, killed himself after being arrested on suspicion of sex assaults at St George’s, when it was at Great Finborough, in the 1980s.

politics-margaret-thatc-006
Sir Keith Joseph, seated next to Margaret Thatcher. Thatcher later referred to Joseph as her closest political friend

 Keith Joseph – St George’s School  at Great Finborough:

  9 Mar 1983:
keith-joseph

Sir Keith Joseph, Secretary of State for Education and Science says he is taking no action against St George’s School at Great Finborough, on the ground that no evidence was provided by those who those who made the original allegations to the BBC Radio 4 Checkpoint programme to substantiate “the few specific incidents alleged, which were directly denied by the headmaster”.

anthony-gilberthorpe-with-mrs-thatcher
Thatcher and Anthony Gilberthorpe

Margaret Thatcher was warned that senior ministers were involved in a child sex ring, a former Tory activist claims.

 I underlined the names of Keith Joseph, Rhodes Boyson and one MP still serving today

hague-and-gilberthorpe
William Hague and Anthony Gilberthorpe

In July 2014, Keith Joseph was named by former activist, Anthony Gilberthorpe, as one of a number of senior Conservative Party politicians who he had seen having sex with boys at cocaine-fuelled romps, in private rooms at seaside conferences. Gilberthorpe claimed he handed a 40-page dossier to Margaret Thatcher, in 1989, detailing Cabinet ministers who took part in the sex parties but says he was warned off by William Hague and a senior civil servant.

bg_w_dl1_imaawqpp
William Hague and Jimmy Savile

link

 

Albany trust Grey & Mrs Sara Morrison

1974: Grey lunches with Sir Keith Joseph & invites Mrs Charles Morrison to become Albany Trust Chair

bitsofbooksblog.wordpress.com/2015/04/11/1974-grey-invites-mrs-charles-morrison-vice-chair-of-the-conservative-party-to-become-albany-trust-chair/


 

britmag_3173793c
Leon Brittan (centre) with Margaret Thatcher, Quintin Hogg Lord Hailsham, Sir Keith Joseph and Michael Heseltine in the 1980s

Chilling day Special Branch swooped to seize ANOTHER dossier on VIP abusers: 16 MPs’ names mentioned in 1984 report on paedophile lobby’s influence in Westminster

Sir Keith Joseph named in Castle’s dossier.

link

link

 


2b0042dd00000578-3181783-image-m-14_1438378525932

In 1992, social workers told Jeremy Corbyn (pictured that year) that organised child abuse was rife in his Islington constituency

  • Social workers warned Corbyn that child abuse was rife in his Islington constituency in 1992 
  • ‘We’d been seeing so many 12 to 15-year-olds who were being sexually exploited, we could hardly believe it,’ Liz Davies, one of the five social workers, recalled this week
  • Corbyn never wrote to Davies, or telephoned, to acknowledge their meeting, or thank her for seeking to blow the whistle 

 

 

Jeremy Corbyn accused of inaction over paedophile scandal

23 Jul 2015

Labour MP John Mann says leadership contender Mr Corbyn “did nothing” about allegations of child abuse in Islington in 1980s

Jeremy Corbyn,the hard-left Labour MP who is tipped to lead the party, has been accused of “doing nothing” over child abuse in his constituency during the 1970s and 1980s.

Dozens of vulnerable children were raped and sexually abused in care homes run by the London borough of Islington.However most of the abusers escaped justice because allegations made at the time by victims were ignored and many files, which contained corroborating evidence, have been lost or shredded.

 

John Mann, a Labour MP, has sent Mr Corbyn an open letter in which he says that his failure to do more to tackle child abuse means it would be “inappropriate” for him to become Labour leader.

In his letter Mr Mann highlights how Liz Davies, a social worker turned whistleblower, visited Mr Corbyn in the early 1990s to raise concerns about paedophiles operating in Islington care homes. Mrs Davies told The Telegraph that she was “heartened” by the meeting, after which Mr Corbyn said he would raise her concerns with Virginia Bottomley, the then Health Secretary.

However she said that while Mr Corbyn has “always treated me very politely” he had not been vocal on the issue. “There’s plenty of scope for apologies and regrets,” she said.

Mr Mann also highlighted an official complaint Mr Corbyn made in the Commons about a visit Geoffrey Dickens, a Conservative MP who repeatedly attempted to expose child abuse, made to his constituency.

At the time he called on Mr Dickens to “unreservedly withdraw his allegations of the existence of child brothels in the area and make a public apology”.

He also highlighted a recent statement Mr Corbyn made in the Commons when said: “There have been complaints about Islington children’s homes in the past and the council has investgated them.”

He said that the statement was “extraordinary” as the council has been accused of suppressing allegations of child abuse in the past. Mr Mann said: “Your carefully worded excusing of Islington Council in the House of Commons equally demonstrates why it is inappropriate for you to attempt to lead the Labour party at the critical time of the

link

 

 

via WW:

How did Henniker get his contract with Islington to run the children’s activity centre?

After Righton’s 1992 conviction, he and his partner Richard Alston were invited to stay at Lord Henniker’s estate in Eye, Suffolk. Righton lived there until his death in 1996. Lord Henniker’s estate was run as a ‘children’s activity centre’, and Islington council had been sending children there for years.

link

Henniker was  Director of the British Council (1968-72).

Charles Napier joined the British Council after his 1972 conviction.

Peter Righton, Charles Napier and Richard Alston abused boys together.

link

Who was protecting Peter Righton; recommending him 4 key roles, writing his references & introductions?

screen-shot-2015-03-03-at-23-05-42

Lady Henniker-Major, a past chairman of Suffolk County Council and former Liberal Democrat Parliamentary candidate

Leon Brittan’s friend, John Gummer (Baron Deben) was the Tory MP for Eye in Suffolk

Sir Peter Hayman’s connections to Save the Children and the International Students House were forged through his wife (not mother) Rosemary Blomefield. Sir John Henniker-Major’s wife Lady Henniker-Major was also ‘very active in the overseas relief and fundraising work of the Save the Children Fund and its Danish sister organisation Red Barnet.” Lord Gore-Booth (of Malty, West Ridings of York), a noted British diplomat and Chairman of The Save the Children Fund 1970 – 1976 wrote Lady Henniker-Major’s obituary.

https://bitsofbooksblog.wordpress.com/tag/sir-john-henniker-major/

 

Raymond Varley

raymondvarley-405779

Fury as child sex beast is FREED after court blunder

2014

THE CROWN Prosecution Service has been slammed after a bid to extradite a dangerous paedophile to India over sex attacks on orphan kids failed.

Convicted sex abuser Raymond Varley, wriggled out of facing justice after two Appeal Court judges upheld an earlier decision that he was a “vulnerable individual” suffering the early onset of dementia.

But prosecutors failed to order their own health assessment of the beast – a key reason why he won his case.

And he is free to contact children and visit schools, nurseries, swimming pools, stay out at night and travel abroad now bail conditions have been scrapped.

 

http://www.dailystar.co.uk/news/latest-news/405779/Fury-child-sex-beast-FREED-court-extradition-blunder

Keith Vaz’s links to Varley are significant as they bring together Goa, Leicester and Islington.

via troy:

Raymond Varley was an international trafficker. That’s why his phony dementia claim keeps him safe from extradition.

 

http://aangirfan.blogspot.com/2014/02/peats-in-goa.html

image1

St George’s School

Kesgrave/Stowmarket: Inquiries into historic child abuse allegations at three former school

04 February 2013

THREE former Suffolk schools are now at the centre of criminal investigations into historic child abuse allegations.

The accusations, which relate to alleged physical and sexual assaults, are said to have occurred between the late 1970s and run through to the 1990s.

Oakwood School in Stowmarket – has said the number of claimants has reached three figures.

Kesgrave Hall independent school – The investigation, codenamed Operation Garford

Two other police inquiries involving the former St George’s School in Great Finborough, near Stowmarket, and Oakwood School are also continuing.

Operation Racecourse (St George’s) has been running since the late 2000s. It has led to the independent school’s ex-headmaster Derek Slade being jailed for 21 years in 2010 for sexual and physical abuse against pupils between the late 1970s and early 1980s.

link

csjfkafxeaam_qf

CORBYN AND CHILD ABUSE

http://aanirfan.blogspot.com/2015/08/corbyn-and-child-abuse.html

Senior Labour politician helped paedophile headmaster establish false identity

link



Dame Alun Roberts CH@ciabaudo

Keith Vaz and Jimmy Savile, two of the closest buddies of Purdew:

bsd6f0viaaa-2ej

1982 Keith Vaz  worked as solicitor for Richmond upon Thames Council (Operation Fernbridge) and for Islington (Operation Fairbank)

Postcards From Jersey To Islington

postcards

To child abuse campaigners, however, these are a smoking gun. For the first time they provide solid evidence that children from Islington’s homes in the 1970s were sent on trips to Jersey, in an exchange programme with children from the notorious Haut de la Garenne home, where widespread abuse took place.

Establishing that children from Islington were indeed sent to Jersey on exchange trips – as has long been claimed – is another piece of the jigsaw that creates a picture of a child abuse ring operating in the UK, with children passed around the country.

It has been established by many independent inquiries that child abuse took place in all of Islington’s 12 children’s homes during this period.

Islington Council has no official records that children in its homes in the 1970s and 80s were ever sent to Jersey on official visits, as all the documents have been destroyed.

link

haute-de-la-garenne

Jimmy Savile with children at Haut de la Garenne

Among those who regularly visited the Haut de la Garenne home was the now-disgraced entertainer Jimmy Savile.

“Jimmy Savile often stayed in the same hotel as Ted Heath,” McGrath Goodman told the dpa news agency, adding that both men were alleged to have taken children from Haut de la Garenne.

http://www.independent.co.uk/news/uk/crime/ted-heath-allegations-jersey-victims-lawyer-says-linking-former-pm-to-child-sex-abuse-like-pinning-10440311.html

via strikeback

I wonder if Lord Henniker’s estate, Thornham Magna, is the “large house in the country owned by a Lord” which Ronald Jebson mentioned in his confession about the South London luxury limousine company with ties to Westminster paedophiles which Sydney Cooke and Savile’s driver David Smith are also alleged to have worked for.
link

 

 

savile-and-philip-for-sale

Lord Henniker has close links with the royal family:

Prince Philip is godfather to his first child.

philip-godfather

link

link

thornham manor.JPG

Quote:
ctjahjswcaa2baw
 168098

“I couldn’t believe it when Ronnie started blabbing. He said he worked for a luxury limousine company on the south side of London. He said it was linked to the Westminster set, and claimed they had all sorts of posh cars, including Rolls Royces.

“He said the clients were all well-to-do, prominent people, including politicians, but said they were also paedophiles. Ronnie said many of the victims came from poor backgrounds.

“He said he often collected the children on a Friday and would take them to a large property in Surrey, to London addresses, or to a large house in the country owned by a Lord.

http://www.dailystar.co.uk/news/latest-news/411704/Babes-child-killer-linked-to-Westminster-politicians-paedophile-ring

 



86976834_child_abuse_investigations_624_v3

Operation Fairbank

http://www.bbc.com/news/uk-28194271

justme@zante03 and crafty muvva:

vaz-no

Really Nige? Not whilst working for NCCL or Labour action group, or reading local papers or being LBRUT SOLICITOR ( ‘London Borough of Richmond upon Thames’)?

proxy1

minster.JPG

As Vaz was solicitor, Minster must have liaised with him following the EGH raid. Police involvement, minors etc

Louis Minster head of social services + KEITH VAZ the council SOLICITOR wld know each other well?

Yes. They worked at the same place at the same time.

Richmond: Minster was there 75 to 84.
KEITH VAZ was there 82

 

Louis Minster – Richmond Social Services, 1975-1984 – news articles.

Barbara Kahan, Peter Righton, Louis Minster and Malta

link



In the House of Commons it was Keith Vaz MP who rose to assure fellow MPs that his old friend was “the victim of a cowardly and wicked attack.” In the same speech Vaz suggested the law be changed so that prominent people could not be accused in open court.

Now, of course, we know very different. The Greville Janner affair was dragged into the open in the face of tremendous official obstruction and indifference. When it finally exploded two years ago one jaw-dropping revelation  followed another. It turned out that  police investigations had been mysteriously derailedthree chances to prosecute had been missed, there had been love letters from Janner to one boy. A second judge even helped Janner in a cover-up. Dozens of former residents of Leicestershire homes for boys came forward to claim that they had been abused by Janner in a scandal that went back four decades.

This fresh scandal will bring a renewed focus on the accusations that swirled around the former president of the Board of Deputies of British Jews (Greville Janner) because of his connection to Keith Vaz.

It is widely known around Westminster that Vaz — who owes his career to Greville Janner — was the unidentified MP in this Sun  front page from last year.

The headline on that Sun front page says “Top Labour MP is paedo” but does not name anyone.

This comes at a pretty unfortunate time for those in the political and legal establishment who wanted the Greville Janner affair buried and out of the way.

http://www.theoccidentalobserver.net/2016/09/why-did-keith-vaz-protect-greville-janner/

Lord Janner detective: We had proof to charge child sex politician 20 years ago… But top brass told us to stop

http://www.dailymail.co.uk/news/article-3055680/Lord-Janner-detective-proof-charge-child-sex-politician-20-years-ago-brass-told-stop.html


Blair, Mandelson, Daniel Janner, Bercow: Interesting that none of these people have come out in support of Keith Vaz.

Yes, indeed. The Janners have been distinctly quiet about the fate of their close friend Keith Vaz.

vaz

Greville Janner, Derry Irvine, Keith Vaz at a reception in honour of Lord Irvine

Keith Vaz was PPS to Lord Irvine who said his PPS was “utterly brilliant”, “the most incredible networker I have ever met”.

This backing from so well connected a source must have assisted Mr Vaz’s rapid ministerial promotion, from parliamentary secretary in Lord Irvine‘s Lord Chancellor’s department to minister for Europe at the Foreign Office.

www.theguardian.com/politics/2001/mar/20/keithvaz

irvine-rantzen-and-vaz

Derry Irvine and Esther Rantzen with Keith Vaz’s picture on back of brochure – Community Legal Service in London

Lord Chancellor Lord Irvine launching the Community Legal Service, a Government initiative to make it easier for people to find good quality legal help and advice throughout England and Wales, by bringing together providers and funders of legal help and advice into co-ordinated, local networks. The Chancellor was joined by Cheri Booth QC and television host Esther Rantzen.…at a conference held at the CBI Conference Centre, Centre Point central London.
4th October 1999

link

lord-irvine-of-lairg-befo-007

Pop superstar Michael Jackson visited the Palace of Westminster on June 14, for a sightseeing trip set to include a meeting with the Lord Chancellor, Lord Irvine,


parlament2

Michael Jackson, Uri Geller, Greville Janner David Blaine and Paul Boateng

The same Keith Vaz with the leak of survivors names who wants anonymity for accused…

Child sex abuse victims got death threats after inquiry published emails

Survivors of historical abuse say committee chair Keith Vaz put them in danger by placing private details on Commons website

http://www.theguardian.com/politics/2015/jan/29/child-sex-abuse-victims-emails-commons-committee

v.s.

Sex crime suspects deserve anonymity

There should be “zero tolerance” of their identities being leaked, unattributed, to the media, it added.

Mr Vaz said: “We have seen how destructive this can be to a person’s livelihood, causing irreparable reputational damage and enormous financial burden.”

http://www.bbc.com/news/uk-31970034



 

Hansard ’91 call by David Ashby & Keith Vaz to change law to stop reporting of abuse claims in court, re Lord Janner

vaz20ashby_zpsbj3eprf5

cddntg0w0aaslvq

Keith Vaz –  Tory MP Ashby ‘lied to cover up his gay affair’

‘They said it was done to reduce the cost of their trip.’

link

Ashby was one of those who helped Harvey Proctor finance his shirt shop.

link


Goa’s bitter experience of pedophilia run rampant

Jan 1 2009

In 1991, India and specifically the resort state of Goa caught the attention of the world for all the wrong reasons

link


The Sunset Meadows development at Betalbatim Goa

The plush mansion is the eighth property owned by the the Keith & Maria Vaz, raising further questions about their personal finances.

sunset-madows-300x153

The Sunset Meadows development at Betalbatim

With only nine bungalows, a swimming pool and a clubhouse spread over six thousand square meters, owning a home in this residency is a privilege to be enjoyed by the fortunate few who understand and appreciate our philosophy of A Whole New Way Of Living.

link

The wife of shamed MP Keith Vaz owns a luxury villa in Goa, bringing the total value of their property portfolio to £4.4million.

Further ­questions raised about the personal wealth of Mr Vaz, who until recently had a salary of £90,000 a year…

Maria Fernandes bought the £400,000 beach resort property in 2007 and the couple have since enjoyed regular breaks there.

One neighbour said Mr Vaz has entertained a number of local politicians and celebrities at the house. Keith and Maria with Bollywood star Amitabh Bachchan

http://www.mirror.co.uk/news/uk-news/shamed-mp-keith-vazs-wife-8829323

 keithvazamitabhpeterjitendramangatibhujangpaigl121011124

Right Hon.Keith Vaz, Member of Parliament, UK and Peter Beckingham, Deputy British High Commissioner invited Amitabh Bachchan on his 7oth birthday to Seven hills hospital in Andheri East and gave him the key of  mobile diabetic van. Vaz also gave art work signed by two prime ministers of United Kingdom to Amitabh Bachchan.

link


 

Keith Vaz bought his £387,500 ‘sex flat’ with cash near family home

Keith Vaz paid almost £400,000 for his “sex flat” through a “personal loan” which was exposed by the Sunday Mirror as where he invited young male prostitutes for sex.

The Labour MP purchased the £387,500 two-bedroom flat in cash, with the price equaling four times his salary.

The lawyer for Mr Vaz says it was purchased using a “personal loan” and land register documents show him to be the sole owner.

His family home, worth £2.2million, is located just a ten-minute walk away.


(2001) COMPLAINT AGAINST MR VAZ BY MR PAUL GOSLING

COMPLAINT AGAINST MR VAZ BY MR PAUL GOSLING

Mr Paul Gosling, a journalist and researcher (and former Leicester city councillor)

had spoken to Mr Alistair McKinnon, a press officer for a company called Ascot which had taken over a business previously trading as Control Securities plc. He added that Control Securities had been a shareholder and landlord of the failed bank, BCCI and that, as a result of the bank’s collapse, the chairman and chief executive of Control Securities, Mr Nazmu Virani, had been “convicted and imprisoned for false accounting.”

Control Securities’ accounts for the year ending 31 March 1992 indicated that the company had made a donation to Mr Vaz.

278.  Mr Gosling said that, in his view, the information provided by Mr McKinnon raised three points of concern, namely:

      (i)  whether Mr Vaz had entered his interest as “Control Ltd” instead of “Control Securities plc” in order to obscure the sensitive issue of the donor’s identity;

(ii)  whether the item in the accounts of Control Securities plc “Mr K Vaz Election Fund” or Mr Vaz’s entry in the 1994 Register “Donation from Control Ltd in 1991 toward the cost of producing a Report/Bulletin for the Asian Community into the work of the Immigration and Nationality Department” was the correct description of the donation;

(iii)  whether the donation to Mr Vaz from Control Securities plc led Mr Vaz to have a conflict of interest when he spoke in the House of Commons about the affairs of BCCI, particularly given Mr Vaz’s leading role in the campaign to secure payment of money owed by the bank to small shareholders and creditors.

…Mr Gosling replied on 29 May 2000 (Annex 9), saying that he did not think it correct to say that it would be easy to identify Control Securities Ltd from the tag “Control Ltd,” and that, whilst people within the company might have known it by that name, the general public did not. He maintained that an improper financial relationship between Control Securities Ltd and BCCI had been demonstrated by the conviction of Mr Virani for false accounting in relation to transactions between the two companies. He added that Mr Vaz should therefore have disclosed his own financial interest in Control Securities Ltd

http://www.publications.parliament.uk/pa/cm200001/cmselect/cmstnprv/314/31415.htm


 


 

 

proxy

 Joginder Sangar and Keith Vaz

Under fire Labour MP Keith Vaz caught on CCTV meeting younger man at London hotel as he battles rent boy scandal

2 yrs ago:  Vaz  met young man in lobby of Washington Mayfair on June 4 2014

(where it’s said he goes for ‘a wash’)

One hotel worker told The Sun the father of two (Vaz) would often arrive at short notice and sometimes with young men.

He said: ‘Keith Vaz would often arrive at very short notice.

‘Sometimes there were other young men with him.

‘There were a number of times when he didn’t stay the whole night. He would stay for just a few hours before checking out’.

According to The Sun a receipt from that night shows the MP has a dinner of lemon sole washed down with J&B whisky and a bottle of still water, costing £54.95.

The paperwork reportedly has the note ‘As per Mr J. Sanger’ at the bottom, a reference to Indian multi-millionaire Joginder Sanger, who owns the hotel.

http://www.dailymail.co.uk/news/article-3775550/Keith-Vaz-s-brief-encounter-young-man-London-hotel-Scandal-hit-MP-seen-CCTV-enjoying-half-hour-rendezvous-four-star-establishment-s-said-goes-wash.html

Keith Vaz immigration & asylum is big money for his best mate £m Joginder Sanger his chauffeur Dragusin his wife Maria Fernandes

491351
Multi-millionaire Joginder Sanger who knows Keith Vaz socially and Prince Charles.

Joginder Sangar and Prince Charles are part of The Bhavan charity:

THE BHAVAN UK HONORARY LIFE MEMBER

  • His Royal Highness, The Prince of Wales, Prince Charles

Joginder P. Sanger – Chairman


BBC Interview with the ‘Asian of the Year 2011’ Joginder Pal Sanger, and Keith Vaz, one of the judges which took place in Dorchester Hotel in London on 21st November 2011

link

Keith Vaz – patron of Gingerbread charity for single parents 1992-

gingerbread

link

Following a merger with One Parent Families in 2007 it was briefly known as “One Parent Families|Gingerbread” before relaunching as Gingerbread in January 2009.

J. K. Rowling, formerly a single parent herself, is the charity’s President.[1]

 

In 1979 the organisation jointly produced a report with the Community Development Trust. Among other things, the report called for the abolition of the age of consent

link

https://gingerbread.org.uk/content/442/Our-history


Can Vaz REALLY stay on as an adviser to the Queen?

queen-elizabeth-ii-meets-backbench-mps-gba8y3_zpsostabdao2

Disgraced MP still holds posts on the Privy Council, national security committee and Labour’s NEC

  • Vaz quit his powerful committee job yesterday amid the rent boy scandal 
  • But he still has a series of high profile jobs in and around Parliament 

Other senior posts Vaz holds in public life:

The Joint Committee on the National Security Strategy (JCNSS)

Paul Boateng also sits on the JCNSS Committee

Keith Vaz Affiliations

He is an officer of:

Related Sourcewatch

 

185712197-britains-prince-charles-meets-politician-gettyimages

24th October 2013 –

Keith  met with the Prince of Wales and The Duchess of Cornwall ahead of their trip to India and Sri Lanka.

Their Royal Highnesses hosted a reception for members of the British Indian and Sri Lankan communities at St. James’s Palace.

In their most extensive visit to India to date, The Prince and The Duchess travelled to Dehradun, New Delhi, Mumbai, Pune and Kochi where they met India’s top political, business and cultural leaders.

link

link

link

link

….The executive director of Silver Star, Hanif Pathan, is a friend and former employee of Vaz, who was embroiled in the Hinduja passport affair. Vaz was investigated by the parliamentary commissioner for standards between 2000 and 2001 after it was alleged that he may have benefited from money paid by the billionaire Hinduja brothers who were trying to gain British citizenship. Pathan, who was then a director of a company that received cash from the Hindujas, was accused of being evasive to a parliamentary investigation.

link

link


joginder-sanger

Revealed: the asylum tycoon

5 October 2004

A multi-millionaire is at the centre of an inquiry into a missing three-year-old boy. Joginder Sanger and his family own the hotel where Rossi Matuvovo disappeared, in a case that has raised new fears about child trafficking in London. Scotland Yard has no idea where the boy has gone.

Inquiries by the Evening Standard have revealed that the owners of the Thornecliffe Hotel were paid an astonishing £4 million of taxpayers’ money last year to house asylum seekers at their bleak 400-room establishment.

It is a world away from the lifestyle enjoyed by the Sanger family, who have a 4.5 million home in Hampstead, with two Mercedes, a convertible Jaguar and a Lexus four-by-four in the drive. The hotel is a cornerstone of the Sangers’ business empire.

The family  also own the four-star Washington Hotel in Curzon Street, Mayfair.

Sunita Sanger, a director of the family company, told the Standard she was not concerned with the missing boy’s welfare. She said: “How am I supposed to keep track of every single little thing that happens down there? I am not interested.

The family reported more than 11million gross profit from three main businesses – the Thornecliffe, the Washington and property interests.

Yet their holding company, Mastcraft Ltd, has paid no tax in Britain for the past two years despite an income of 19million last year. Challenged by the Standard to discuss his business and the case of the missing boy, Mr Sanger refused to comment and ignored numerous phone calls.

http://www.standard.co.uk/news/revealed-the-asylum-tycoon-6943075.html

link

“Joginder Sanger is a prominent social worker deeply involved in fund raising activities of a large number of charitable, social and religious organisations.”

http://articles.economictimes.indiatimes.com/2007-02-12/news/28461187_1_uk-hoteliers-first-hotel


2009: Romanian MP Marian Florian Săniuţă invited to UK seminar on HUMAN TRAFFICKING by Keith Vaz

http://www.cdep.ro/bperm/2009/F4683-mem._2.pdf

cseg7tpxeaaha_h

 

romanian_1725835c

A gang of Romanian gipsy child-snatchers stole almost 200 poor children from their families and brought them to Britain to pick pockets, a court heard.

27 Sep 2010

The leaders of the group are identified in the court documents as Constantin Radu, Nicolae Schian, Tase Dumitru – nicknamed “Chinezul The Chinese”, Mircea Niculae and Gheorghe Ion Dragusin. (related?)

http://www.telegraph.co.uk/news/worldnews/europe/romania/8027694/Romanian-gipsy-gang-snatched-200-children-from-homes-to-use-them-as-beggars.html

Project Spade – 

November 14, 2013

Police allege Brian Way, 42, had been running an “exploitation movie, production and distribution company” called Azov Films since 2005, and had made more than $4-million from the business.

Through his company, the man would allegedly contract people to create child porn videos involving kids, largely boys, between the ages of five and 12. Many of those videos were allegedly shot in Ukraine and Romania

link

Many of the site’s bestselling videos focus on a group of young boys in Eastern Europe. Police ultimately determined they were in Romania and Ukraine — and that they were being exploited for profit. The Romanian children were recruited from karate schools across the northern region of the country.

“Parents were being told their kids were going on karate trips, and they were being allowed to drink, do drugs, watch pornography and have naked videos made of them,” says Belanger.

link

A Project Spade –  global investigation into buying and selling child abuse images online has led to 13 arrests and 11 convictions in Wales, a BBC investigation has found.

The NCA has referred itself to the Independent Police Complaints Commission (IPCC) over its own delays in relation to Project Spade, while referrals from other forces are currently being assessed by the police watchdog body.

North Wales Police’s handling of its cases is also being looked at by the IPCC. The force was given the names of three possible paedophiles by the NCA but did not act on them for a year.

link

http://aanirfan.blogspot.co.uk/2015/02/hampstead-azov-banks.htmlhttp://aanirfan.blogspot.co.uk/2015/02/hampstead-azov-banks.html

Keith Vaz : “Pigskin”, “Juicy”, a gay reality TV star and another former aide, Dan Irimia.

10 Sept 2016

Last night it appeared that the MP’s links with various Romanians may have played a central role in his downfall..

They include his Romanian personal assistant Daniel ­Dragusin, who paid the rent boys, and Mr Dragusin’s flatmate Maria Costache, who worked at the London hotel where Mr Vaz met another young man, as well as fellow Romanians known as “Pigskin” and “Juicy” and a gay reality TV star.

The 29-year-old — nicknamed Pigskin by friends back home — was also used by Mr Vaz as a chauffeur.

Mr Dragusin’s flatmate Maria Costache is an executive at London’s four-star Washington Mayfair hotel and is

also the sole director of D&M London Cleaning Services, where Mr ­Dragusin and his father Marcel have worked in recent years.

Just three weeks ago Mr and Mrs Vaz flew to Romania where he was a godfather — a traditional role in Romanian weddings — when another former aide, Dan Irimia, got married.

Mr Irimia’s name has appeared in the official House of Commons register of members’ interests as Mr Vaz’s “researcher” or “secretary”.

Another guest was the bride’s brother Ciprian Serban, nicknamed “Suculet” or Juicy in his home town, as well as bisexual reality TV star and model Bogdan Vladau. He too has moved to London.

https://www.thesun.co.uk/news/1758155/the-downfall-of-controversial-mp-keith-vaz-whose-slimy-reputation-finally-caught-the-better-of-him/


  • Silver Star employee Daniel Dragusin paid for Keith Vaz’s rent boys
  • Vaz founded the diabetes charity in 2007. He first met Dragusin in 2010  
  • The organisation then employed Dragusin, even though he had no apparent experience in either the charity or the medical sector
  • Silver Star has refused to comment how Dragusin came to join its payroll

Why did a diabetes charity decide to employ a chum of Keith Vaz who had no apparent experience in either the charity or the medical sector?

Dragusin studied car mechanics at technical college in Transylvania. He’d worked largely as a chauffeur since coming to the UK in his mid-20s. His only other professional work (aside from assisting Vaz) was in the construction trade — helping out his father and brother, who run a London building company.

Silver Star charity – Its finances are equally mysterious. The organisation’s last published accounts, for the 12 months to December 31, 2014, show that it spent £160,680 during the course of the year. However, only nine per cent — £14,968 — was ‘direct charitable expenditure’.

Of the remaining £145,000, some £21,377 was spent on ‘fundraising’, while £10,381 went on publishing its ‘Globe newsletter’ — which is often festooned with images of Mr Vaz. A total of £81,990, was spent on ‘wages’.

It’s a similar story during each one of the four years for which records are available. During that period, Silver Star has spent £393,099, of which just 11.8 per cent, or £46,052, was ‘direct charitable expenditure’.

Over the same period, a greater sum appears to have been spent on ‘fundraising’. It adds up to £78,573.

Perhaps most intriguing, in the context of Dragusin, is the fact that Silver Star’s ‘wages’ bill has increased dramatically in the years during which he has been involved. In 2011, it was £52,329. In 2012, the year he joined, it went up to £60,789. By 2013 it was £70,176 and in 2014 it was £81,990. At least some of this cash is presumably finding its way into the Romanian aide’s pockets by way of a salary.

link

 

 

methode2ftimes2fprod2fweb2fbin2f4d0ec10c-746b-11e6-b82c-4a7c4fea6596

Keith Vaz and Daniel Dragusin

Mystery of mechanic who became aide at heart of Vaz sex scandal

The man who allegedly paid £150 to Keith Vaz’s male escorts has been working as the MP’s chauffeur and personal assistant.

A woman, Maria Costache, Mr Dragusin’s flatmate is an executive at London’s four-star Washington Mayfair hotel, living at the same address as the assistant works at the hotel (The Washington Mayfair) where leaked CCTV footage yesterday showed the Labour MP Keith Vaz meeting a young man.

Both of them have enjoyed rapid rises after coming to Britain. Mr Dragusin even served as a parliamentary assistant…

vaz-mechanic

link

vaz1-large_transedjtm7jpzhsgr1_8apewqa1vlvhkmtvb21dmmpqbfes

Keith Vaz, the charity worker and the mystery of their trips to India

Keith Vaz travelled to Goa in India with the Romanian charity worker and parliamentary aide alleged to have paid two male prostitutes on the Labour MP’s behalf.

A photograph published on the Facebook page of Daniel Dragusin shows the Romanian sitting on a beach in Goa with a plastic bag emblazoned with the Portcullis emblem of the Houses of Parliament at his feet.

The photograph is stamped with a February 13, 2011 date

Dragusin is listed on his LinkedIn page as Silver Star’s London coordinator and states that he began working for the diabetes charity in April 2012.

Mr Vaz, was there at the same time, according to his own website and local newspaper reports, meeting prominent Indian politicians and visiting the Silver Star charity which he founded and for which Mr Dragusin works

The charity has refused to say whether Mr Vaz recommended him for the post. But in 2012 and early 2013, Dragusin is also listed as a parliamentary aide to Lord King of West Bromwich, a good friend of Mr Vaz.

The unpaid role entitled Mr Dragusin to a parliamentary pass allowing him unfettered access to the Palace of Westminster.

On Wednesday a close friend and parliamentary aide of Lord King, Robert Page said he had no recollection of Mr Dragusin ever working for the Labour peer. 

Roger Page,  was Lord King’s parliamentary aide from 1999, when he was ennobled, to his death from a heart attack in January 2013.

Lord King’s daughter(-in-law), Nishpal, said she also could not recall Mr Dragusin working for her father

Other photographs on 31-year-old Mr Dragusin’s Facebook page show him on the House of Commons terrace with Mr Vaz in August 2011, about eight months before he started working with Silver Star.

(

Interesting. Keith Vaz had a laptop stolen from Parliament in 2011)

vaz2-large_transrp36ti1mfcyr8pmus2fhb17hoduspm84eyl8thpmrlk

Subsequent photographs show Mr Dragusin in the House of Commons with Patrick Viera, the World Cup winning French footballer in November 2011 at a parliamentary function.

Esther Rantzen and Patrick Viera – Childline

 

arsenal-players-with-esther-rantzen-g6fxx7

Esther Rantzen teamed up to launch Arsenal’s first ever Charity of the Season partnership.

26th August 2003

The Gunners have chosen ChildLine.

Arsenal captain Patrick Vieira added: “The wellbeing of children and young people is so important and that’s why ChildLine’s work is vital as it gives youngsters a platform to discuss and overcome their problems.”

In May 2010, Vieira was nominated Goodwill Ambassador of the Food and Agriculture Organization of the United Nations

http://www.standard.co.uk/sport/wenger-joins-up-with-esther-6952302.html)


As recently as April this year, Mr Dragusin posts from the King Power stadium where he watched Leicester City, the team of Mr Vaz’s constituency, play West Ham.

The newspaper alleges that on August 24 this year, a bank account nominated by the two male escorts received a deposit of £150 from Mr Dragusin’s account.

The money was paid 24 hours after Mr Vaz, the former Home Affairs select committee chairman who has resigned from the role, had agreed to pay £150 for a night with the men.

http://www.telegraph.co.uk/news/2016/09/07/keith-vaz-the-charity-worker-and-the-mystery-of-their-trips-to-i/

 

 


Murdered Hindu priest led ‘double life’

Keith Vaz, the MP for Leicester East, had known Mr Purohit for 15 years

24 Oct 2000

Harish Purohit, 42, a “flamboyant” priest and the president of the Hindu Federation and Secretary of the National Association of Hindu Priests. :

Mr Purohit, a part-time care worker, was last seen on Thursday at 11pm when he left home in the Belgrave district of Leicester for a night out, driving his silver BMW 320i car

Mr Purohit was sometimes known for his outspoken views and was an associate of Keith Vaz, the Labour MP for Leicester East. He worked in social services at Leicester city council until 1998 and since then had been unit manager for a day centre in Milton Keynes, Bucks, working part-time with adults with learning difficulties.

link

link

Dean Riddell jailed for life at Nottingham crown court for the murder. He said Purohit tried to rape him.

https://www.theguardian.com/uk/2001/jul/10/drugsandalcohol.taniabranigan

 

cqt60guweaalzaj



In the 1990s Vaz intervened on behalf of a Nigel Philpot-Jones who ran the ‘rent boy’ scene in Leicester

Reading this, I have a distinct feeling that Philpot-Jones had enough dirt on Vaz to blackmail him into helping him!

https://www.thesun.co.uk/news/1766704/police-reportedly-investigating-claims-keith-vaz-threatened-council-worker-who-tried-to-evict-a-rent-boy-pimp/

csjcyl1wiaapsvf

csjbq9kwgaavbta

NINTCHDBPICT000265896993

Nigel Philpot-Jones

VAZ PIMP AID PROBE

Police reportedly investigating claims Keith Vaz threatened council worker who tried to evict a rent boy pimp

12 Sept 2016

 

Shamed Labour MP Keith Vaz allegedly told housing chief he would make his life ‘impossible’ unless pimp was allowed to keep his home – despite not paying £1,400 rent

The disgraced Labour MP intervenedwhen gay brothel owner Nigel Philpot-Jones was booted out of his Leicester council flat 25 years ago for rent arrears.

 

Ex-councillor Paul Gosling told The Sun he was quizzed by police in March about the MP’s behaviour in the early 1990s.

He said: “On many occasions Keith Vaz interfered with the running of the council in ways that breached his responsibilities as an MP.

“In particular I was unhappy about his involvement in reversing the decision to evict Nigel Philpot Jones, who had not paid his rent and was also operating a gay brothel in breach of the council’s clear rules on tenancy.

Vaz had been brought into the eviction row by his friend Philip Taylor, son of a former mayor of Leicester and himself homosexual. Mr Taylor was also a friend of Philpot-Jones.


npj


Mr Gosling also claimed the MP (Vaz) was believed to have been a regular visitor to the Philpot-Jones council block address. Philpot-Jones was involved with procuring male prostitutes


 

 

2375f9be-bcaf-4726-95a0-4e1f8d2bb3ad-large

David Anthony Taylor

a very devoted politican as the councillor for the Braunstone ward for 35 years, his first love was music and he was a professional entertainer in the 50’s and 60’s touring in clubs throughout europe.He married our mum Margaret Batty on 18th December 1965 at St Matthew’s Church, Leicester.He devoted a lot of time to voluntary work and served on the committees of many local charities.

In 1989 he was the Lord Mayor of Leicester and although they had been divorced for over 10 years, our mum Margaret was his Lady Mayoress. He later said that this was one of the best years of his life and together with meeting the Queen, Princess Margaret and the Duke and Duchess of Kent, he was able to host a reception for the athletes from the special olympics that were held in Leicester that year.

http://www.family-announcements.co.uk/localworld/view/1131377/david-anthony-taylor

david20taylor

David Taylor

Died: September 1996 aged 55 (Labour Party)

Dave Taylor was first elected for North Braunstone ward in 1971 and became a County Councillor for the same ward in 1974. He was an active in the field of Social Services. In 1978, a charge of indecency was brought against him, though he was found not guilty. His political career survived and he became Lord Mayor 1989.

Because of his links to the world of entertainment, he was known as the showbiz mayor, as he had worked as a cabaret singer and dancer. Eventually, his drinking took a toll on his health.

Sources: Leicester City Council, Roll of Lord Mayors 1928-2000, author’s personal knowledge


On This Day: 25 Years Ago

February 25, 2014 (1989)

Leicester’s next Lord Mayor, 48-year-old David Taylor, has chosen the woman he divorced 10 years ago to be his Lady Mayoress, it was revealed this afternoon.

Mr Taylor has remained friendly with his ex-wife, Margaret.

He has spent the last 20 years in showbusiness and says: “We are civilised people and are still good pals. We go out together quite often.”

Mrs Taylor, the manageress of the electronic message service Air Call, in Leicester, was in London today and unavailable for comment.

 both a city councillor and a county councillor – will find few problems in stepping into the city’s top civic spotlight.

Mr Taylor – who is

He was, until recently, the marketing director for a Leicester night spot, Starlight 2000, and made his debut in the world of entertainment at the age of 12, at the Aylestone and District Club.

He hit the headlines when, as 18-year-old David Anthony, in 1958, he appeared on TV’s Bid For Fame talent show as a vocalist. By then, he had made a name for himself in Leicester’s working men’s clubs.

Mr Taylor, who lives in Nutfield Road, Leicester, has represented North Braunstone since 1971.

 http://www.leicestermercury.co.uk/day-25-years-ago/story-20695799-detail/story.html#SV6Hzgpxk0D7zMZ5.99

Context – 1989 Leicester

1989 A former resident of one of Beck’s children’s homes makes allegations of abuse and a major inquiry is launched.

greville-janner-lord-janner-of-braunstone-meeting-hm-queen-elizabeth-emyn7j

Greville Janner, Lord Janner of Braunstone meeting HM Queen Elizabeth II. Leicester 1989

link

 


 

KEITH VAZ AND THE SORDID ELEMENT OF LEICESTER

https://scepticpeg.wordpress.com/2016/09/06/keith-vaz-and-the-sordid-element-of-leicester/


csfhnt-xgaazutd

Keith Vaz And The Curious Case Of His Ex-Con Pal Nigel Philpot-Jones

Vaz lobbied for:

Nigel Philpot-Jones

“When I came to Leicester I basically controlled the gay scene. People know I have been in prison for sex offences. I was accused of all sorts of being a drug dealer and running rent boys. 

…I still say I owe Keith a great deal.”

Keith Vaz And The Curious Case Of His Ex-Con Pal Nigel Philpot-Jones

cshjggbweaacw_u


Allegations Keith Vaz intervened in eviction of council tenant suspected of running brothel probed by cops

11 Sept 2016

Police are investigating whether disgraced Labour MP Keith Vaz had links to an alleged brothel owner.

Officers were probing claims Vaz intervened in the eviction of a tenant suspected of providing “the services of young men for other men”, according to a witness who has given a police statement.

They are examining potential abuse of office and personal misconduct dating to 1991, when a witness complained about Mr Vaz’s attempt to overturn the council eviction, it was reported.

Former Labour city councillor Paul Gosling, who has given police a statement, said Nigel Philpot-Jones ran a suspected brothel at a council block, Oriel House.

It is not known whether Mr Vaz was aware of this, but Mr Gosling said he acted in a bullying, inappropriate manner in trying to get Mr Philpot-Jones’s eviction, over unpaid rent, reversed.

link

vaz-philpot-jones

Dame Alun Roberts CH ‏@ciabaudo

The housing officer threatened by Vaz seems to have fallen up the career ladder.

A boss, Ged Lucas, the council’s former deputy chief executive,  at cash-strapped Stockport council was paid £357,000 last year, a report has found.

 

link

link


Vaz’s crooked race lawyer pal struck off: Victory for the Mail as conman is found guilty of 104 breaches of rules

ONGOING MONSTROUS COVER-UP OF MS. SEVEN’S CASE
14th September 2014
Distribution:
Shaun Wright, South Yorkshire Police and Crime Commissioner
David Crompton,Chief Constable

 

link


Keith Vaz is to be questioned over £15,000 worth of donations made to his election campaign

“Mr Milne saw a young man from Mr Vaz’s office collect envelopes of cash for the MP”.

 

http://www.telegraph.co.uk/news/uknews/1321060/The-trail-of-suspicion-that-led-Vaz-to-the-moment-of-truth.html

^ LazerLight ‏@Lazer_Light23

Interesting to see Sarosh Zaiwalla employed Blair in the 1970’s Shipping Sarosh involved into claims re money to Vaz

http://www.thelondonmagazine.co.uk/people-places/interviews/sarosh-zaiwalla.html

Tony Baldry  told to apologise to MPs after recommending that a lawyer, Sarosh Zaiwalla, who had lent him  £5000 should be awarded a CBE.

link

via WW:

Tony Baldry ex mp also involved with some of Vaz’s dodgy

dealer counterparts :

link

http://www.telegraph.co.uk/news/politics/11361128/Why-Im-standing-down-from-Parliament-Sir-Tony-Baldry-MP-for-Banbury.html

another poi?

bercow-and-baldry

 Baldry is a freemason.

Personal assistant to Margaret Thatcher.

Parliamentary Private Secretary to John Wakeham

Baldry – Second Church Estates Commissioner

his predecessors…

Sir William van Straubenzee was Second Church Estates Commissioner from 1979 until 1987 when he retired from Parliament.

Baldry also member of general synod

The Second Church Estates Commissioner is ex officio a member of the House of Laity of the General Synod and so as it happens, I am the only Member of Parliament on General Synod and the only member of General Synod in the House of Commons.

http://www.tonybaldry.co.uk/2011/12/01/tony-baldry-speaks-about-his-role-as-second-church-estates-commissioner/

link

link

vaz-le-cercle

obama_rezko_auchi_080416_mn

The main thing to note right now is Keith Vaz’s links to Nadhmi Auchi; couple this with the fact that Auchi was also pivotal in Barack Obama‘s rise to power.

1. The very conservative Lord Norman Lamont worked for, or at least with, Nadhmi Auchi.

2. Lamont also chaired Le Cercle.

3. Auchi is one of only a hundred people who attends high-level meetings of Le Cercle.

4. Auchi also funneled millions of dollars to the then-unknown Barack Obama — who, with amazing rapidity, rose to become president of the United States.

LE CERCLE WAS A PRIMARY MECHANISM FOR ARRANGING EVENTS THAT LED TO 9/11

https://www.facebook.com/permalink.php?story_fbid=10157363029895032&id=697345031&pnref=story

Keith Vaz was a director of the company General Mediterranean Holdings’ owned by the Anglo-Iraqi billionaire Nadhmi Auchi, who had in the past hired British politicians Lord David Steel and Lord Norman Lamont as directors.

 


KEITH VAZ DOES NEARLY EVERYTHING

Timeline

https://scepticpeg.wordpress.com/2016/09/04/keith-vaz-does-nearly-everyting-even-selling-washing-machines/


Vaz’s charity Silver Star attended over 750 separate venues in major towns and cities of Britain, India and Tunisia

Mr Vaz has also launched the UK-Tunisian Parliamentary Friendship Group on 29 October 2015 during a ceremony held at the House of Commons with the participation of the Heads of the two Tunisian Parliamentary Groups and members of the Tunisian Diaspora, and plans to extend his charitable programme to Morocco and Algeria over the coming years.

link


Tunisia – Harvey Proctor

pe180987

 

‘s travel itinery

cse5oq2xyaaqgzx

Bercow & Vaz

csgjcibw8aandds

https://londra.mae.ro/en/node/396https://londra.mae.ro/en/node/396

Loyalty or flawed judgement? Keith Vaz and the Janner child sex abuse investigation

 


330px-grindr_logo_yellow

Grindr/paedophile rings/chemsex child porn parties/St Benedict’s School/Vaz

A recording appears to show Mr Vaz speaking to them, telling the escorts ‘Bring poppers’ … ‘we need to get this party started’ and tells them to ‘look on Grindr’.

http://metro.co.uk/2016/09/04/keith-vaz-steps-down-after-sex-with-male-prostitutes-is-revealed-in-sting-6108226/

peter-allott

Grinder was the site used by convicted paedophile Peter Allott of St Benedict’s School. (Chris Patten, Laurence Soper etc)

chris-patten-patron-small2

Deputy head at a prestigious Catholic school, Peter Allott spent his weekends at chemsex child porn parties with paedophiles he met on Grindr, a court heard. He spent up to £600 a week on Class A drugs and was addicted to child sex images whilst teaching at St Benedict’s School.

Judge Peter Hillen said: It was at the drug parties that you became aware of, and addicted to, indecent images of children. I use the phrase of a PAEDOPHILE RING, that’s precisely what that was.

Paedophile Peter Allott left for a year in 2011 to work as a research associate for a project on the Prime Minister David Cameron’s “Big Society” initiative and Catholic social teaching at Cambridge University.

Michael Shaw, for the prosecution, said: “In interview he stated he engaged seeking homosexual company through an online dating site called Grindr which involved him meeting other men who engaged in taking Class A drugs, normally crystal meth.

In order to attract them he would raise the question of child abuse. If they expressed an interest he offered to show them images he had.

On the hard drive he had a selection of images of different sexes and ages he showed prospective partners on the basis it would arouse them.

Allott admitted possessing 25 “grossly offensive” images on a hard drive and sharing them with other offenders on the Zoom photo and video sharing programme.

Scandal-hit St Benedict’s School and its linked Benedictine monastery, Ealing Abbey, were also condemned in 2011 for a “lengthy and cumulative failure” to protect pupils after five monks and three former teachers were linked to child abuse.

link

link

link

Former Conserative Colwyn Bay councillor John George Reaney , 50, of Llanelian Heights, Old Colwyn, accused of sexual activity with a boy of 14.

The jury was told that, at some point before June 29, 2015, the defendant had met the boy on gay sex website Grindr.

http://www.dailypost.co.uk/news/north-wales-news/ex-colwyn-bay-councillor-child-11283365

John George Reaney  – Secretary for  RHYL YOUTH ACTION GROUP LIMITED

https://beta.companieshouse.gov.uk/company/06395882/officers

RHYL YOUTH COMMUNITY HUB

https://beta.companieshouse.gov.uk/company/08377526/officers

 


 


justme ‏@zante03

Was Keith Vaz thrown under bus to take heat off this?

 

  • 4 Sep 2016

“A close confidant of Reader said: “It was a shock for the gang when they found photographs of a famous ­politician abusing children.

 

Secrets of Tory abuse cover-up that made even criminal gang sick

 

http://www.mirror.co.uk/news/uk-news/hatton-garden-secrets-tory-abuse-8762865#rlabs=1%20rt$category%20p$6%20%E2%80%A6

cid-officers-outside-lloyd-bank-following-the-discovery-of-the-robbery

Bank job that opened the door on a royal sex scandal

 

  • 16 Feb 2008
  • 2 Feb 2012

…as they tunnelled into the vault of the Baker Street branch of Lloyds Bank, they had no idea they were about to spark a secret service cover-up and claims of a royal sex scandal.

Despite massive interest in the crime, details about the loot and the criminals responsible were immediately suppressed by MI5 and senior government officials.

Speculation quickly arose that compromising sexual photographs of the Queen’s sister, the late Princess Margaret, had been uncovered in the bank vault. It was rumoured they had been stashed away by well-known underworld figure Michael X. A drug dealer and Black Power leader, he was convicted of murder and hanged in Trinidad in 1975. A government file on him will remain closed until 2054.

The Mirror can for the first time reveal that Fleet Street editors of the day were approached directly by senior government officials and told to drop the story.

The four men caught, charged and convicted of the raid went to jail without ever having their names mentioned in the press, and to this day their identities and the circumstances of their capture remain secret. Even the lengths of their sentences are still shrouded in mystery.

Now, one of the men, in his 70s, has spoken to the Mirror from his home in Europe. The ex-gang member said he was terrified to discover one box belonged to the-then head of the judiciary.

Closed for 100 years FOI decision date 2015

hatton garden closed

edward-heath-margaret-tha-009

Former lord chancellor Quintin Hogg (right) with Edward Heath, prime minister, and Margaret Thatcher, education and science secretary.

He said: “It was owned by Quintin Hogg, the Lord Chancellor.

When we opened it we dropped it on the floor like it was a time bomb. We didn’t want to take anything that might give us extra trouble so we left it. All we wanted was cash and jewels.”

But the gang didn’t have time to go through all of the stash and ended up taking some sensitive material.

The ex-raider, who refused to be identified, said last night: “When we got out we realised we had a lot more than we’d bargained for.”

At the time of the robbery, in September 1971, Princess Margaret’s marriage to the Earl of Snowdon was in its final stages.

In the 60s and 70s she was known to party hard on the Caribbean island of Mustique, where she was famously pictured with lover Roddy Llewellyn, a landscape gardener 17 years her junior.

She is said to have taken snaps of male friends frolicking naked but it is not known if any were ever taken of her. Asked whether he thought pictures might have existed, her cousin Lord Snowdon said recently: “I’d have thought it unlikely.”

But when we asked the ex-raider he refused to deny the rumours. He said: “I can’t talk about that. But we did find a lot of guns.

And what was most disturbing was the child pornography we found.

We were disgusted and left it in their open boxes so police could trace the owners.”

http://www.mirror.co.uk/news/uk-news/bank-job-that-opened-the-door-on-a-royal-293740


Misc -Quintin Hogg’s daughter

dame-hogg

Dame Justice Hogg stunned experts and ignored pleas from social services when she handed little Ellie Butler back to her parents

Dame Mary Claire Hogg, comes from a famous legal and political dynasty; she is the daughter of former Lord Chancellor Lord Hailsham and sister of former agriculture minister and fellow QC Douglas Hogg.

3583a48b00000578-3600545-image-m-10_1466520374237

Dame Mary Claire Hogg, DBE (15 January 1947), is a British lawyer and former High Court judge. She is the daughter of Quintin Hogg, Baron Hailsham of St Marylebone and his wife, Mary Evelyn Martin, and is the sister of Douglas Hogg.

…she has been a High Court judge in the Family Division since 1995 and was a member of the council of the Children’s Society for five years before that.

1990 – 1995              Church of England’s Children Society Home Office*

She retired from the High Court in 2016, 6 days prior to the beginning of the trial of Ben Butler for killing his daughter, whom she had previously exonerated despite advice from his local council not to.

Butler employed the dubious services of the now disgraced PR guru, Max Clifford

Oct 2012: Lady Justice Hogg Delivers Bombshell Judgment

The language of the judgment was so gushingly in favour of Butler that sources at the local authority admitted to being “shocked”, particularly at the suggestion that there could have been an “innocent explanation” for what had happened to Ellie.

Brushing his lengthy criminal record, including a number of convictions for violence aside, the judge commented on how impressed she had been by him.

She even commented on the fact that none of his convictions for violent behaviour had been directed towards children.

The judge stated: “He came through as a reflective, thoughtful individual, who at times over-reacts through frustration.

Mrs Justice Hogg appointed a team of independent social workers from a company called Services for Children to assess whether it would be safe for Ellie to return and to manage the transition.

http://www.telegraph.co.uk/news/2016/06/21/ellie-butler-murder-how-the-full-tragic-story-unfolded/

Gray has now been found guilty of child cruelty following an eight-week trial at the Old Bailey in which her abusive partner, Ben Butler, was convicted of murdering their little girl. 

Gray was a graduate of the famous Brit School in Croydon which produced the likes of Amy Winehouse, Leona Lewis and Adele.

As a teenager, she had minor roles in EastEnders, The Bill and Silent Witness before carving out a career as a graphic designer.

link

Disappeared British girl Madeleine McCann was made a ward of court, during summer 2007, on application by her parents.

During a court hearing on 7 July 2008 Hogg made an extraordinary plea to Madeleine’s abductor to “show mercy and compassion” and reveal her whereabouts.

Mrs Justice Hogg, who has effectively been Madeleine‘s legal guardian since her parents applied for her to be made a ward of court last year, said she had excused the McCanns from attending the hearing because “they have suffered enough and I wished to ease their burden”.


Dame Mary Claire Hogg, – Her great-grandfather another  Quintin Hogg, was an English philanthropist who had an interest in homeless boys, remembered primarily as a benefactor of the Royal Polytechnic institution at Regent Street, London, now the University of Westminster

In Ragged School annals appear the names of Quintin Hogg, Dr. Barnardo, Tom Hughes, General Gordon, and Professor Leone Levi. The Barnardo Homes grew directly out of the Ragged School movement, as did Quintin Hogg’s Polytechnic …

link

link

link

link


 

*(Dr Pamela Mason Home Office/Duncroft Psychiatrist was also a member of the Church of England’s Children Society Home Office since 1962)

link

link

link

link



article-0-18d8cce200000578-33_634x749

Revealed: The wealthy £40,000 Labour donor who is Sally Bercow’s Westminster drinking pal

  • Speaker John Bercow’s wife was photographed at an awards ceremony
  • She was accompanied by a mystery female companion
  • Mail on Sunday can reveal she is Farah Sassoon
  • Mrs Sassoon is Mrs Bercow’s best friend, and a businesswoman who has donated tens of thousands to the Labour party

 

The two are familiar figures in  the watering holes of Westminster, where they have been seen drinking champagne until late at night.

 

article-0-202998d400000578-952_634x552

She and her pal Farah Sassoon are enjoying the best seats in the house for the State Opening of Parliament.

bercow1

Tory MP Rob Wilson said: ‘This raises further questions about the Speaker, but in particular his wife’s relationship with Farah Sassoon.

‘For her to be given such a lofty place at the State Opening of Parliament, mere days before she donates thousands to the Speaker’s re-election campaign, raises the spectre of past Parliamentary scandals.’

Mrs Sassoon had been granted a pass giving her access to the parliamentary estate two years before she made the donation

Mr Bercow said that the pass allowed Mrs Sassoon access to his grace-and-favour apartment overlooking the Thames.

While other visitors must go through stringent and lengthy airport-style checks to gain entry to the Palace of Westminster, Mrs  Sassoon can walk straight in by showing her pass, just like MPs.


 

She is married to hotelier/Chartered Surveyor Peter Sassoon Munns. She has given more than £40,000 to Labour including a £4,200 donation to Ed Miliband’s leadership campaign in 2010.

She is listed as director of Trust Reservations, a conference and hotel booking agency, which made the donation to Mr Bercow.

One of its contracts is said to be arranging hotels for Labour delegates at its annual party conferences.

The company’s website boasts a picture of a Labour rally featuring deputy leader Harriet Harman and ex-union boss and Labour MP  husband Jack Dromey.

 

Identified only as a ‘female  companion’ of Mrs Bercow, Mrs Sassoon was photographed with  her friend after they left an  awards ceremony for gay magazine Attitude at the Royal Courts of  Justice.

Since 2007, Trust Reservations has given more than £35,000 in cash and ‘staff costs’ to Labour.
In 2010, the company made a  separate £4,200 donation to Mr  Miliband’s leadership campaign.

Records show that the money was received three months after he was elected Labour leader.
A Labour spokesman declined to discuss the company’s business connections with the party.

link

link

Trust Reservations

Trust Reservations was launched in 1999 and is privately owned and fully independent.
Specialising in UK meeting and conference management services and the sourcing of accommodation, our clients are typically corporations, SME’s, unions and Political Parties.

https://companycheck.co.uk/company/03829637/TRUST-RESERVATIONS-LIMITED/companies-house-data

http://www.trustreservations.com/about-us.php

Trust Reservations previously called

PATHGRASS LIMITED

COMPANY NUMBER
01752371

COMPANY TYPE
Private limited with Share Capital

BUSINESS ACTIVITY (SIC)
– No SIC description available

INCORPORATION DATE
13/09/1983 (33years old)

linklink

link

Previous company names
Name Period
PATHGRASS LTD 23 Aug 1999 – 17 Nov 1999

https://beta.companieshouse.gov.uk/company/03829637

MS FARAH SASSOON

farah-companies

In Common Date Limited

In Common Lovers Limited

Same in Common Limited

Your Miracle Match Limited

^ Dating Services?

https://companycheck.co.uk/director/909635420/MS-FARAH-SASSOON/companies

cash

David Morris MP tells Guido this morning that Farah Sassoon introduced herself to him on the Commons Terrace as ‘an adviser to Ed Miliband’ saying she advised the Labour leader ‘on all sorts of things’. Another Tory MP, speaking on the condition of anonymity for now, says that on a separate occasion Ms Sassoon claimed to be Sally Bercow’s agent. If this is true it adds a rather unsavoury commercial angle to why she has been allowed unfettered access to Parliamentary estate. Who is this mysterious character, and to what end is she really using this pass?

Whether she’s a friend, a Labour adviser, or Sally’s agent , the line from the Speaker that this is all dandy does not hold water. Crucially, Bercow’s spokesman dodged the question of whether proper advice was sought before he accepted a donation from this mysterious business woman. Even if there is an innocent explanation, as an example to all MPs, the Speaker must be whiter than white. Yet each day brings new questions…

Link

farah-miliband

Farah Sassoon former manager of Scarborough’s Royal Hotel:

royal-hotel

link

farah-press-reader

She took over the Royal Hotel Scarborough in 1992 along with hotelier husband Peter Sassoon Munns.  She banned Scarborough Council chiefs including John Trebble from the venue after being fined for food and hygiene offences. She also banned the Pindar printing family.

http://www.pressreader.com/uk/the-scarborough-evening-news/20140807/281608123581265

sassoon-nspcc-gala-dinner

MONTE CARLO – : Prince Albert of Monaco with his friend Alicia Wallach, Lloyd Bedack and guests at the NSPCC and Zonta Gala Dinner held at the Hermitage Hotel on 19th September 2001, in Monte Carlo

NSPCC Gala Dinner Monte Carlo 2001 – Prince Albert and Farah Sassoon Munns

Mrs Farah Sassoon With Man Utd Shareholder, The Nfpcc Gala Dinner At The Hermitage Hotel In Monte Carlo

Farah Sassoon with Manchester United Chief Executive Peter Kenyon and guest at the NSPCC and Zonta Gala Dinner held at the Hermitage Hotel on 19th September 2001, in Monte Carlo

http://www.gettyimages.com/detail/news-photo/lloyd-bedack-and-guest-at-the-nspcc-and-zonta-gala-dinner-news-photo/50823778#lloyd-bedack-and-guest-at-the-nspcc-and-zonta-gala-dinner-held-at-the-picture-id50823778

On the NSPCC and Zonta Gala Dinner in Monte Carlo

from “Hello!” magazine, number 683, October 9, 2001

Prince Albert of Monaco Enthusiastically participated in the bidding at an auction at the NSPCC-Zonta End Child Abuse Full Stop Charity Gala Dinner at the Hermitage Hotel in Monte Carlo.
with Mrs Lloyd Bedack The proceeds of more than £80,000 were shared between the NSPCC and Zonta International, a Monte Carlo-based charity which supports UNICEF in its aim to eliminate maternal and neonatal tetanus.

http://home.arcor.de/bassey/info/rp2001.html


2c3a8ba700000578-0-comrades_in_arms_a_beaming_jeremy_corbyn_embraces_len_mccluskey_-m-89_1442190269016

As the country’s most powerful union baron – and the man responsible for Jeremy Corbyn’s rise to power – ‘Red’ Len McCluskey

Last night ‘Red Len’ was mocked by a Tory MP for ‘living the high life’ while fellow trade unionists in the RMT were ‘crippling the country with strikes’.

The five-star Hotel de Paris, opened in 1863 and is one of the world’s most luxurious hotels, where the cheapest room is £450 a night.

IMG_0207.JPG

The 66-year-old former docker spent Friday evening at the hotel’s world-famous Le Bar Américain, with a group of friends including a mystery socialite

The wine list includes a Jeroboam of Dom Perignon Rose champagne, vintage 2000, costing £12,800.

a fellow drinker at the hotel’s bar suggested the mystery socialite in Mr McCluskey’s group was Farah Sassoon, a Labour donor who first came to public attention three years ago when she was pictured draping her leg across Sally Bercow’s lap in a cab on a night out. 

Mr McCluskey has played a key role in propping up Jeremy Corbyn.

One of Mr McCluskey’s closest friends, Karie Murphy, is the director of Mr Corbyn’s office.

The mystery woman seen with ‘Red Len’ bears a striking resemblance to socialite businesswoman Farah Sassoon, who has given £40,000 to Labour

link


2b94bd6700000578-3207505-image-m-18_1440288894805

Farah Sassoon, pictured, has donated £6,000 to Tom Watson’s Labour deputy leadership campaign through her company, it has emerged

Tom Watson gets unlikely lift from ‘limo girl’ Farah Sassoon

Burly Tom Watson’s bid to replace Harriet Harman as Deputy Labour Leader – and therefore be the man to face George Osborne at Prime Minister’s Questions in David Cameron’s absence – has received a boost from an unlikely source.

Farah Sassoon, best known for her antics in a taxi after a night out with her drinking pal Sally Bercow, has donated £6,000 to his campaign through her company – thus lending a much-needed touch of glamour to the old bruiser.

http://www.dailymail.co.uk/debate/article-3207505/BLACK-DOG-Corbyn-growing-ambition.html

Labour criticised for ‘cash for access’ Gala dinner

4 Jul 2014

Party is allowing wealthy donors to attend the £15,000 a table gala dinner without having to publicly register their names

http://www.telegraph.co.uk/news/politics/labour/10946782/Labour-criticised-for-cash-for-access-Gala-dinner.html

Why won’t Ed name the guests at Labour fundraiser? Party accused of ‘staggering hypocrisy’ after not publishing who attended £15,000-a-table ‘gala’

http://www.dailymail.co.uk/news/article-2686750/Why-wont-Ed-guests-Labour-fundraiser-Party-accused-staggering-hypocrisy-not-publishing-attended-15-000-table-gala.html

london-uk-9th-july-2014-labour-financier-and-farah-sassoon-leaving-e4f5c1

Labour financier and Farah Sassoon leaving  Labour Party Gala Dinner Roundhouse Camden …

london-uk-9th-july-2014-women-in-red-leaving-labour-party-gala-dinner-e4f5ay

Labour Party Gala Dinner Roundhouse Camden 9th July, 2014

Labour’s pre-election gala, hosted by Stephen Fry

“It’s all gone bizarre as Stephen Fry launches into speech on Operation Yewtree

Labour was accused of ‘staggering hypocrisy’ last night for refusing to publish the names of guests at a lavish fundraising dinner with Ed Miliband

Labour refused to release the full list of attendees – just days after it demanded David Cameron release a list of guests at a similar Tory event last week.

http://www.dailymail.co.uk/news/article-2686750/Why-wont-Ed-guests-Labour-fundraiser-Party-accused-staggering-hypocrisy-not-publishing-attended-15-000-table-gala.html

link

fry-filth

Stephen Fry stuns Labour gala as he hits out at sex abuse investigation: he attacks former Director of Public Prosecutions

  • Host Stephen Fry left audience at Labour fundraiser in shocked silence
  • Actor criticised Operation Yewtree investigation into historic abuse
  • He complained that less than 50 per cent of those held had been convicted

Operation Yewtree investigation – the Scotland Yard operation spawned by the Sir Jimmy Savile abuse scandal – of entertainer Rolf Harris, publicist Max Clifford and TV presenter Stuart Hall.

The actor then launched into what one guest described as a ‘rant’ about how the law should be toughened up to deter people from inventing claims about sex abuse.

http://www.dailymail.co.uk/news/article-2690107/Fry-stuns-Labour-gala-hits-sex-abuse-investigation-Miliband-rebukes-TV-star-attacks-former-DPP.html

100 business leaders back Mayor contender Khan to be their ‘friend at City Hall’

Farah Sassoon                             Trust Reservations Limited, Managing Director

http://www.standard.co.uk/news/mayor/100-business-leaders-back-mayor-contender-khan-to-be-their-friend-at-city-hall-a3215981.html



“Tony Blair’s first major scandal involved Formula 1 billionaire and New Labour donor Bernie Ecclestone. The profits raised by Formula 1’s worldwide monopoly are often funnelled through companies headquartered on the Channel Islands. Ecclestone was worth $4.2 billion in 2011, which makes him the fourth richest person in the UK. Ecclestone transferred his Formula One assets to his wife Slavica in the 1990s and then to a family trust in Liechtenstein. Ecclestone said his tax bill would be about £1.2bn if he was shown to be involved in the trust.”

“In addition to Ecclestone, Stephen Glover in the Daily Mail reported that between 2001 and 2008, Labour accepted donations worth £8.9million from eight non-domiciled donors.

,
Labour donor Sir Gulam Noon (estimated worth £65 million in 2006), gave up his lucrative non-dom tax status to become Assistant Treasurer to the Labour Party in 2010. His fellow Assistant Treasurer, the late Nigel Doughty (estimated worth £130 million in 2011), was again from the private-equity industry, being the founder of Doughty Hanson & Co which manages over £8 billion in assets.
Labour’s largest donor was Lord David Sainsbury*, who had given a staggering £18 million pounds by 2012. He received his peerage from the party leadership that he had donated to and became a government minister for eight years, without having to stand for election.

link

 Lord David Sainsbury, Vaz and Nadhmi Auchi

The anniversary bash held on 23 April 1999 is proving embarrassing for Labour. According to a glossy brochure published by Auchi for the occasion, a painting of the House of Commons was ‘presented by the British Prime Minister Tony Blair and signed by leaders of Her Majesty’s Opposition.’

The painting was in fact presented by the Science Minister, Lord Sainsbury. The Observer asked Lord Sainsbury’s office why he had presented such a potentially embarrassing gift on behalf of the Prime Minister. The answer: ‘He did it as a favour for Keith Vaz.’

Although the party was held before the French arrest warrant was issued, we have discovered that the intelligence services had long been aware of Auchi’s controversial and mysterious past to the extent of warning one former director about its concerns.

https://www.theguardian.com/politics/2001/may/27/election2001.labour1


Mystery as curry king Lord Noon, who was once said to be worth £75million, leaves just £2.6million in his will

  • Lord Noon was at the centre of a ‘cash for peerages’ scandal back in 2006 
  • He died in October, aged 79, but left a UK estate of only £2,672,826 

In July 1994 he was voted ‘The Asian of the Year’ by the community; in 1998 the Asian Business Network awarded him an ‘Outstanding Lifetime Achievement Award’, which was presented by the Rt Hon Mr Jack Straw MP;

7698_gulam-noon-with-the-queen

In 1996 he received an MBE in the Queen’s Honours List and this was followed in 2002 by a knighthood bestowed by Her Majesty in her Jubilee Year Birthday Honours List.

He was on the Board of CARE International UK for four years (2002 – 2006); he was a Founder Member of Cancer Research UK; he has also held multiple Trusteeships including with the Arpana Charitable Trust UK, the British Food Trust, the Maimonides Trust, the Memorial Gates Trust, which was established to commemorate the contribution made in world wars by the people of the Commonwealth, and finally he was Chairman of the Board of Trustees of the Noon Foundation.

pg-46-noon-pa.jpg

Noon, who served on the board of the Prince’s Trust, with Prince Charles in 2003

In 2010, with turnover at £105m, Prince Charles opened Noon’s new state-of-the-art factory.

His London office in Queen Anne’s Gate, Westminster, displayed autographed cricket bats and photographs of him with royalty and politicians. He was on the advisory council of the Prince’s Trust.

it was his association with politicians that brought him into the headlines. He often sat with John Major supporting Surrey county cricket club at the Oval in London, but he was a Labour supporter and major donor who was on personal terms with Blair and Gordon Brown.

RELATIONSHIPS: (From left) Manraj Sekhon, Lady Mohini Noon, Zarmin Sekhon, Cherie Blair, Natania Harnal, Tony Blair, Arun Harnal and his wife Zeenat, John Bercow and Keith Vaz

there was a prayer meeting in Southall gurdwara and on Monday (2), a “celebration of his life” organised in parliament by Leicester East MP Vaz.

At the event, Tony Blair, who occupied his old prime minister’s chair in a packed Committee Room 14 in the House of Commons, said Lord Gulam Noon “will continue to be an inspiration even after his passing”.

The gathering included members of both Houses, speaker John Bercow

Condolence message from Vaz: Our community has lost one of its greatest stars,”

https://i0.wp.com/indiangymkhanaclub.co.uk/wp-content/uploads/2016/03/Lord-GULAM-Noon-Senior-Vice-President-of-club-Joginder-Sanger-Trustee-of-the-club-e1458839944583.jpg

London-based NRI hotelier and chairman of Bhavan UK Joginder Sanger, one of Lord Noon’s oldest friends, said: “He was a great friend and a strong believer in secularism.

Lord Noon counted Prince Charles and his father, Prince Philip, among his friends.

http://webcache.googleusercontent.com/search?q=cache:OJApJbiTvQAJ:www.ndtv.com/indians-abroad/britains-curry-king-lord-gulam-noon-passes-away-1236977+&cd=8&hl=en&ct=clnk&gl=us

http://www.dailymail.co.uk/news/article-3671948/Mystery-curry-king-Lord-Noon-said-worth-75million-leaves-just-2-6million-will.html

http://www.mosaicnetwork.co.uk/mosaic-ambassador-lord-noon-passes-away/

https://www.theguardian.com/business/2015/oct/28/lord-noon

https://www.easterneye.eu/news/detail/lord-noon-laid-to-rest

link

https://image.issuu.com/130227121107-1c05574674a1430189c19f4f9e98ce6c/jpg/page_11.jpg

*Sainsbury foundation gave money to Albany Trust via the Gatsby charitable foundation.

P.I.E were helped with funding from the Government through The Albany Trust, established by Antony Grey (aka Antony Edward Garside-Wright) as part of his campaign for homosexual rights. Grey also sat on the committee’s for British Association for Counselling, NCCL (Liberty) and Campaign Against Censorship.

http://google-law.blogspot.com/2016/04/kids-homes-approved-schools-can-by.html

Sainsbury and Butler-Sloss families are related.



https://cathyfox.wordpress.com/2016/09/04/more-vaz-sex-sleaze-and-government-child-sex-abuse-cover-ups/

http://aanirfan.blogspot.co.uk/2016/08/keith-vaz-male-prostitutes-and-child.html

https://wordpress.com/post/goodnessandharmony.wordpress.com/410

https://books.google.com/books?id=jofh0xR_3CkC&pg=PA162&lpg=PA162&dq=dorothy+savile+jimmy+savile+the+road+to+champneys&source=bl&ots=ZvRjn-pX9H&sig=I8dJqutpYGpbG6GY4vtEXIXWgcQ&hl=en&sa=X&ei=eUj8VMKRNvb7sATKu4GQBA&ved=0CDMQ6AEwAw#v=onepage&q=vaz&f=false

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader charged with buggery of a 14-yr old.


Update: August 26, 2016

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader found guilty of gross indecency with young boy

John Coatman, leader of Urban Saints Youth Group, Croydon was warned by Judge Richard Horne QC that he faced a jail term. He is due to be sentenced on September 30.

 

Sexual contact took place on about four or five occasions.

In emotional testimony in front of the jury, the man – who was 14 at the time at the time – broke down in tears as he described the alleged abuse taking place 

“… the effects of abuse on a young person can be quite traumatic…”

 

The survivor also said Coatman had asked whether any other boys he knew “might be interested”.

 link

link

 

377e2a9100000578-3753419-image-a-3_1471886185455
A retired headmaster, John Coatman, has been charged with having sex with a 14-year-old boy he met through a Christian youth group in the 1970s.

Jurors heard that at the time of the incidents, Coatman was not only the headteacher of a secondary school in south London (St Andrew’s Church of England High School), but was also involved in a Christian group for boys.  

The name of the Christian youth group is – Crusaders/now called  Urban Saints Youth Group organisation – Cliff Richard’s group

http://research.omicsgroup.org/index.php/Urban_Saints

http://www.dailymail.co.uk/news/article-3753419/Retired-headmaster-75-head-sex-14-year-old-boy-met-Christian-youth-group-1970s.html

Mr Coatman, who described himself as a bachelor told jurors that the topic of sex did crop up during youth group meetings, but only in reference to passages in the Bible involving “Christian aspects of sexual behaviour”, he added.

link

John Coatman MBE Supporters

From a lonely John Coatman testimonial website (comprised of a handful of supporters)

Testimonial by Victoria Swainson

“…I also did my bronze and silver Duke of Edinburgh awards outside of school, through a group organised and led by John (Coatman), and attended a residential Crusaders weekend on the Isle of Wight, again which he’d organised”

 Testimonial by Dr Amy Kendrick

 My name is Amy Kendrick and I was a pupil at St Andrew’s Church of England School in Croydon between 1992 and 1997.

http://jcoatmantestimonials.blogspot.com/search?updated-min=2015-01-01T00:00:00-08:00&updated-max=2016-01-01T00:00:00-08:00&max-results=3

Dr Amy Kendrick – related to evangelical songwriter Graham Kendrick?

Graham Kendrick

Special commissions from such charities as Tear Fund, the Children’s Society, Church Army and Care for the Family, have resulted in songs of compassion and justice. They have been sung at major public occasions – including the Dunblane memorial service.

Festival of LightAmong these were Malcolm Muggeridge, Lord Longford, Bishop Trevor Huddleston and Cliff Richard. Among the performers were Cliff Richard, and Graham Kendrick.

link

link

logo2x

The Tear Fund charity was created out of the Evangelical Alliance (EA) and the Evangelical Refugee Fund created by the United Nations.

In January 1969 Cliff Richard did two fundraising concerts for Tearfund at London’s Royal Albert Hall. He has served as the charity’s Vice President and in 1999 served as its president

 

article-1053130-026e2fc900000578-126_468x311

Life-long bachelor Cliff Richard – his manager and live-in companion of more than 30 years, Bill Latham (right) was  hugely involved with charity work and was in “on the start of Tearfund”

In 1972  Latham was Deputy Director of Tearfund and had been instrumental in persuading Jean Le Maistre, a Christian politician on the island who was just launching Jersey Overseas Aid, to take a team for his first project to a hospital in Nazareth.

link

cliff tear fund

1978 English pop singer Cliff Richard in concert for the Christian charity, Tear Fund.

jamesogilvyroyalweddingpreweddingdinneriaqmd75ldgtl

Julia Ogilvy  (centre)– a Trustee of Tearfund with Princess Alexandra and James Ogilvy

Julia Ogilvy is a member of the extended British Royal Family. She is the wife of James Ogilvy, the only son of Sir Angus Ogilvy and Princess Alexandra, The Honourable Lady Ogilvy, a granddaughter of King George V and first cousin of Her Majesty the Queen.

link

Jimmy Savile admitted getting knighthood was ‘a relief because it got me off the hook’

His OBE folder contained a handwritten letter from Angus Ogilvy

link

More on the Ogilvys- The Ogilvys

Testimonial by Joshua Woodcock
 John Coatman was at first my leader, then as i grew older my co-leader as i joined the team leading the group and even after i left a dear friend mine. My very first contact with John was at St Andrews school where he was my sisters head master.
I went to Wallington crusaders with John for the best part of 15 years
From mass groups of us walking over box hill in the middle of the night every year to may trips away to Westbrook on the isle of white.

 

John Coatman reckons he’s been to about 300 Crusaders camps over the years

link

img_0071

westbrook_new_website

westbrook20front

Westbrook started life as a large Victorian residence surrounded by 25 acres of mixed parkland that was purchased by Crusaders Union in 1948

The original intention of the Committee at the time was to use a Memorial Fund of just over £500 to purchase a field as a permanent camp site for the ever developing Crusader holidays

link

 Crusaders Youth Group/Urban Saints

link

Donald Wiseman worked for military intelligence.

In 1942 he became senior intelligence officer of the Mediterranean Allied Tactical Air Forces.

Wiseman joined a special intelligence group handling the Ultra signals, deciphered at Bletchley Park.

Wiseman worked with the Christian Crusaders

Wiseman also maintained a close connection with the Crusaders organisation. He was leader of the class at Finchley, which included Cliff Richard

Martin J. Selman, “Donald J. Wiseman,” in Walter A. Elwell and J. D. Weaver (eds.), Bible Interpreters of the 20th Century (Grand Rapids: Baker, 1999) p. 309

http://aanirfan.blogspot.com/2016/06/cliff-richard-crusaders-military.html


 

1979 Margaret Thatcher immediately carried out her promise to slash public spending, recommending that heating be drastically rationed in offices and schools.

This led to a remarkable revolt in Westerham in October 1979 when rebel children from Churchill School, led by senior pupils, burned their text books and walked out in protest against the cold. When headmaster John Coatman went into the playing field to remonstrate, many returned. Around 50 to 60 protesters stayed outside until a caretaker confirmed that the boilers were on.

link

 

 T H E O L D W H I T G I F T I A N A S S O C I A T I O N , C R O H A M M A N O R R O A D , S O U T H C R O Y D O N , S U R R E Y

John A Coatman attended Whitgift (1952-59) as did his brother Robert William Coatman, MBE, JP

coatman family whitgift
Robert William Coatman, MBE
3007948-large
Robert William Coatman, MBE – ONE of Croydon’s longest-serving councillors.He was first elected as a Conservative for Croydon Central ward in 1966 and went on to represent its successor ward, Fairfield, until his retirement.

Councillor Coatman was elected in 1966 to represent Croydon Central ward, following a family tradition after his great-uncle, GF Coatman, represented Croydon Central in the 1920s

Bob Coatman was educated at Whitgift School and worked for 41 years as a chartered surveyor.

He was best known on the council for his role in planning – serving on the planning committee from 1968 and spending 16 years as its chairman.

 He was Mayor of Croydon in 1977-78.

In 1993, Mr Coatman was made an MBE for his services to local government, and he received a lifelong service award from the council in 2006.

He also served as a magistrate at Croydon Magistrates’ Court for 21 years from 1976.

Outside of council business, Mr Coatman was founder president of both the Rotary Club of Croydon South and the Croydon Mayors’ Association.

He had also been a member of the Croydon South Probus Club and the Old Whitgiftian Association and a longstanding member of the court of the Whitgift Foundation.

His interests included classic cars, he was  a member of the A40 Farina Club and the history of Croydon, and he was a member of the Croydon Corps of Drums.

 

coatman john

2012 John Coatman. Leader, Urban Saints Youth Group, Croydon – MBE for services to Young People. (London, CR0)

 

standrews

Coatman was head teacher at St Andrew’s until he retired in 1997 and was awarded with an MBE by The Queen in 2012 for his services to young people.

Life-long youth worker given MBE

A FORMER head teacher who has spent his life working with Croydon’s youth has been recognised for his services to young people.

John Coatman, who taught at St Andrew’s School in Warrington Road, has been appointed an MBE.

Mr Coatman joined youth group the Croydon Crusaders, now known as Urban Saints, in 1949 aged eight and rose to represent the club on a national and international level.

 John Coatman

John is very active “for his years”, keeps fit and loves to travel the world – he’s always looking for travel companions who can keep up with him.

Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people leading expeditions to Austria, a project which has secured European Union funding, and on countless Duke of Edinburgh Award trips.


Imperial College LondonJohn Coatman, BSc Civil Engineering 1962

link

link


Ten English Days or TED – by John Coatman, on behalf of the leadership team:

 

Coatman TED Austria

The expedition is being run as part of the work of Croydon Crusaders. Crusaders is a registered charity and the expedition is a charitable activity supporting the work of a charity in Austria. Please ask for information about gift aid.
EU GRANTS
In 2001, 2002, 2003, 2004 and 2005 we had generous grants towards the project from the European Union and we may be applying again this year.
This will be my seventh year leading the TED expedition so I know a great deal about where we are going and what we will be doing. For the first 3 years the trip was part of the Crusoe (Crusaders Overseas Expeditions) programme organised by Crusaders. From 2003 the same expedition has been run under my own Croydon Crusaders Group. Apart from that, all is the same and it is a great success. The 2006 trip is open to any Christian young person aged 15 to 25 who wants to serve God on a working holiday. For legal reasons, by applying they become members of Croydon Crusaders. I promise a great deal of fun in one of the most beautiful parts of Europe in a building that you will find tobe very hospitable and lovely. You will live in luxury but I also promise that you will work hard!
We will be going to Schloss Klaus in Upper Austria.

https://web.archive.org/web/20160823154816/http://www.youthblog.org/tedaustria2006.pdf

Schloss Klaus

link

 


b2zkx5aciaafnbm

One of our loyal readers, John Coatman of The Croydon Crusaders, decided to pop in this morning and say hello!

The Pass is a magazine inspiring the UK’s Group Travel Organisers.


2011 Croydon Council consultant – John Coatman Crusaders

https://www.croydon.gov.uk/sites/default/files/articles/downloads/appendices1-3.pdf


coatman com ck

Nature of business (SIC) – 7020 Letting of own property

https://companycheck.co.uk/director/906652625/MR-JOHN-ANTHONY-COATMAN/companies


WALLINGTON CRUSADER HALL

Crusader Hall in Carshalton, England

Charitable Objects

“To Be Used For All Or Any Of The Purposes Of The Wallington Crusaders’ Bible Class For Public And Private Schoolboys And Young Men In Such Manner As The Leader Of Learders For The Time Being Thereof Shall Think Fit Within The Limits Of The Trusts Hereinafter Declared And Subject To Such Terms And Obligations As May Be Agreed Between The Trustees And The Wallington Crusaders’ Bible Class Aforesaid.”

Operations

Operation Location(s) Domestic
Surrey
Sutton

Trustees

Name

CHRISTIAN AND SPORTING ACTIVITIES MOSTLY FOR YOUNG PEOPLE WALLINGTON 253811

253811 MR BOB HEDDERLY, MR DERRICK CHARLES LEWIN 462944 MR NOEL GODFREY CARPENTER 467551 ROBERT VERNON HEDDERLY 468174 IVAN RATNAYAKE 3266458 JOHN COATMAN 3266459


 

cr1970chtimes08_21x_zps3eca9245

1970 Cliff had just returned from spending two weeks at a Christian Crusader camp. Cliff has entertained many young people on a boat that he moors on the Norfolk Broads

 …………………………………….

Cliff Richard led an armada of five motor cruisers along the Norfolk Broads…Last night with 27 boys from the Crusaders’ Union...in his six-berth Pomander ...

cliff2b-2bnorfolk2bbroads2b

cr1972dexp04_04x_zps256ad2f4

cr1966chtimes11_18x_zps31ab0c54

link

 

cliff2bbroads

 

WHAT IS AN URBAN SAINTS GROUP ANYWAY? There was a bumper crop of Urban Saints family members included in the 2012 New Year’s Honours list by Her Majesty The Queen.

This included MBEs for John Coatman (for his work with young people in Croydon, including the Wallington Urban Saints group), Dr Avice Hall & Stephen Hammersley (for their work in education, the community and their own local groups, in St Albans and Harpenden respectively). Former Crusaders Director, Dr Alan Kerbey, received an OBE for his work with young people in education and another former staff team member, Colin Henry, was recognised for with a MBE, for services to education in his role as Chair of Governors at Christ’s College in Guildford.

URBAN SAINTS is the operating name of The Crusaders’ Union, a company limited by guarantee and registered in England & Wales, company number 07771037, charity number 1144923

https://companycheck.co.uk/company/07771037/THE-CRUSADERS-UNION/companies-house-data

http://docslide.us/documents/engage-spring-2012-56f388fd581ab.html


l-r-president-of-crusaders-steve-chalke-sir-cliff-richard

2006
Crusaders, the youth missionary movement, hosted “An Evening with Sir Cliff Richard” recently in Central London to celebrate its centenary.

Alongside Steve Chalke, the President of Crusaders, Sir Cliff shared his personal life and faith, as well as performing a couple of songs from his repertoire.

Sir Cliff shared openly about his early days as a young performer, his big break, his very public conversion to Christ and the significant role played by Crusader leaders in his early Christian journey.

He spoke fondly of his time with Crusaders.

Sir Cliff is Patron of the Crusaders

http://www.christiantoday.com/article/sir.cliff.richard.shares.faith.at.crusaders.centenary/8014.htm

 


 

Paul O’Grady: “He’s really been through it this year, poor Cliff. He’s had a terrible time.”

Cliff Richard to O’Grady: “…you and I we’ve stood side by side through the storms together and all through the years you have been golden”

 

sir-cliff-richard-and-paul-ogrady

Cliff Richard’s drag queen friend and supporter, Paul O’Grady worked at care homes where Jimmy Savile abused and where Crusaders (members of the organisation that Cliff Richard is patron of)  were charged with abuse.

 

lily-savage-580x350_73610a

Paul O’Grady as drag queen, Lily Savage (Carlton Television) worked for Camden Council Social Services

1004410

O’Grady worked at The Children’s Convalescent Home and School on Meols Drive, West Kirby

link

paul-o-grady-the-devil-rides-out

From his autobiography:

o grady children's home

link

Last night TV funnyman Paul O’Grady told how Savile was banned from being alone on a girls’ ward at a care home where the Lily Savage star once worked.

Paul says: “When I worked in a children’s home in West Kirby in the 1970s, Jimmy Savile came to visit.

O’Grady, recalled the “creepy” DJ, Jimmy Savile visiting the Conny Home in West Kirby, Merseyside, which housed disabled and abused children in the 1970s.

He said: “Some of the house mothers were told not to let him on the girls’
unit unsupervised.”

31d765e700000578-0-image-m-101_1457094029831

link

link

paul o grady crusaders quote

o grady crusaders

link

West Kirby Residential School, West Kirby, Wirral

A group of 10 claimants has already issued legal proceedings relating to claims for severe physical and sexual abuse from the mid 1970s to the early 1990s at West Kirby Residential School in Meols Drive.

Three men (Graham Charles Webb, Henry Christie, Matthew Johnson) received jail sentences at Liverpool Crown Court for their part in the physical and sexual abuse at the residential school.

*Former head of care Graham Charles Webb, was jailed for seven years in July 1997 for abusing boys at the school and at camps he helped organise.

Webb, who also worked for a well known Christian youth movement, admitted abusing 20 children over a period of almost 20 years.

https://theukdatabase.com/2013/05/04/west-kirby-residential-school/

(West Kirby Residential School, West Kirby, Wirral

Matthew Johnson was also at Balliol School, Sedburgh, Cumbria.

The former house parent, of Kirby Stephen, Cumbria, committed the offences on five pupils at the residential school and three boy scouts who were in his care when he was a scout master.)


And another Crusader leader charged with abusing boys:

Crusader leader vicar Rev David Henry McIntosh:

 

Crusader Graham Webb charged along with

fellow Crusader leader vicar Rev David Henry McIntosh:

Alongside McIntosh in the dock was 41-year-old Graham Webb, who was care head at a West Kirby residential school, and Bournemouth man Robert Moses.

Some of the charges involve both McIntosh and Webb, who were leaders of activity holidays.

 

FORMER West Kirby residential school head Graham Webb and a vicar face indecency charges.

23 May 1997

 

Rev David Henry McIntosh, of Fenwick Lane, Runcorn, has been bailed with sureties of £2,000. A condition of bail is to make no contact with Webb. They will appear at Crown Court to plea on June 12, after being directed to the higher court by Wirral magistrates.

http://www.wirralglobe.co.uk/news/7439630.Head_and_vicar_face_sex_trial/?ref=arc

 26 Mar 1997

The Rev McIntosh had been staying at an address in Fenwick Lane, Halton Lodge, Runcorn, but has now been moved to a secret venue which was not revealed in open court.

Reporting restrictions have not been lifted.

link

A Church of England VICAR, the Rev David Henry McIntosh,

who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

The court was told that the “shower games” took place during Crusader holidays at a boarding school in Swindon, Wiltshire, in 1988,1994 and 1995 and at a weekend gathering of boys for a reunion at a church commissioner’s house in Llandudno in 1994.

His position was made more serious by the fact he had helped draw up documents advising leaders about appropriate behaviour with the boys.

The Church of England vicar, who resigned from his post at Barnton, near Northwich, after his arrest last December, used to work as part of a ministry team in Ellesmere Port

He studied maths and physics at Durham University.

He is charged with 19 indecent assault allegations at West Kirby, Swindon, Minehead, Malvern and Cheltenham, four matters of gross indecency at West Kirby and two other offences brought under the Sexual Offences Act.

He had been involved with the Crusaders for longer than his involvement in the church, attending more than 40 holidays during that period of time.

link

link

 December 1997

 PERVERT VICAR JAILED

 A VICAR who sexually assaulted young boys during naked “shower games” at holiday camps organised by a Christian youth group has been jailed for three years at Liverpool Crown Court.

McIntosh, who was camp chaplain at the holidays at Pinewood boarding school, Swindon, from 1988 to 1991, became overall holiday leader there in 1993.

The two boys whom McIntosh abused in Llandudno were both from an Ellesmere Port school where he was vicar.

https://theukdatabase.com/2012/04/23/david-mcintosh-swindonruncornwarrington/

link

link


 

 Another Crusader charged with abusing boys at a care home:

image-24m

Mr Gilbart-Smith… who had led the Crusaders children’s group for fifty years was accused of abuse

All the allegations were said to have involved Mr Gilbart-Smith and others at Greenfield House children’s hostel in Maidenhead, Berkshire.

During that time the court heard residents were subjected to sustained, systemic abuse at the hands of the home’s managers and numerous visitors.

The youngsters were repeatedly raped and even ‘loaned out’ to other paedophiles elsewhere.

Mr Gilbart-Smith, a successful businessman, was accused of being one of those who took part in the sex attacks.

http://www.dailymail.co.uk/news/article-1292277/Paedophile-suspect-doused-petrol-victim-court-dock-drama-acquittal.html

Nine men “horrendously abused” by a paedophile ring in a children’s home 40 years ago have received an out-of-court settlement totalling more than £300,000

The civil settlement came despite the fact that no-one has ever been convicted of criminal offences regarding the abuse at the council-run Green Field House in Maidenhead, Berkshire, between 1964 and 1970

The home was then managed by ex-soldier Don Prescott, who died about 19 years ago.

He used to abuse the boys and rent them out to other paedophiles as far afield as Leicester, London, Cambridge and Reading

https://theukdatabase.com/2012/04/21/green-field-house-childrens-home-maidenhead/

“Unfortunately for the boys staying at Green Field House, it was the centre of a paedophile ring numbering so many men some of the boys lost count of those who abused them.

“They suffered the most horrendous abuse – it was the worst type of sexual abuse. They were filmed, photographed and had to take part in the abuse.

“… it went on for six years.”

http://news.bbc.co.uk/2/hi/uk_news/england/berkshire/6195572.stm

Nine men all with children and grandchildren claimed to have been raped by Gilbart-Smith the Lloyds investor during their stay at Green Field House children’s home Maidenhead (Theresa May’s constituency).

Gilbart-Smith, offered no defence other than a denial and a moral smoke screen, as he claimed to be a “Christian” who was a church leader at Foxes Piece School, Newfield Road, Marlow. Gilbart-Smith also told the court that he was a Bible teaching missionary and friends with a David Pawson.

http://www.thepaedotrial.com/crown-court-paedo-defence/

link


coatman mbe

Is John Coatman MBE  linked with these other Crusader leaders who have been charged with csa?

Is he part of a ring?

 

John Coatman reckons he’s been to about 300 Crusaders camps over the years”

link

“Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people”

link

Coatman …”rose to represent the club on a national and international level.”

link

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

“John (Coatman) was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member…”

policy statement urban saints

Coatman on the South East Regional Steering Group of the Urban Saints (formerly known as the Crusaders)

coatman steering group

The South East Regional Steering Group

The South East Regional Steering Group consists of  …

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

John was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member of the Croydon group.

link

John Coatman organised and took part in many residential Crusaders weekend on the Isle of Wight

 



 

crusader postcard

link

proxy

 


 

Misc info on Cliff Richard’s friend Paul O’Grady who worked at West Kirby Residential School

dsc_0390

Predator Savile’s attack on victim at High Royds Psychiatric Hospital in Menston
link

Paul O’Grady used to work on one of the wards when I was there. He was a staff nurse and was training to be a comedian at the time.

http://www.highroydshospital.com/galleries/1902-2/


09c92615-b2b3-060a-b8836710146cc270

Paul O’Grady appointed MBE by Prince Charles – The star said: “I’m delighted. Now I’m part of the Establishment.”

Prince Charles – friend of  “creepy” Jimmy Savile:

prince-charles-jimmy-savile


 

Paul O’Grady:

Even now, 40 years on, the TV host and comedian shivers as he relives the night he saved the 18-month-old youngster’s life while working for social services. (Camden Council Social Services)

He tells how he fled the flat where he was keeping watch on the baby after a terrifying confrontation with the little lad’s drunken father – and how the drama ended with him making a desperate phone call to the Salvation Army for help.

Paul O’Grady reveals the terrifying moment in 1976 … he feared for his own survival

 Paul O'Grady: The Sally Army and Me

Paul O’Grady, while employed by Camden Council Social Services 

 took a toddler to a pub where Adam Ant was playing

Reliving his unforgettable ordeal in 1976, Paul says: “It was a dangerous situation for the kid, and for me.

“There were a few times when my life and that of The Sally Army crossed paths, but that night is one of the most memorable.”

After heading to London in the 70s, a few years before conjuring up Lily Savage , Liverpudlian Paul, then 21, worked for Camden Council Social Services providing respite care for families at home.

He says: “I remember the mother of this child had to go to hospital for an operation so I was there to look after him. He was only 18 months.

“It must have been about 2am when there was a banging at the door. I answered it …‘What are you doing carrying on with my wife?” he said.

“I tried to explain I was a care worker, but he just told me, ‘I want my kid.’

“‘You’re not getting your kid, mate,’ I said. ‘I’m sorry, you’ve got to get through me first.’

So I took the child in the middle of the night…I hurried into this club next to Camden Town tube. I remember Adam And The Ants* were playing a gig there that night.”

“I asked the manager if I could use his phone to call my duty worker. But I couldn’t get through to him for some reason. So I called The Sally Army instead and said, ‘can you bloody help me?’

“And they came. And they didn’t ask lots of questions. They wrapped the kid in a blanket. We had a place of safety in Kentish Town and they took him there.

 

http://www.mirror.co.uk/tv/tv-news/paul-ogrady-reveals-terrifying-moment-7635112


Adam Ant’s father, Alfred Leslie Goddard (left), was jailed for preying on runaway boys nearly 30 years ago.

 Leslie Alfred Goddard  worked as a chauffeur.

 

*Stuart Leslie Goddard/Adam Ant’s father- Leslie Alfred Goddard- was jailed in 1987 with Sidney Cooke as part of the Dirty Dozen gang.

http://aanirfan.blogspot.com/2015/08/goddard-cooke-adam-ant-and-security.html

Boys had been hawked around “safe houses” and passed on to other members of the gang which included council porter Alfred Goddard, father of 1980s pop star Adam Ant.

The former council porter was a member of a gang that included Britain’s most notorious paedophile, Sidney Cooke, who was later convicted of the sadistic gang rape and killing of a teenage boy and is suspected of murdering many more.

It has emerged that detectives investigating shock allegations of three murders and systemic child sex abuse by senior Establishment figures are looking into Goddard’s possible involvement.

The suggestion is that the child sex ring, dubbed the Dirty Dozen and known to have targeted vulnerable youngsters, could have passed on their victims for the MPs to abuse.

At the time, Goddard lived in Eccleston Square, Pimlico, close to the exclusive apartments of Dolphin Square where the VIP child abuse ring is said to have been based.

adam-ant-margaret

Adam Ant’s mother was an embroiderer or the Queen’s dressmaker Norman Hartnell. and worked at Paul McCartney’s house as a cleaner.

Like Sidney Cooke, Leslie Alfred Goddard was also a chauffeur to rich families.
link

Alfred Leslie Goddard had served in the Royal Air Force.

https://en.wikipedia.org/wiki/Adam_Ant

 


 Cliff Richard’s friend Paul O’Grady is a patron of  the Peter Tatchell Foundation

 

tatchell1

 

peter-tatchell-patrons

http://www.petertatchellfoundation.org/node/573

 

School children ‘given experimental drugs without their parents’ consent in 1960s Home Office-approved trial’

EXPERIMENTAL drug trials on school children were approved by Home Office doctors in the 1960s, it has been revealed.

Disruptive boys were given an anticonvulsant drug to see if it would help to control their behaviour while a proposal to give girls a powerful sedative was also considered.

In the disturbing revelations, exposed in National Archive files, parents were not consulted with consent left to managers.

richmond hill school b & w

Richmond Hill Approved School

The anticonvulsant drug trial was performed at the Richmond Hill Approved School in North Yorkshire, which housed male students aged 15-17 years-old.

The school for boys was established at a Victorian building on the site in 1961 after The Green Howards moved from its regimental headquarters and continued until 1973, when approved schools were replaced by community homes.

One of the documents was dated late 1967 and signed off by Dr JR Hawkings. He wanted to give some of them a drug called Beclamide

The proposal at the girls school had been considered for all students at the Springhead Park Approved School in Rothwell, which cared for 14 and 15-year-olds.

The drug that would have been trialled was Haloperidol, which is a powerful sedative now used as an anti-psychotic.

All three doctors involved in the drug trial plans are now deceased.

Home Office psychiatrist Dr Pamela Mason approved of the drug trials, saying she recommended “maximum support” for the project.

As the Richmond Hill trial got under way, a second trial was proposed, again by a school psychiatrist, at Springhead Park Approved School for girls in Rothwell near Leeds.

This was a sister school to the better known Duncroft in Surrey, a small institution for girls of higher intelligence.

In November 1968, Dr Joyce Galbraith wrote to Dr Mason at the Home Office “in strict confidence”.

She suggested giving Haloperidol to every girl in the school, for 18 weeks.

Again, Dr Mason supported the plan.

The files also show that Shelagh Sunner, headmistress of the school between 1966 and 1982, did not support the trial.

Bob Hammal, a teacher at Richmond Hill between 1968 and 1972, said he did not know about the trial at the time and is appalled.

link

http://www.bbc.com/news/uk-37149029http://www.bbc.com/news/uk-37149029

https://www.thesun.co.uk/news/1652873/home-office-docs-agreed-seedy-secret-drug-trials-on-restless-borstal-boys-in-60s-files-reveal/


P.O.I.

 

joyce galbraith

Dr Joyce Galbraith, a psychiatrist working at Springhead Park (Dr Joyce Galbraith, the archivist of the York Medical Society)

Dr JR Hawkings, a psychiatrist working at Richmond Hill

Dr Pamela G Mason Home Office psychiatrist

 

^ In cahoots  with Henry Hunter of Balderton Hospital?  

and Dr Kenneth Milner of Aston Hall Hospital

via Kaz

“In Nottinghamshire, there were a series of lunatic asylums used to house wayward children. Those that refused to conform to schooling or the structure of family life. Doctors that thought nothing wrong in testing new anti-psychotic drugs and new treatment methods on the inmates…”

“This work was led, from what I can gather, by Dr Henry Hunter of Balderton Hospital in Newark, Notts. Funded by the Sheffield Health Authority, he accessed patients from numerous asylums around the region.

In turn, the doctors from these asylums trawled the children’s homes and secure units, looking for viable subjects for upcoming research or drug trials.”

“Over the years, Dr Hunter, Superintendent of Balderton saw fit to “borrow” patients from other facilities in the area.
Whittington Hall Hospital
Nottingham County and Borough Lunatic Asylum
Harmston Hall Hospital
Glenfrith Hospital
Aston Hall

Treatments included Chloropromazine, Trifluoperazine, Sodium Amytal, Ether, sensory deprivation.”



Police launch investigation into historic abuse claims at Derbyshire children’s hospital Aston Hall

FORMER child patients at a hospital at the centre of abuse allegations have told how they were drugged and thrown into padded rooms “to find out why they were misbehaving”.

“They said they wanted to find out where things had gone wrong when I was a kid, treatments at night time, at eight or nine o’clock. When we saw the car pulling up, we were petrified. We would scream. We were normal healthy children. There was nothing wrong with us. I don’t know why we were there.”

Det Insp Simon Tunnicliffe, head of Operation Hydrant, said: “A number of people have contacted the police wanting to talk about their experiences at Aston Hall.


mental-650095

The psychiatrist and hospital chief superintendent Dr Kenneth Milner (right), is alleged to have injected children with the truth serum sodium amytal before sexually abusing them. 

link

thehorrors

 

Kenneth Oswald Milner was born on June 26, 1909, and educated at Wakefield Grammar School and Leeds University, graduating with honours in 1933 and gained his medical doctorate at the university in 1939.

It said he served as a medical officer in HM Prison Service at Broadmoor Hospital and later as deputy medical superintendent at Rampton Hospital.

This was before being appointed physician superintendent at Aston Hall Hospital in 1947, where he remained until 1975.

http://www.express.co.uk/news/uk/652148/police-investigating-abuse-allegations-Aston-Hall-Derby-Operation-Hydrant-truth-serum

http://www.derbytelegraph.co.uk/just-troubled-teenager-ended-aston-hall-forget/story-28810446-detail/story.html


Establishment Physician – Dr Pamela Mason

pam mason queen

 1984-87 Pamela Mason  Queen’s Honorary Physician

link

pamela mason who's who scan enlarged

Pamela Georgina Walsh Mason married first to David Paltenghi and

then to Director/Producer Jan Darnley-Smith in 1965

pamela georgina mason  paltenghi

MASON Pamela Georgina Walsh, Medical Officer; Psychiatrist, m. (1) David Paltenghi. 1949, dec. 1961, 2 sons, (2) Jan Darnley-Smith, 1 965. Education: Christ’s Hospital School, Royal Free School of Medicine. University of London; MRCS.

 

jan darnley-smith

Career

Dr Pamela Mason Senior Principal Medical Officer at the Department of Health and Social Security

pam mason holloway

Visiting Psychiatrist, Holloway Prison, 1962-67 (When Myra Hindley was there)

link

 

1987

MASON, Pamela Georgina Walsh 34 Goodwood Ct., Devonshire St., London W1N ILSMB BS Lond. … Late: Hon. Phys. HM the Queen; Sen Pnncip. Med. Off. DHSS; Cons. Psychiat. Childr Dept. Home Office

link

Adviser to Church of England Children’s Society 1962-


1967

 

Pamela Mason MB, BS, DPM Consultant Psychiatrist to the Home Office Children’s Department and Visiting Psychiatrist to Duncroft Approved School.

 

 


Social Work Today – Volume 1 – Page 21

https://books.google.com/books?id=h1VFAQAAIAAJ
1970 – ‎Snippet view

Peter Righton of the National Institute for Social Work Training spoke on the relationship between residential and community-based … Dr Pamela Mason, who is psychiatric adviser to the Home Office children’s department, speaking about …

https://www.google.com/search?tbm=bks&hl=en&q=dr+pamela+mason+and+righton



via WW:

All of this was government run and controlled.

 


duncroft savile mason

Jimmy Savile visited Duncroft Approved School for Girls in the 1970s, pictured here, in 1974, with staff members and students

 

Dr Pamela Mason 

Consultant Psychiatrist to the Home Office Children’s Department

and

Visiting Psychiatrist to Duncroft Approved School.

Pamela Mason, who supported the drugging of these children in Richmond Hill Approved School and in Springhead Park Approved School, without parental consent, was the Home Office visiting psychiatrist at Duncroft Approved School where  Jimmy Savile visited and had his own room.

Duncroft, a ‘paedophile sweet shop’…

Savile abused 23 girls at a school for emotionally disturbed teenagers where he was given ‘unrestricted and largely unsupervised’ access to youngsters, a report revealed.

The paedophile DJ carried out at least 46 sexual offences Duncroft School.

He was even allowed to stay overnight and abused girls across the property and in vehicles parked outside, including his Rolls-Royce.

The abuse even took place in the principal’s office

He is also recorded to have twice stayed at Norman Lodge, a hostel in the grounds used as a place of transition for girls who had gained employment, and also visited the intensive care unit twice.

http://www.dailymail.co.uk/news/article-3060559/Jimmy-Savile-abused-23-youngsters-Duncroft-School-emotionally-disturbed-teenage-girls.html

78706595_prince_phil_83670c

Former pupils recall that other visitors included the popular character actor James Robertson Justice and  the Conservative politician, Home Secretary (1957–62)  Rab Butler.

http://www.dailymail.co.uk/news/article-2220802/Meirion-Jones-BBC-war-astonishing-claims-reporter-aunt-saw-Savile-abuse-school.html

link

link

Dan Davies writes about the Duncroft home in his book about Savile:

“Many of the 25 or so girls in its care at any one time came from comfortable backgrounds and included the daughters of ambassadors and BBC producers. As a Home Office-approved school, funding came from Social Services.

Regular guests at their parties included the actor James Robertson Justice, who was one of Britain’s leading film stars in the 1940s and 1950s and reportedly a close friend of the Duke of Edinburgh. Princesses Marina and Alexandra are said to have attended.

Among the former Duncroft girls to have come forward, one has said she was put in the isolation unit for ‘two or three days’ after loudly protesting when Savile groped her in a caravan on the school grounds. ‘For years we tried to report him,’ another confided to me. ‘We even had a mass breakout to Staines police station.’

link

 

 

article-2220802-15785516000005dc-383_320x307

Police cover up Savile’s claims to be friends with Queen’s cousin: Paedophile ‘visited (Duncroft) school at centre of abuse allegations with Princess Alexandra’

article-2550472-1b261e3100000578-94_634x411

Angus Ogilvy and wife Princess Alexandra

  • Paedophile Jimmy Savile mentioned first trip to Duncroft  school at centre of abuse claims
  • He said he was with Princess Alexandra, a patron of the school
  • Made claims during police interview, the transcription of which was edited
  • Information was removed by Surrey Police but has now been unveiled

jimmy-savile-sir-ogilvy-363573

Sir Angus Ogilvy, Princess Alexandra’s husband (left) with Jimmy Savile. All mention of the former DJ’s claims to friendship with the royal was initially omitted from police transcripts

In his 1974 life story Savile wrote: “Princess Alex is a patron of a hostel for girls in care. At this place I’m a cross between a term-time boyfriend and a fixer of special trips out.”

wald-duncroft-collect4.JPG

Jimmy Savile was a frequent guest at garden parties at Duncroft Approved School for Girls  and had his own room there

prince charles savile duncroft cover up poster

The Daily Star Sunday has asked the Information Commissioner’s Office (ICO) to investigate the redactions and consider the arguments any outside bodies made.

As we revealed in May, Government papers showing links between Savile and Prince Charles were redacted.

http://www.dailystar.co.uk/news/latest-news/346148/Royal-cover-up-Police-censor-Jimmy-Savile-interview-transcript


Duncroft – Closed Records for 85 years

duncroft20file20closed_zpsndzr0oh9

Duncroft  – 01/01/1963 – 31/12/1975  

Reports of visits by Home Office inspectors

This record is closed

Closed For 85 years
Opening date: 01 January 2061

 

http://discovery.nationalarchives.gov.uk/details/r/C6099703


via WW

The Walton Hop was situated only five miles from Jimmy Savile’s haunt the infamous Duncroft Approved School.

 Girls were also  allowed to attend the Walton Hop which was within walking distance and were sometimes provided with ‘escorts’

Walton Hop was  the hunting ground for convicted abusers such as Chris Denning, Jonathan King and Tom Paton – the latter of Bay City Rollers infamy.

The management must have been aware of this, permissions granted and ‘escorts’ arranged?

How was it that  the underage patients knew about the abuses, as did other visitors and yet, according to the statement Mind has issued, it would appear that staff and indeed Mind has no knowledge of this?

 

link


 

1968, Dr Joyce Galbraith suggested giving Haloperidol to every girl in the school, for 18 weeks.

Background on Springhead Park School for Girls

A major aspect of the cost of maintaining Springhead Park, Sheffield, and of many other CHEs, was that of the employment of large numbers of staff. This raised the weekly fees to a level that deterred many local authorities from using the service.

In Springhead Park, a CHE for 30 girls, there were a Principal, two Deputies, a Head of Education, three full-time teachers, two Group Leaders and a team of residential social workers, a field social worker, a bursar, two office staff, a cook, a handyman, a gardener and domestic staff. It is hardly surprising that at the time of its closure in 1986 the weekly charge was £423 per week per girl. Part of the explanation for the policy of providing a high child/ staff ratio was the belief that change in the child could be best achieved through effective interpersonal relationships.

http://www.thetcj.org/child-care-history-policy/the-reality-of-closure

springhead20home1_zpsd9kb0jkm

Springhead Park School for Girls age 14-16yrs – provided domestic training and instruction in gardening. 

The establishment also had facilities for the treatment of venereal disease!

 

springhead202_zpsbokhinca


 


http://www.childrenshomes.org.uk/RothwellAS/

richmond and springhead natl arch

 

 1965 Jan 01-1966 Dec 31 Springhead Park Approved School, Rothwell, near Leeds, Yorkshire: opening of the school by Her Royal Highness Princess Marina and speech by the minister of state

Springhead Park Approved School, Rothwell, near Leeds, Yorkshire: reports of visits

1965 Jan 01-1974 Dec 31  

 

This record is closed

Closed For 78 years
Opening date: 01 January 2053

http://discovery.nationalarchives.gov.uk/details/r/C11133104

 

springhead barnados
1975 MIND’s Springhead Park School for Girls  was being considered  for take-over by Barnardos
http://mandatenow.org.uk/wp-content/uploads/2015/04/Operation-Outreach-29-4-2015-11186-link.pdf 

 

Richmond Hill School, Richmond:

richmond hill school 1

 

1950 Jan 01-1965 Dec 31

Richmond Hill Approved School, Richmond, Yorkshire: complaint of irregular punishment

http://discovery.nationalarchives.gov.uk/browse/r/h/C11133102

Richmond Hill Approved School, Richmond, Yorkshire: complaint of indecency

This record is closed

1965 Jan 01-1968 Dec 31

Closed For 93 years
Opening date: 01 January 2062

http://discovery.nationalarchives.gov.uk/details/r/C11133103

richmond20hill20school202_zpsvga0ksey

 


 

Kendall House: Girls drugged and abused at Church of England-run home

13 July 2016

Girls at a church-run children’s home were routinely drugged, locked up and physically, emotionally and sexually abused, a review has found.

Hundreds of girls were sent to Kendall house in Gravesend in the 1960s, 70s and 80s, before it closed in 1986.

It found girls were heavily sedated and placed in straitjackets.

The review found girls as young as 11 were “routinely and often without any initial medical assessment, given antidepressants, sedatives and anti-psychotic medication”.

Drugs were administered in dosages exceeding usual prescribed adult levels to control girls’ behaviour, placing them in a constant stupor, and restricting their ability to communicate, the report said.

The review found: “The effects of the drugs also increased their vulnerability to emotional, physical and in a smaller number of cases, sexual abuse”.

Concerns about the medication regime at Kendall House were raised in the 1970s and 80s by residents, their parents, by some social workers and some employees. “All were either ignored, rebuked, ridiculed or belittled by those in the position of authority in the home,” the report said.

Many of the women, including Teresa Cooper, say they were also sexually abused at the home, sometimes while they were unconscious from the drugs.

Two former residents reported being raped on the premises in the late 70s inside the “locked isolation room”, one allegedly by a male visitor to the home when sedated, the other, allegedly, by several male visitors on different occasions.

“I woke up to people abusing me more than once and I think it’s possible I was abused by men from outside the home as well as staff,” she said.

stream_img

The Home Office consultant psychiatrist in charge, Dr Marenthiran Perinpanayagam , has said in the past that the drugs used by the staff at the home were safe and did not have side effects.

link

link

link

link

link

 

How many kids in care used as drug experiments? must investigate drug companies. What have GSK to fear?

 

Misc

 

pamela mason holloway

1985 Dr Pamela Mason – Holloway Prison/ David Mellor

http://pb.rcpsych.org/content/pbrcpsych/9/12/247.full.pdfd Hill

https://books.google.com/books?id=h1VFAQAAIAAJ&dq=Home+Office+Pamela+Mason&focus=searchwithinvolume&q=+Mason

 

 

Home Office:

Sir Charles Cunningham 1957–1966

He became Permanent Under-Secretary of State at the Home Office (1957-66) during which time he encountered

the likes of R A Butler (Duncroft visitor) and

Roy Jenkins, now Lord Jenkins of Hillhead, with whom he is said to have had a colourful relationship.

(“PIE was so deeply rooted in the realm of the social elite and the political establishment that it had extensive influence. To have these links fully examined now would lead to the exposure of many highly influential individuals as being either practising paedophiles or the promoters of paedophilia. It has to be remembered that Roy Jenkins (Home Secretary & the “Architect of the permissive society”) expressed support for PIE. The organisation also came close to having a private members bill to have the age of consent reduced to just five years of age introduced into Parliament. PIE was also linked to the security services. Some speculate that the security services used PIE to entrap, for the purposes of blackmail, people of influence. I believe that there is now sufficient circumstantial evidence in the public domain to support this assertion.”

https://nationalinquiry.wordpress.com/2015/04/15/open-letter-to-justicegoddard-re-pie-savile-and-nationalinquiry-paedobritain-corruption-csa/)

Sir Charles Cunnigham went on to become chairman of the United Kingdom Atomic Energy Authority (1966-71), chairman of the Uganda Resettlement Board (1972-73), and was a director of Securicor Ltd from 1971-81.

link

Sir Philip Allen Home Office 1966–1972Chairman of the charity Mencap from 1982 to 1988

http://www.telegraph.co.uk/news/obituaries/1570841/Lord-Allen-of-Abbeydale.html

He was also a member of the Diplock security commission for 18 years (1973-91), investigating, among other things, the salacious circumstances which brought about the resignation of Lords Jellicoe and Lambton in 1973 and the spy scandals inside MI5.

link


 

1970  Responsibility for Springhead Park School –  NAMH

1970  Responsibility for Richmond Hill – Local Committee

link

Church of England CSA VIP Cover ups… Bishop Garth Moore, Bishop Michael Fisher and Bishop Peter Ball etc


 There has been no apology from Justin Welby, the archbishop of Canterbury, to whom Joe reports writing 18 letters after the church began examining his case. He had one reply, from a correspondence secretary, assuring him that “the archbishop would hold him in his prayers”.

Dozens of Church of England officials ignored sex abuse victim ‘for decades’ despite being told of horrific abuse at hands of paedophile clergyman Revd Garth Moore

‘I told so many bishops‘: survivor tells of system that protected priest

15 March 2016

For almost 40 years, Joe has struggled to be heard by the Church of England over the sexual abuse that has blighted his life. The depression, anxiety and occasional suicidal thoughts that have dogged him since he was a teenager were, he says, as much the product of the church’s failure to listen to and act on his anguish as the original assault in 1976.

One of the earliest senior members that he told about the abuse  was Michael Fisher, the highly regarded leader of the Society of St Francis and later the suffragan bishop of St Germans in Cornwall.

Bishop Michael Fisher, who was then in his 60s and died in 2003, was acquainted with Bishop Garth Moore and was a close associate of Peter Ball, the former bishop of Lewes, who was jailed last October for sexual abuse.

According to Joe, then aged 18, Fisher “drew the full story out of me in confession. Immediately afterwards, he led me into an intensely romantic friendship with him”…kissing and caressing …This was not the right response to a young man who was seeking help,” says Joe. 

When Joe was 15, Rev Garth Moore, the chancellor of the dioceses of Southwark, Durham and Gloucester and the vicar of St Mary’s Abchurch in the City of London, was a family friend. According to Moore’s obituary, published in 1990 in the Ecclesiastical Law Journal, he was “the foremost canonist of his generation in the Church of England”.

Rev Garth Moore was a very senior figure in the establishment.

St Mary’s Abchurch in the City of London.

St Mary’s Abchurch in the City of London

http://www.theguardian.com/world/2016/mar/15/i-told-so-many-bishops-survivor-tells-of-system-that-protected-priest

Archbishop Carey accused of failing to refer to police detailed ’92 allegations against Peter Ball.

George Carey, who was archbishop of Canterbury at the time when police were investigating claims of sexual abuse by Ball, wrote in support of Ball to the director of public prosecutions and the chief constable of Gloucester police in February 1993.

http://www.theguardian.com/world/2015/dec/31/archbishop-and-mps-wrote-in-support-of-accused-bishop-foi-request-reveals

screen-shot-2015-10-17-at-18-57-481

Diplomat Robert Alston (right –  brother of  convicted paedophile, Richard Alston – left- partner of PIE’s Peter Righton and friend of PIE’s Charles Napier), was on the staff of Archbishop George Carey

http://www.world-traders.org/profileAlston.phphttp://www.world-traders.org/profileAlston.php

http://www.theguardian.com/world/2015/dec/31/archbishop-and-mps-wrote-in-support-of-accused-bishop-foi-request-reveals

 

 photo nott and queen_zpsombovitc.jpg

Another bishop who protected Peter Ball:
Peter Nott, Bishop of Norwich

 photo nott_zpsd1ilpaal.jpg

Sophie Rhys-Jones – One of her mum’s oldest friends- the former Bishop of Norwich Peter Nott

Sophie’s father was a master at Sherborne School


The former Heads of the CSA inquiry have something in common – The Church of England

Elizabeth Butler Sloss and Dame Fiona Woolf

Butler-Sloss Church of England hand picked.

She wanted to exclude some of the survivor’s allegations against Bishop Peter Ball, in a bid to protect the Church of England.

He says she told him she “cared very much about the Church”.

 http://www.bbc.com/news/uk-politics-28274882
More on Sloss:
Butler-Sloss was appointed by the government to chair the child sex abuse inquiry but she stood down after it was claimed that there was a conflict of interest because her brother, the late Sir Michael Havers, was Attorney General during the alleged cover-up of a previous pedophile scandal.

Butler-Sloss ‘kept claims of bishop Peter Ball’s abuse quiet

Child rapist jailed despite support of Lady Butler-Sloss
Lady Butler-Sloss criticised for giving evidence for defence in child rape trial

Elizabeth Butler Sloss is related to the  Sainsbury family

“The Hon. Sarah Sainsbury, daughter of John Davan Sainsbury, married to Hon. Robert Butler-Sloss, son of Elizabeth Butler-Sloss, Baroness Butler-Sloss

en.wikipedia.org/wiki/Sainsbury_family

Sainsbury Family were involved, along with bishop Peter Ball, in Derry Mainwaring Knight Satanist trial

The biggest contributor was Mrs. Sainsbury, who wrote checks totaling $116,000. Next came the chief magistrate and former high sheriff of East Sussex, a wealthy farmer named Michael Warren, who is reported to have given nearly $80,000.

Lord Hampden, Anthony David Brand Deputy Lord-Lieutenant for East Sussex contributed a Rolls-Royce with state-of-the-art communications equipment

The local bishop, the Right Reverend Peter Ball, of Lewes, a monk of whom the judge said, “You may think he is a little unwordly,” also agrees. “Father Peter,”… endorsed Mr Baker’s fund-raising with a note

http://www.nytimes.com/1986/05/04/world/devil-did-it-a-british-man-nets-313000.html

Derry Mainwaring Knight’s trial  … shocking testimony that would blow the lid off Satanic doings at the highest levels of English society.

He “outed” two Tory politicians (William Whitelaw, Enoch Powell) and one Labour MP (Leo Abse) as cult members.
He declared he would have no need to bilk money out of churchgoers, because he was a successful pimp.

Fomer Head of the CSA inquiry Dame Fiona Woolf


Fiona Woolf – Also, Church of England
Woolf  is a member of the Parochial Church Council of St Clement Eastcheap
A parochial church council (PCC) is the executive committee of a Church of England parish

https://ianpace.files.wordpress.com/2014/10/mail-261014-woolf-aide-linked-to-magic-circle-gay-sex-ring-claim.jpg?w=465&h=620

Marie Staunton/NCCL/PIE

Harriet Harman’s successor as legal officer, Marie Staunton, openly defended the affiliation in an astonishingly frank statement of September 1983, which reflected the continued hold of the sexual rights agenda.

The NCCL is campaigning to lower the age of consent to 14. An affiliate group like the Paedophile Information Exchange would agree with our policy.’

 photo staunton_zpswb4uplgu.jpg

Like so many others in NCCL/PIE  saga, Ms Staunton — now a CBE — has gone on to have an elevated public career, enjoying spells as the British director of Amnesty International and deputy director of Unicef in the UK, and head of the international charity Plan International. She is now chair of the overseas  charity Raleigh International.

 Dame Fiona Woolf DBE is a trustee of Raleigh International

Another of her Raleigh trustees is Former Unilever Vice President Patty O’Hayer

Leon Brittan had been a non-executive director of Unilever 2004 – 2010

raleighinternational.org/about-us/trustees-and-governance/

 Raleigh International and Save the Children (Patron Princess Anne) work together

a UK-originated youth and sustainable development not-for-profit organisation

Revealed: who is getting the most money at Britain’s biggest aid charities

2012 £90,001 to 100,000 Marie Staunton, chief executive

Marie Staunton, a trained human rights lawyer, was chief executive of Plan UK for a decade until late 2012. She had previously worked for as a deputy director at Unicef, a director at Amnesty International as as acting general secretary at Liberty.

Ms Staunton writes a blog on the Huffington Post and is also the British independent member on the management board of the EU Fundamental Rights Agency, which monitors racism and xenophobia across Europe.

http://www.telegraph.co.uk/news/politics/10223961/Revealed-who-is-getting-the-most-money-at-Britains-biggest-aid-charities.html


Our history

Prince Charles 1978

1978 – Operation Drake

Colonel John Blashford-Snell and HRH Prince Charles launched Operation Drake, running youth projects from ships circumnavigating the globe

http://raleighinternational.org/about-raleigh/our-history

August 2014

The Freemasons’ Grand Charity donate £50,000 to Raleigh International, in support of disadvantaged young people

http://raleighinternational.org/news-centre/press-releases

Raleigh International chosen as beneficiary of Lord Mayor’s Appeal

November 9th 2013

Raleigh International today announced that it is one of four charities which will benefit from funds raised during the 2013-2014 Lord Mayor’s Appeal. Alderman Fiona Woolf, CBE, elected today as Lord Mayor of London, is a Trustee of Raleigh International and has chosen Raleigh as one of the beneficiaries in the official role’s annual charity appeal.

http://raleighinternational.org/images/Raleigh International chosen as beneficiary of Lord Mayors Appeal.pdf


Enoch Powell and Jimmy Savile

Enoch Powell accused of satanic sex abuse

  • Late Tory MP was one of the most prominent politicians of the 20th century
  • He has been named in Church of England review into historic sex abuse

  • Claims relate to allegations of satanic rituals often involving abuse of kids
  • Powell’s name was given to police by Bishop of Durham Paul Butler

Powell is one of several high-profile names passed to Scotland Yard by Bishop of Durham Paul Butler, who is leading the review.

The Bishop has also handed detectives the name of Leo Abse, the flamboyant Welsh MP who died in 2008 aged 91.

Last night the Church of England confirmed that both names had been passed on to detectives from Operation Fernbridge, a Metropolitan Police inquiry into an alleged Westminster VIP paedophile network.

The Right Rev Butler was given the politicians’ names by Dominic Walker, former Bishop of Monmouth, who heard the allegations when he was a vicar counselling in the 1980s.

Mr Walker told senior clerics that Abse was named by three abuse survivors whom he counselled when he was a vicar in Brighton in the 1980s.

He also passed on the names of two former Conservative cabinet ministers, who have not yet been publicly linked to the scandal. Mr Walker was questioned by the Right Rev Butler after the discovery of a book from 1991 in which he described counselling sessions with adult survivors.

‘A number of survivors independently gave the name of a particular MP being involved,’ he said, adding. ‘I don’t believe there was any collusion in their stories.’

A Church of England spokesman said: ‘The name Enoch Powell was passed to Operation Fernbridge on the instruction of Bishop Paul Butler.’

http://www.dailymail.co.uk/news/article-3017207/Enoch-Powell-accused-satanic-sex-abuse-Bishop-Durham-gave-Met-detectives.html


Enoch Powell and Harvey Proctor –

Enoch Powell was an idol of Harvey Proctor

Harvey Proctor’s solicitors were Denby & Co – Sir Richard Denby AND Peter Jonathan Denby.

 

It is through Enoch Powell that another intriguing strand in the life of Harvey Proctor appears. This is his personal friendship with missing lawyer Peter Denby who used to work as an assistant to Enoch Powell.

Peter Jonathan Denby, a former aide to Enoch Powell and friend of Conservative Member of Parliament Harvey Proctor

https://spotlightonabuse.wordpress.com/2014/10/16/harvey-proctor-cottonrose-ltd-and-the-conservative-party/


Later he telephoned Proctor and left a message on his answering machine, saying: “I know I’m wanted but I can’t give myself up yet.” Proctor said he was “worried about him.”

While on the run after holding cops at gunpoint, Denby contacted Swinton Circle Bee Carthew, Powell … and Harvey Proctor!

Crafty muvva

He & Denby had just attempted (unsuccessfully) to sue the BBC. Elm Guest House very much happened & Leon Brittan was named, not by police, media etc, but by residents. The Times were alerted to it many years ago & chose to ignore. Lengthy coverup.

tinyurl.com/pgja7jp

karmic kick

According to Chief Supt Anthony Stevens

The incident was more likely to have stemmed from another crime that had gone wrong.

Dame Alun Roberts ‏@ciabaudo

Jonathan Denby, Proctor’s solicitor, got off lightly for his crimes and is now running a hotel in the Lake District.

Fifty Shades of Grey known for its graphic sexual nature replaces bible at hotel and brings backlash for Damson Dene Hotel owner Jonathan Denby

link

Dame Alun Roberts ‏@ciabaudo

Sir Richard Denby, a former president of the Law Society like Fiona Woolf, lived in Leon Brittan’s old Yorkshire constituency?

Plus Savile & Jaconelli in Scarborough & all those Tories at Swinton College

Jonathan Denby and Barbara Hewson are first cousins.

Barbara Hewson, Leading Barrister, Says Age Of Consent Should Be 13 And Criticises Operation Yewtree

http://www.huffingtonpost.co.uk/2013/05/09/barbara-hewson-says-age-of-consent-should-be-13_n_3242798.html

 karmic kick

(Barbara) Hewson and her crew have been rabid about smearing Dickens and debunking the dossiers since the start of this.

Other interesting family links – Barbara Hewson’s mother, Kathleen Joan Denby, worked at Bletchley Park

link

link


 Barbara Hewson and Butler- Sloss/Havers links:

Barbara Hewson, Butler-Sloss & Helena Kennedy attending.

cte3deew8aaetpb


Barbara Hewson  sits on board (Justice Journal editorial advisory board) with Elizabeth Butler Sloss’ nephew Philip Havers QC:

Philip Havers QC – nephew of Elizabeth Butler-Sloss

justice journal hewson havers 2

justice journal hewson havers 2

 

Justice.org

Our people – England & Wales

helenakennedywomenyearluncharrivalsngq2o9nefirl

Chair of Council, Baroness Helena Kennedy of the Shaws QC

Council

hrh_hk

camillaparkerbowleseleanorcattonwinswgdynvkk9tjl

View image on Twitter


The Master and Fellows are delighted to announce that Baroness Elizabeth Butler-Sloss has been elected an Honorary Fellow of Corpus.

Baroness Elizabeth Butler-Sloss has many close connections with Corpus.  Her father, Sir Cecil Havers, was an Old Member, as were her brothers, Michael (m 1946) who became Lord Chancellor in 1986, and David Havers (also m 1946).  More recently, her son Robert (m 1981), and her nephew, Philip Havers QC (m 1969) have kept the Corpus link alive.

link


Misc

 photo har3_zpsc479171f.jpg

Harriet Harman & Marie Staunton CBE in Ghana

Rev Fisher was a Bishop to Her Majesty’s Prisons 1985


 

Church of England warned bishops not to apologise too fully to sex abuse victims  

“The approach to survivors is often a corporate model and this document supports that – it shows a church led by lawyers and insurers, you get the impression that these people are really their masters.

“A diocese is deferential to their bishop and the bishop is deferential to a bunch of lawyers.

“The Church will say ‘our hands are tied’ but they are paying the people who are tying their hands.

Survivors said it showed there was a culture of denial, dishonesty and “blanking” victims in ways which had heightened their pain and ultimately failed to tackle the roots of the abuse crisis.

It follows a damning independent review of the Church’s handling of sadistic abuse by Garth Moore, a priest and top canon lawyer, in the 1970s.

It highlighted how the teenager – known as “Joe” – revealed his ordeal to a string of leading clerics, three of them later ordained as bishops, who then claimed not to remember anything.

http://www.telegraph.co.uk/news/2016/08/21/church-of-england-warned-bishops-not-to-apologise-too-fully-to-s/

 

https://www.churchtimes.co.uk/media/5199289/garth-moore.jpg

Rev Garth Moore was a Speaker at Butlins Holiday Camp at Skegness


Butler Sloss’ brother Havers/ Sir Peter Hayman etc

Denby investigated for accepting a bribe from the Iranian State shipping Line?

troy

Peter Hayman heavily involved in shipping lines. CEO of Seatrade


The North Yorkshire aspect and Operation Spade

The North Yorkshire Enquirer believes that one of the paedophiles named in the dossier handed to Whitby MP Leon Brittan, when he was Home Secretary, by Mr Dickens in 1983, was Britain’s most successful and longest offending paedophile and rapist Peter Jaconelli, who was exposed by the NYE team.

It is entirely credible that Jaconelli was one of the prominent persons mentioned in the dossier that Mr Dickens passed to the Home Office. It is also possible that the dossier had information on Jimmy Savile, who was equally well-known for offending openly in Whitby, in joint enterprise with Jaconelli.

The West Yorkshire Police investigation into why it failed to arrest Savile was widely castigated as a whitewash.  So was the North Yorkshire Police investigation. NYE investigation here. As with the Home Office and MI5, intelligence files appeared to have conveniently disappeared

nyenquirer.uk/child-abuse-wanlesswhittam-report-published/

Satanists On The Prince’s Land

Daily Express (28th August, 2006)

http://www.westcoast-news.org/story-satanists.htm

https://goodnessandharmony.wordpress.com/2016/05/21/church-of-england-csa-vip-cover-ups-bishop-garth-moore-bishop-michael-fisher-and-bishop-peter-ball-etc/

Cambridge-educated deputy head of St. Benedict’s Catholic private school jailed for horrific stash of porn images featuring children as young as two

 

 photo 8641cc1d-e8ca-4b49-b942-b4e688ff9dc2_zpswfj204at.jpg

 photo patten patron_zpstu8at6wv.jpg

BBC chairman Chris Patten is facing claims he helped cover up key evidence about the Jimmy Savile sex abuse scandal.

http://www.dailymail.co.uk/news/article-2521976/BBC-chairman-Chris-Patten-Patten-accused-cover-BBC-Savile-probe-blunder.html

Lord Patten, previously from the paedophile-infested BBC is Patron of the paedophile-infested school where Allott has worked since 2004

The school has been dogged by scandal after one teacher was convicted of nearly four decades of sexual abuse of children and another priest is still on the run from a child abuse charge.

The school and its linked Benedictine monastery, Ealing Abbey, was condemned four years ago for a ‘lengthy and cumulative failure’ to protect pupils in its care from child abuse.


Who on earth would feel safe their children were safe at that school?

No statement from patron Chris Patten on the abysmal governance at his school.

Patron:

One that supports, protects, or champions someone or something.  

A noble or wealthy person in ancient Rome who granted favor and protection to someone in exchange for certain services.

 photo st bene_zpsjakuhppb.jpg

Allott – Hi flyer, Cambridge-educated, former Tory councillor, member of David Cameron’s “Big Society” initiative is a member of “paedophile ring”


1/6/2016

Update

Patrick Rock, former aide to David Cameron, has been convicted of five counts of making indecent images of children.

link


Wonder if Peter Allott has any connections with Patrick Rock ?… another of David Cameron’s policy people charged by police over child abuse images and who has also worked under Chris Patten


Cameron brought Rock back into Downing Street in 2011, appointing him deputy head of the influential No 10 policy unit.

http://www.theguardian.com/uk-news/2014/mar/04/patrick-rock-tory

Rock was deputy head of David Cameron’s policy unit at the time of his arrest and they have known each other since the late 1990s.

Patrick Rock became an advisor to various Ministers during the 1990s, including Michael Howard and also Chris Patten

Patrick Rock is due back in court this month – big secret as to the exact date – no mention in msm.


At the time of his arrest, Allott was the deputy head teacher at St Benedict’s


He was identified after intelligence was received that an individual had been using video conferencing facilities to share indecent images of children with other paedophiles around the UK.


Judge Peter Hillen said :

…engaged in public service and political service. Someone who has engaged in charity work. Someone who was a high flyer

  ‘It was at the drug parties that you became aware of, and addicted to, indecent images of children. I use the phrase of a PAEDOPHILE RING, that’s precisely what that was.


Allott, a former Tory councillor, who served on the Perivale ward from 2006-2010

Peter Allott, 37, worked at £15,000-a-year school in London but now jailed for 33 months

When detectives from the National Crime Agency’s specialist child abuse team arrested Allott in December last year, they found nearly 700 illegal images and videos of children and extreme pornography.


The deputy head of a scandal-hit Catholic private school was jailed today after admitting getting hooked on child pornography blowing £600 a week on paedophile drug parties.

The Cambridge–educated deputy headteacher became addicted to child sex images and Class A drugs after being introduced to both at ‘chemsex’ parties organised on gay dating app Grindr.

He amassed nearly 400 horrific images of children as young as two, which he kept on his iPhone and on a hard drive in his office at the £15,000-a-year St Benedict’s School.

The private school in Ealing, West London, which counts comedian Julian Clary, Tory peer Chris Patten and actor Andy Serkis amongst its alumni, has been dogged by scandal after one teacher was convicted of nearly four decades of sexual abuse of children and another priest is still on the run from a child abuse charge.

The school and its linked Benedictine monastery, Ealing Abbey, was condemned four years ago for a ‘lengthy and cumulative failure’ to protect pupils in its care from child abuse.

The  scandal led to five monks and three former teachers being linked to child abuse.

 Allott was working at the school at the time of the abuse

Allott, originally from Barnsley, swapped images with a notorious paedophile, who used the internet name ‘Londonpaedo’ through Zoo. The internet sharing facility allows for an online conference call where perverts could chat and exchange images.

He studied history and politics at Hull University and gained a second degree in theology at the University of Durham. 

He became an economic and politics teacher at St Benedict’s when aged 25, and was elected to Ealing Council for the Conservatives in 2006. 

After a stint studying in Cambridge, Allott returned to St Benedict’s and was at the time of his arrest studying for a doctorate. 


Paedophile Peter Allott left for a year in 2011 to work as a research associate for a project on the Prime Minister David Cameron’s “Big Society” initiative and Catholic social teaching at Cambridge University.

Allot’s published work on Cambridge website

<script><script><script><script><script><script><script> <script><script><script><script><script><script><script><script><script>

 photo allot_zpsnv9qshwi.jpg

http://www.polis.cam.ac.uk/about-us/publications-from-polis-1/publications-from-polis-2013


Allott, taught at St Benedict’s  from 2004  and was promoted to deputy head in 2012


Allott, a former Tory councillor, who served on the Perivale ward from 2006-2010…engaged in public service and political service. Someone who has engaged in charity work. Someone who was a high flyer.

Michael Shaw, for the prosecution when asked about the fate of the children in the images, he said: ‘I would be surprised if some of them were still alive.’

Allott admitted possessing 25 ‘grossly offensive’ images on a hard drive and sharing the images with other offenders

http://www.stbenedicts.org.uk/governors

http://www.dailystar.co.uk/news/latest-news/480283/Ealing-private-school-st-benedicts-deputy-charged-child-abuse


St Benedict’s Fr Laurence Soper

Sept 2016

Soper Trial

soper-sept-19-2016-trial


https://goodnessandharmony.wordpress.com/2016/05/06/cambridge-educated-deputy-head-of-st-benedicts-catholic-private-school-jailed-for-horrific-stash-of-porn-images-featuring-children-as-young-as-two/

 

Murdered Bodies on Royal Estates/Prince Philip and Jimmy Savile/Records Sealed for 100 years

Truthseeker1 ‏@thewakeupcall09

Why are the records of murdered 7 year old Christine Butcher closed till 2047 ?

Unsolved murder of Christine Vivian Butcher (7 years) at Windsor, Berkshire, on 8 July 1951.

This record is closed

Closed For 74 years
Opening date: 01 January 2047

http://discovery.nationalarchives.gov.uk/details/r/C10887911

Was there a member of the royal family involved?  Why would those files from a murder in 1951 be closed for so long?

Who is being protected?  What is being covered up?


July 1951

Boxer Sugar Ray Robinson, a 3-to-1 favourite, trained in the shadow of Windsor Castle.

A strange thing happened the day prior to the bout: a young girl named Christine Butcher, aged only seven years, went missing while venturing off to visit Robinson at his camp only 30 metres away, kicking off a feverish police search.

En route to the weigh-in on Windmill Street in London, the streets were so choked with people that Robinson’s Cadillac was literally pushing its way through the crowd. Traffic was stopped in all directions at Piccadilly Circus, with reports stating it was the biggest crowd of people to take to the streets of London since V Day — the day when the Allied powers celebrated victory over the Axis powers six years earlier. Robinson was a half-hour late to the weigh-in because of the traffic.

An A.P. report out of Windsor read: “Christine had a doll that she imagined looked like Sugar Ray. She set off yesterday to show the doll to the champion. No one has reported seeing her since.” It was little more than an afterthought among the more pressing news, like how much heavier than the champion Turpin would scale, but it would later become haunting.

As the two men were toiling inside the ring, an investigation was underway;

The body of young Christine Butcher had been found not far from Windsor and “a white man in a grey suit” was sought for questioning. Her murder kicked off six weeks of similar crimes.

She was murdered on Sunday 8th July 1951 and found on 10th July.

<script><script><script><script><script><script><script> <script><script><script><script><script><script><script><script><script>

 photo ed55cac1-63b9-4746-b905-d8e5b4abfa34_zpsdmtbqnos.jpg

It’s interesting that Christine was on her way to meet Sugar Ray Robinson:

Robinson was a high-ranking mason, and was for a time in a relationship (some sites say married) to Mary Ann Degrimston, co-founder of the (CIA-linked) satanic Process Church, which famously interviewed Savile for the “Sex” issue of their magazine.

Degrimston later worked as an escort in London and may have been involved with the Profumo scandal.

link

Sugar Ray Robinson was a Prince Hall Freemason

http://www.masonrytoday.com/index.php?new_month=5&new_day=3&new_year=2015

http://www.theguardian.com/music/2014/jul/02/secret-jazz-freemason-history-duke-ellington-sun-ra


The body of 7 yr-old Christine Butcher (who had been violated before and after her murder) was found in Stephen’s Field of Windsor Park

Stephen’s Field is in the grounds of the castle.

 The Festival of Britain floats on their way to Stephen’s Field...In September 1951 at the time of the procession everyone in Windsor knew where it was because just two months earlier, on 10th July, the body of 7-year old Christine Butcher was found there. The papers were full of it. The crime was never solved.

 

The Windsor Forest Bowmen (Patron Prince Philip) give their location as St Stephen’s Field, Home Park.

They say that it is at the far end of Romney Lock Road, past the rugby club and cricket club, next to some very large trees.

theroyalwindsorforum.yuku.com/topic/1368/St-Stephens-Field-including-1951-Festival-of-Britain?page=2#.VxQsw3pGQpo

Windsor Forest Bowmen

Windsor Forest Bowmen was formed in 1951 and was granted Royal Patronage with His Royal Highness the Duke of Edinburgh, Prince Philip, accepting the appointment of Club Patron.

We are a target archery club catering for Recurve, Compound and Longbow. We also cater for traditional (hunter type) and barebow styles as some of the club members branch out into field archery. We enter winter and summer postal shoots as well as going to various competitions in the local area and sometimes further afield.

We are fortunate to have sole use of St Stephen’s Field, part of the Windsor Home Park Recreation Ground for our shooting activities; Windsor Castle providing a fitting backdrop.

www.vanzyl.co.uk/wfb/abouttheclub.htm

webcache.googleusercontent.com/search?q=cache:xEBN74km7mkJ:www.boxingmonthly.com/stories/robinson-turpin-i/+&cd=3&hl=en&ct=clnk&gl=us

The 1951 Festival of Britain celebrations… St Stephen’s Field, where the procession in 1951 ended up

Here is a facsimile of the programme for the local parade celebrating the Festival of Britain in September 1951 following a summer of events around the country. It was a major event by all accounts, with all the local schools, military and clubs taking part.

Royal Windsor Parade – Stephen’s Field 1951

^ Lots of youth organisations involved e.g. Girl Guides Association

and the Windsor Archery Club, Windsor and Eton Amateur Boxing Club, Star and Garter Riding School participating


Savile’s whereabouts in 1951

He competed as Oscar ‘The Duke’ Savile Aug 1951 Tour of of Britain cycle race

1951 – Age 24, Company director, Leeds Olympic,

4th Ayr-Carlisle 1951, known as “The Duke”

2nd Edinburgh-Newcastle 1950,

link

link

 

1951 Film: A Boy, a Girl and a Bike with Diana Dors  and Honor Blackman

Jimmy Savile also had a part in  A Boy, a Girl and a Bike

A Boy, a Girl and a Bike. Jimmy Savile can be seen on the right of the picture - just next to the man in the flat cap and smoking a pipe.

Jimmy Savile can be seen on the right of the picture – just next to the man in the flat cap and smoking a pipe in

A Boy, a Girl and a Bike.

http://www.yorkshirepost.co.uk/what-s-on/cinema/sir-jimmy-a-bike-blue-skies-hot-dinners-and-the-dream-time-1-3937514

Speaking in 2006, aged 80, Jimmy Savile was remembering his first brush with showbiz. It was spring 1948, and director Ralph Smart was on location in Skipton making the romantic drama A Boy, a Girl and a Bike, starring Diana Dors and Honor Blackman.

Dors by Diana p. 77 in Love Sweet Love she talks of filming at Hebden Bridge

The film is regularly screened at the Hebden Bridge Picture House to a full house.

link

Savile was a regular visitor to Hebden Bridge.

Sir Jimmy Savile during a visit to St John's church, Cragg Vale

Sir Jimmy Savile used to stay in a caravan at nearby Cragg Vale but was never interviewed by police.

Calls for investigation into murder of girl, 13, who was dumped in a canal in 1994 just miles from where shamed Jimmy Savile used to take holidays

  • Lindsay Jo Rimer was murdered in Hebden Bridge, West Yorkshire
  • But the case remains unsolved after 19 years
  • It has emerged that Savile would often holiday just miles from her home

Police have said they do not know Savile’s movements in November 1994

He made no public appearances that month and was not making programmes for the BBC.

Lindsay’s family lived at Lower Rough Head Farm, near Savile’s holiday spot before moving into Cambridge Street, Hebden Bridge, before her disappearance.

http://www.hebdenbridgetimes.co.uk/news/local/vicar-backs-police-investigation-into-possible-jimmy-savile-links-to-hebden-bridge-and-schoolgirl-murder-of-lindsay-rimer-1-6167522

http://www.dailymail.co.uk/news/article-2468322/Calls-investigation-murder-girl-13-dumped-canal-1994-just-miles-shamed-Jimmy-Savile-used-holidays.html


Diana Dors’ wild parties

Glimpsing orgies at 11 and offered drugs aged five, Diana Dors’ son reveals how wild parties were the norm in his childhood home

http://www.dailymail.co.uk/femail/article-2296497/Diana-Dors-son-Jason-Dors-Lake-reveals-wild-parties-norm-childhood-home.html

Diana Dors and Stephen Ward

https://forum.davidicke.com/showpost.php?p=1061804030&postcount=76958

What did Max Clifford witness at Diana Dors’ libidinous parties?

Max Clifford told Southwark Crown Court that he attended the sex parties in his ‘younger days’.

http://www.dailymail.co.uk/news/article-2592006/So-did-Max-Clifford-witness-Diana-Dors-libidinous-parties.html


Diana Dors held wild parties and drugs were offered to her 5 year old son at one. Bob Monkhouse was a regular attender … drug and sex orgies …in the 60s and beyond.

http://www.dailymail.co.uk/femail/ar…hood-home.html

https://forum.davidicke.com/showpost.php?p=1061804030&postcount=76958


Actress Honor Blackman lends support to the Liberal Party as she joins Johnnie Savile, brother of broadcaster Jimmy and candidate for Battersea North, London, on a canvassing tour of the constituency.

Honor Backman and Johnnie Savile

23rd February 1974: Actress Honor Blackman lends support to the Liberal Party as she joins Johnnie Savile, brother of broadcaster Jimmy and candidate for Battersea North, London, on a canvassing tour of the constituency.

http://liberalengland.blogspot.com/2012/11/jimmy-saviles-brother-was-liberal.html

https://forum.davidicke.com/showthread.php?t=222773&page=3029


Diana Dors and Prince Philip also involved in Profumo affair

Prince Philip and a delicate question: Why HAS ‘sensational’ Profumo file been buried for another 30 years?

More than 50 years after the scandal, there is clamour to release a file

http://www.dailymail.co.uk/news/article-2550297/Uncovered-The-secret-two-way-mirror-gave-bedside-view-Profumo-affair-flat.html

Prince Philip with Jimmy Savile wearing a Tea-rific shirt

During 1974 and 1975 Savile was holding annual fundraising events ‘Tea-rific’ for NAYC and while writing his autobiography (published in 1974) referred to himself as Vice-President to Angus Ogilvy’s President.

 


British Boys Boxing World

Prince Philip Patron of FEDERATION OF LONDON BOYS’ CLUB BOXING

 

<script><script><script><script><script><script><script>

<script><script><script><script><script><script><script>

 photo boxing philip_zpsyix6wt0c.jpg

The Duke of Edinburgh, who has become patron of the Federation of London Boys Clubs, watched their boxing finals at the Royal Albert Hall.

Julian Gibbs Vice-Chairman of the London Federation of Boys Clubs in 1971

On 22 October 1974

Gibbs had hosted a fundraising and networking evening for  PIE-linked Albany Trust, attended by Rev. Michael Butler, David Barnard and Antony Grey.

https://bitsofbooksblog.wordpress.com/tag/sir-harold-haywood/

Julian Gibbs

1951-53 2nd Battn. Green Jackets, 2nd Lieutenant. 1953-55 Queen’s Westminster Rifles (T.A) Lieutenant.

(^2nd Battn. Green Jacketssame battalion as Lord Edwin Bramall )

(Julian Gibbs on the Livery of the Grocers’ Company 1961. Vice-Chairman London Federation of Boys Clubs 1971. Chairman of the PM Club since 1970. Governor of the Royal Victoria Hall (Old Vic) since 1974. Vice-President of the Insurance Institute of London 1972.

Clubs: Carlton, Beefsteak, Pratt’s.

Julian Gibbs’ mother:

Helen Margaret Leslie CBE

Various posts with the Girl Guide Association, including County Commissioner, Herts. (1938-46)

She gave special support to the National Society for the Prevention of Cruelty to Children NSPCC

link

link

http://www.aparchive.com/metadata/youtube/ac6724248bbe4f39912937eacfbbdc93

1973 Variety Club Run – all sorts involved…boxers, Savile etc…guest of honour Prince Philip

 photo philip savile_zpspgtuisdl.jpg

https://books.google.com/books?id=EuQ_CgAAQBAJ&pg=PT207&lpg=PT207&dq=jimmy+savile+broadmoor+patients+windsor&source=bl&ots=F6hsvqjdjy&sig=uj2Q5LwlxQgh67YM4Nd7qmnqw_A&hl=en&sa=X&ved=0ahUKEwjq-KK11JjMAhXDeT4KHZ5VCGMQ6AEIXjAJ#v=onepage&q=jimmy%20savile%20broadmoor%20patients%20windsor&f=false



“Savile did whatever he wanted at Broadmoor and nobody could stop him.”

As accusations against the shamed star last night continued to mount, the Daily Mirror can also reveal

 Savile arranged for 60 patients, including convicted murderers, to be granted early release.

But for the patients who remained, Savile used his trusted status at the hospital in Crowthorne, Berks, to organise day trips for patients to the Queen’s back garden at Windsor Great Park and aboard a luxury boat on the Thames.

He also invited bands into the hospital grounds, then home to patients including Yorkshire Ripper Peter Sutcliffe and gangland boss Ronnie Kray, to stage exclusive concerts.

A former employee at Broadmoor, who knew Savile but asked not to be named, said: “He had access to all areas.

http://www.mirror.co.uk/news/uk-news/jimmy-savile-child-abuse-sexual-1380981

‘Child perverts soon become child killers’: Jimmy Savile was questioned by police over Yorkshire Ripper murders

Savile was questioned by detectives comes after it was reported that the body of Sutcliffe’s third victim Irene Richardson was discovered just yards from Savile’s flat.

http://www.independent.co.uk/news/uk/crime/child-perverts-soon-become-child-killers-jimmy-savile-was-questioned-by-police-over-yorkshire-ripper-8290236.html


Broadmoor

HC Deb 11 July 1985 vol 82 cc533-4W 533W  §

Mr. Peter Bruinvels asked the Secretary of State for Social Services

(1) if he will take steps to prevent patients at Broadmoor from being allowed out on visits; (2) why patients from Broadmoor were recently allowed to visit Windsor; and if he will make a statement.

 

 

clarke20award_zps6kvd6nbk

§ Mr. Kenneth Clarke

Visits outside Broadmoor hospital and the other special hospitals are an important element in patient rehabilitation programmes. The visit to Windsor to which my hon. Friend refers took place in July 1984 without any complaint from anyone at the time. Decisions on patient outings or other visits are matters for the clinical judgment of responsible medical officers. In the case of restricted patients, absences from the hospital require the approval of my right hon. and learned Friend, the Home Secretary. (Leon Brittan – 1985)

Patients taking part in group outings are escorted continuously by nurses from the hospitals. I am quite satisfied that there is no unacceptable degree of risk to the public from such visits.

2-21439039

The Royal Windsor Horse Show and the Windsor Rose Show take place within the Windsor Park.

link

link

Broadmoor paedophile ring (In 1986 & 1997)

Savile had been working as a volunteer at Broadmoor since the 1970s and would have been working there at the time of the 1986 allegations

Savile – Broadmoor & Necrophilia

https://spotlightonabuse.wordpress.com/2013/12/06/there-was-evidence-of-a-broadmoor-paedophile-ring-in-1986/


Sugar Ray Robinson and the Process Church

Let’s play 6 degrees of separation with Annie Besant, Charles Leadbetter, Charles Manson, Mary Ann MacLean, Mary Tyler Moore and Sugar Ray Robinson… the connections are diabetes, animal rights, cults and people who travel with an entourage.

“Sugar Ray Robinson was the pioneer of boxing’s bigger-than-life entourages, including a secretary, barber, masseur, voice coach, a coterie of trainers, beautiful women, a dwarf mascot and lifelong manager George Gainford. When Robinson returned to Paris in 1962—where he was a national hero—to get him to cross the seas the French had to promise to bring over his masseur, his hairdresser, a guy who whistled while he trained, and his trademark pink Cadillac.

The Process Church of the Final Judgement was founded by Mary Ann MacLean and Robert DeGrimston Moore. Several sources report her as having once been married to Sugar Ray Robinson

link

https://goodnessandharmony.files.wordpress.com/2016/08/8de73-jsinterview.jpg?w=436&h=606

The satanic Process Church, which famously interviewed Savile for the “Sex” issue of their magazine

A Strange Hub: What Were UFOs, The Process Church, Roman Polanski, David Litvinoff, the Krays, Eric Clapton, Jimmy Savile, & Whitley Strieber Up To in 1968 London?

Savile was interviewed for a 1969 issue of The Process magazine, the “Sex” issue. The piece was called “The Natural Life of Jimmy Savile.”) This places Savile in the same circle as the Krays, the Cammells, the Claptons, and The Process

link


Savile told hospital staff he performed sex acts on corpses in Leeds mortuary

Former TV presenter said he posed with bodies in lewd positions and stole glass eyes, Broadmoor nurse tells investigators

Jimmy Savile told hospital staff he interfered with patients’ corpses, taking grotesque photographs and stealing glass eyes for jewellery, over two decades at the mortuary of Leeds general infirmary.

The late Top of the Pops presenter had free access to the mortuary from the late 1970s to the mid-1990s, an official investigation has found, concluding that Savile’s interest in the deceased was “not within accepted boundaries”.

Savile was said to have been best friends with the chief mortician of Leeds general infirmary, who is now dead, and had regular unsupervised access to the mortuary from the late 70s until the mid-90s.

Massive Cover-ups – Prince Philip

There are at least 27 D-Notices in place to prevent details of Philip’s sordid predilections getting into the public domain. The notices last for a staggering 100 years.

According to the Mirror:

SECRET files about Prince Philip’s private life are to remain locked behind closed doors for 100 years.

Most confidential Cabinet documents relating to relating to the royals and government are covered by the “30-year rule”.

But at least 27 royal files in the vaults of the Public Records Office at Kew, West London and many of , are considered so delicate they are labelled: “Closed for 100 years“.

More than 10 concern astonishing MI5 and Scotland Yard reports on the Duke Of Edinburgh’s private life.

As an explosive new biography of the Queen hints that the Greek-born Prince was unfaithful to the Queen, we can reveal that Buckingham Palace courtiers and security chiefs were once so concerned about Philip’s non- royal activities that they ordered round-the-clock surveillance.

They feared the Royal Family would be compromised and that there would be a constitutional crisis if news leaked out of how the Prince was behaving.

He was known to be “letting his hair down” with celebrities of the day at weekly meetings of the Thursday Club above exclusive Wheeler’s Restaurant in Soho.

One senior detective, now retired, who was attached to the Prince’s protection team, said: “It’s true we had to report back on where we had been and who had been present.”

But he refused to discuss the Prince’s private visits.It is not known what details of Prince Philip’s private life were made known to the Queen or the Privy Council. But it will not be until the years 2052 to 2060 that they will be released – if then.”

https://thecolemanexperience.wordpress.com/2014/02/02/prince-philip-filthy-secrets-princess-diana-jimmy-savile-and-the-100-year-d-notice/


Jimmy Savile Takes Young Girl To Prince Philip in Buckingham Palace.

 


Another murdered girl is found on the grounds of  a different royal family estate – Sandringham – the castle where convicted establishment paedophile Jeffrey Epstein visited and hunted.

 photo sandringham murder_zpshter0vvt.jpg

Murdered girl found near royal stud farm

British police said that a young woman’s body was found in the forest at Sandringham and that they are treating it as a murder case.

Queen Elizabeth II and her family gathered in rural splendor to celebrate Christmas and New Year’s.

Sandringham has long been one of the queen’s favorite residences, especially during the holidays.

The royal family also typically enjoys horseback riding and shooting parties at Sandringham

Buckingham Palace officials are staying mum about the murder case.

http://www.nbcnews.com/id/45850427/ns/world_news-europe/t/murder-inquiry-after-female-remains-found-uk-queens-estate/#.VxToYnpGQpo

It is one mile from the entrance to Sandringham House and half a mile from the Sandringham Stud where the Queen breeds racehorses.

Prince Philip normally leads shooting parties on the estate and has previously been seen with his gun in the field next to the wooded area.

http://www.dailymail.co.uk/news/article-2081529/Sandringham-house-Human-remains-dog-walker-Queens-estate.html

An inquest into the death of Lithuanian teenager Alisa Dmitrijeva will take place more than two and a half years after her body was found on the Sandringham Estate

The last positive sighting of her was in Friar’s Street, King’s Lynn at 12.15am on Wednesday 31 August 2011, where she was seen in a green Lexus car with two men.

Despite extensive enquiries and tests, police have been unable to confirm exactly how or when Alisa died.

They are also appealing for anyone with information about her black LG GM360 phone which is also missing.

The last signal her phone gave out was at the nearby Sandringham estate.

Despite the inquest today the case of Alisa’s death does remain open

http://www.itv.com/news/anglia/2014-09-15/inquest-into-death-of-latvian-teenager-found-on-royal-estate/

WHAT IS WITH THE ROYAL FAMILY & DEAD BODIES?

https://spidercatweb.wordpress.com/2015/10/02/what-is-with-the-royal-family-dead-bodies/

Prince Philip loves “blood-sports”

The now-frowned upon custom of a royal hunt was, at the time, a popular past-time amongst royals and wealthy

In 1961, Prince Philip went ahead with the hunt despite protests from British and Indian politicians.

On the same trip he is said to have killed a crocodile and six mountain sheep.

Critics of the Duke’s fondness for hunting claim he has shot at least 30,000 pheasants in Britain alone and has also killed deer, rabbit, wild duck, pigeon and partridge.

http://www.express.co.uk/news/royal/595424/Queen-Prince-Philip-pose-dead-tiger-50-years-before-Cecil-lion-controversy


Visit: Epstein was hosted by Prince Andrew at Sandringham,The Queen's home in Norfolk

Visit: Paedophile Jeffrey Epstein was hosted by Prince Andrew at Sandringham,The Queen’s home in Norfolk

Jeffrey Epstein ‘kept a diary of his under-aged victims

The Duke of York’s billionaire paedophile friend kept a secret journal, described as “The Holy Grail” by lawyers, which listed his alleged under-aged victims and the celebrity guests he entertained at his Florida mansion.

Jeffrey Epstein and Ghislaine Maxwell at Sandringham in 2000 Photo: ALBANPIX


Jeffrey Epstein and Ghislaine Maxwell were among guests on this pheasant shoot, attended by Andrew (right), at Sandringham, Norfolk, after the Prince and the US businessman became friends

link

The billionaire financier, who attended The Queen’s birthday party in 2000, was sentenced to 18 months in prison in 2008

Prince Andrew’s billionaire convicted paedophile friend, Jeffrey Epstein, given permission to land his private jet at RAF base for visit to Sandringham

The flight log of Epstein’s Gulfstream revealed it touched down at RAF Marham on December 7, 2000, before he was hosted by the Andrew at the Queen’s Norfolk residence.

Civil aviation authorities called the situation ‘unusual’.

He is alleged to have used his fleet of private aircraft to traffic under-aged girls around the world for sex.

Entries in the Gulfstream’s flight log reveal he regularly flew alone with Virginia Roberts, who has claimed she was used as a ‘sex slave’ by Epstein from the age of 15. Roberts was photographed with the Duke.

www.dailymail.co.uk/news/article-1364742/Jeffrey-Epstein-Prince-Andrews-billionaire-paedophile-friend-visit-Sandringham.html

The Palace has declined to say, for example, why Andrew was in the company of a 17-year-old masseuse working for Epstein at Maxwell’s home.

The Palace also refuses to answer questions about Andrew’s friendship with Epstein, or confirm the several occasions the two men appear to have partied together.

Those reported encounters between Epstein and Andrew, some of which appear to be corroborated by flight logs for Epstein’s private planes, which have been reviewed by the Guardian, stretch back more than a decade.

They include parties at Windsor Castle and Sandringham, the Queen’s Norfolk estate,

an exclusive dinner in St Tropez and a holiday in Thailand…

Indeed, the Palace has never offered a public explanation for Andrew’s most controversial meeting with Epstein, which occurred in New York in 2011. That was two years after Epstein had been released from prison. He was, by then, a registered sex offender, and though some celebrities were still willing to be seen with him, he’d been abandoned by many of the more influential figures he previously called his friends.

www.theguardian.com/world/2015/jan/10/jeffrey-epstein-decade-scandal-prince-andrew

SANDRINGHAM AND JEFFREY EPSTEIN

aangirfan.blogspot.com/2012/01/sandringham-and-jeffrey-epstein.html


Goddard inquiry: Outrage as bishop Peter Ball jailed for sex offences given public funding for legal team

Pictured above: 2006 Peter Ball former Bishop of Lewes with his good friends Prince Charles and Camilla at a memorial for her father Bruce Shand


 

Disgraced bishop, friend to members of the royal family, jailed for a string of sex offences, Peter Ball has been given public funding for a legal team at the Government’s child sex abuse inquiry.

The decision to pay for lawyers, costing taxpayers up to £200 an hour, to defend the reputation of Peter Ball, the former Bishop of Gloucester and of Lewes, has outraged his victims.

Ball is the first convicted sex offender to be granted taxpayer funds, setting a precedent that could pave the way for dozens of paedophiles to get the same deal.

He received the legal funding because he “may be subject to explicit criticism by the inquiry”.

A lawyer close to the inquiry said: “I was really surprised Ball was given funding. The issue is about how he was allowed to get away with it by the Church not about his offending. He has already been investigated and pleaded guilty.”

http://www.telegraph.co.uk/news/2016/07/30/goddard-inquiry-outrage-as-bishop-jailed-for-sex-offences-given/

Lowell Goddard chair of the IICSA – her ex-husband, Sir Johnny Scott was a close friend of Camilla’s.

more here: https://goodnessandharmony.wordpress.com/2016/07/12/update-on-peter-ball-establishment-cover-up-ball-investigated-in-2008-for-being-part-of-a-suspected-paedophile-ring/

ball at wedding

2005 The wedding of Prince Charles and Camilla Shand attended by Bishop Peter Ball

Peter Ball ‘preached at the funeral of Camilla’s father’s in 2006, which indicates his standing in their household.’

img0102

It is quite Eye Opening Info, that Lord Mountbatten, Charles’ mentor, who introduced Jimmy Savile to the Royal Family, used to have Charles and Camilla visiting regularly in the early 70s around the time that Judge Goddard was in Britain with Camilla’s friend (Johnny Scott)

rebecca scott lewes

Lowell Goddard’s daughter Rebecca Scott was born in Lewes District in the county of Sussex  20/3/1970.

link

Through her marriage to Sir Johnny Scott, the current head of the Home Office‘s ‘independent’ inquiry into child abuse, Judge Lowell Goddard, has links with Camilla and Prince Charles
12d00b81200e86a1a1cf84ec21354463
Camilla met Charles at a polo match in 1970.
Sir Johnny Scott (IICSA Chair Lowell Goddard’s ex-husband and father of her child Rebecca Scott) grew up with Camilla, Duchess of Cornwall,
scott sir johnny

Both their parents (Johnny Scott’s & Camilla’s) were involved in the Southdown hunt;

Camilla’s father, Bruce Shand,the Master and

Walter Scott (Johnny Scott’s Father), Lowell Goddard’s former father-in-law, the chairman

 

01as-rufq

Major BRUCE SHAND MC With his daughter CAMILLA

Camilla Parker-Bowles father was Master of the Southdown Hunt. Vice Lord-Lieutenant East Sussex 1974-92

b9b2gfviiauefer

Lowell Goddard’s former father-in-law, Sir Walter Scott was Chairman of the Southdown Hunt. In 1975 he was Deputy Lieutenant East Sussex.

 

link

link

https://twitter.com/ciabaudo

b9md1d4iyaak_vm

johhny scott 2

link

 

IICSA Lowell Goddard’s daughter Rebecca Scott sits on a charity called Catwalk with royal family member Zara Phillips. 

https://www.catwalk.org.nz/project/rebecca-scott/

Ms Phillips, the Queen’s granddaughter and the daughter of Princess Anne, is a patron of the trust.

Lowell Goddard is a significant supporter of the CatWalk Spinal Cord Injury Trust

link

rebecca scott zara catwalk

Catwalk Trust: Back row – Lisa Chittick, Charlotte Gendall, Georgie Falloon, Sharleen Workman, Zara Phillips, Rebecca Scott, Greer Draper, Paula Petrie
Front row – Leanne Parker, Catriona Williams, Pip McCarroll

https://webcache.googleusercontent.com/search?q=cache:k4fu4zIzil8J:https://www.facebook.com/thecatwalktrust/photos/a.201931616529119.64759.104081226314159/784428134946128/+&cd=9&hl=en&ct=clnk&gl=us

Peter Ball was friends with many members of the royal family, not just Prince Charles & Camilla – Princess Margaret, the Queen Mum and Queen Elizabeth too

The Queen supported Bishop of Lewes Peter Ball after his police caution. In 1994, when she was distributing Royal Maundy money in Truro, Ball was there with his brother, who was Truro’s bishop.

After lunch in the Chapter House, the Queen, who had been on the high table with local dignitaries, went across to Ball, held out her hand and said in the clearest of voices: ‘My love and encouragement, Bishop.’

link

queen scott cousin rebecca

Ceremonial: The Crown of Scotland is carried by The Duke of Hamilton – Rebecca Scott’s cousin

more here: https://goodnessandharmony.wordpress.com/2016/07/12/update-on-peter-ball-establishment-cover-up-ball-investigated-in-2008-for-being-part-of-a-suspected-paedophile-ring/

hon-lowell-goddard-dnzm

NZ judge confused by UK laws

31 July 2016

The New Zealand judge heading the UK’s historical child abuse inquiry has shocked barristers by admitting that she is confused by English law.

Dame Justice Goddard is set to earn around £5million (NZ$9.17m) as chairwoman of the inquiry after being appointed by Theresa May.

Some lawyer have expressed their concerns about the delays and Dame Justice Goddard’s handling of the inquiry.

During the preliminary hearings last week, she admitted she was ‘unsure of local law’, when police attempted to block details of an investigation going public, according to The Times.

http://m.nzherald.co.nz/world/news/article.cfm?c_id=2&objectid=11684655

comnjwbweaard7x


Dame Lowell Goddard, the head of Britain’s inquiry into child abuse, has spent more than 70 days working abroad or on holiday in her first year in the role.

 

4 August 2016

The inquiry has been beset by delays and controversies since it was first announced by the then home secretary Theresa May.

Baroness Butler-Sloss, stood down in July 2014 amid questions over the role played by her late brother, Lord Havers, who was attorney general in the 1980s.

Her replacement Dame Fiona Woolf resigned following a barrage of criticism over her “establishment links”, most notably in relation to former home secretary Leon Brittan, who died in 2015.

Mrs May officially reconstituted the probe under Justice Goddard in March 2015

http://www.nwemail.co.uk/news/national/article/Child-abuse-inquiry-head-spent-44-days-working-abroad-in-a-year-e12ffada-0f17-43ba-b9c4-d174faae3ebd-ds