John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader charged with buggery of a 14-yr old.

Update: August 26, 2016

John Coatman MBE – Crusaders/ Urban Saints Youth Group Leader found guilty of gross indecency with young boy

John Coatman, leader of Urban Saints Youth Group, Croydon was warned by Judge Richard Horne QC that he faced a jail term. He is due to be sentenced on September 30.

 

Sexual contact took place on about four or five occasions.

In emotional testimony in front of the jury, the man – who was 14 at the time at the time – broke down in tears as he described the alleged abuse taking place 

“… the effects of abuse on a young person can be quite traumatic…”

 

The survivor also said Coatman had asked whether any other boys he knew “might be interested”.

 link

link

 

377e2a9100000578-3753419-image-a-3_1471886185455
A retired headmaster, John Coatman, has been charged with having sex with a 14-year-old boy he met through a Christian youth group in the 1970s.

Jurors heard that at the time of the incidents, Coatman was not only the headteacher of a secondary school in south London (St Andrew’s Church of England High School), but was also involved in a Christian group for boys.  

The name of the Christian youth group is – Crusaders/now called  Urban Saints Youth Group organisation – Cliff Richard’s group

http://research.omicsgroup.org/index.php/Urban_Saints

http://www.dailymail.co.uk/news/article-3753419/Retired-headmaster-75-head-sex-14-year-old-boy-met-Christian-youth-group-1970s.html

Mr Coatman, who described himself as a bachelor told jurors that the topic of sex did crop up during youth group meetings, but only in reference to passages in the Bible involving “Christian aspects of sexual behaviour”, he added.

link

John Coatman MBE Supporters

From a lonely John Coatman testimonial website (comprised of a handful of supporters)

Testimonial by Victoria Swainson

“…I also did my bronze and silver Duke of Edinburgh awards outside of school, through a group organised and led by John (Coatman), and attended a residential Crusaders weekend on the Isle of Wight, again which he’d organised”

 Testimonial by Dr Amy Kendrick

 My name is Amy Kendrick and I was a pupil at St Andrew’s Church of England School in Croydon between 1992 and 1997.

http://jcoatmantestimonials.blogspot.com/search?updated-min=2015-01-01T00:00:00-08:00&updated-max=2016-01-01T00:00:00-08:00&max-results=3

Dr Amy Kendrick – related to evangelical songwriter Graham Kendrick?

Graham Kendrick

Special commissions from such charities as Tear Fund, the Children’s Society, Church Army and Care for the Family, have resulted in songs of compassion and justice. They have been sung at major public occasions – including the Dunblane memorial service.

logo2x

The Tear Fund charity was created out of the Evangelical Alliance (EA) and the Evangelical Refugee Fund created by the United Nations.

In January 1969 Cliff Richard did two fundraising concerts for Tearfund at London’s Royal Albert Hall. He has served as the charity’s Vice President and in 1999 served as its president

article-1053130-026e2fc900000578-126_468x311

Life-long bachelor Cliff Richard – his manager and live-in companion of more than 30 years, Bill Latham (right) was  hugely involved with charity work and was in “on the start of Tearfund”

In 1972  Latham was Deputy Director of Tearfund and had been instrumental in persuading Jean Le Maistre, a Christian politician on the island who was just launching Jersey Overseas Aid, to take a team for his first project to a hospital in Nazareth.

link

cliff tear fund

1978 English pop singer Cliff Richard in concert for the Christian charity, Tear Fund.

jamesogilvyroyalweddingpreweddingdinneriaqmd75ldgtl

Julia Ogilvy  (centre)– a Trustee of Tearfund

Julia Ogilvy is a member of the extended British Royal Family. She is the wife of James Ogilvy, the only son of Sir Angus Ogilvy and Princess Alexandra, The Honourable Lady Ogilvy, a granddaughter of King George V and first cousin of Her Majesty the Queen.

link

Jimmy Savile admitted getting knighthood was ‘a relief because it got me off the hook’

His OBE folder contained a handwritten letter from Angus Ogilvy

link

More on the Ogilvys- The Ogilvys

Testimonial by Joshua Woodcock

John Coatman was at first my leader, then as i grew older my co-leader as i joined the team leading the group and even after i left a dear friend mine. My very first contact with John was at St Andrews school where he was my sisters head master.

I went to Wallington crusaders with John for the best part of 15 years

From mass groups of us walking over box hill in the middle of the night every year to may trips away to Westbrook on the isle of white.


 

John Coatman reckons he’s been to about 300 Crusaders camps over the years

link

img_0071

westbrook_new_website

westbrook20front

Westbrook started life as a large Victorian residence surrounded by 25 acres of mixed parkland that was purchased by Crusaders Union in 1948

The original intention of the Committee at the time was to use a Memorial Fund of just over £500 to purchase a field as a permanent camp site for the ever developing Crusader holidays

link

 Crusaders Youth Group/Urban Saints

link

Donald Wiseman worked for military intelligence.

In 1942 he became senior intelligence officer of the Mediterranean Allied Tactical Air Forces.

Wiseman joined a special intelligence group handling the Ultra signals, deciphered at Bletchley Park.

Wiseman worked with the Christian Crusaders

Wiseman also maintained a close connection with the Crusaders organisation. He was leader of the class at Finchley, which included Cliff Richard

Martin J. Selman, “Donald J. Wiseman,” in Walter A. Elwell and J. D. Weaver (eds.), Bible Interpreters of the 20th Century (Grand Rapids: Baker, 1999) p. 309

http://aanirfan.blogspot.com/2016/06/cliff-richard-crusaders-military.html


 

1979 Margaret Thatcher immediately carried out her promise to slash public spending, recommending that heating be drastically rationed in offices and schools.

This led to a remarkable revolt in Westerham in October 1979 when rebel children from Churchill School, led by senior pupils, burned their text books and walked out in protest against the cold. When headmaster John Coatman went into the playing field to remonstrate, many returned. Around 50 to 60 protesters stayed outside until a caretaker confirmed that the boilers were on.

link

 

 T H E O L D W H I T G I F T I A N A S S O C I A T I O N , C R O H A M M A N O R R O A D , S O U T H C R O Y D O N , S U R R E Y

John A Coatman attended Whitgift (1952-59)
coatman family whitgift
3007948-large
His brother was Robert William Coatman, MBE
ONE of Croydon’s longest-serving councillors.he was first elected as a Conservative for Croydon Central ward in 1966 and went on to represent its successor ward, Fairfield, until his retirement.

Councillor Coatman was elected in 1966 to represent Croydon Central ward, following a family tradition after his great-uncle, GF Coatman, represented Croydon Central in the 1920s

Bob Coatman was educated at Whitgift School and worked for 41 years as a chartered surveyor.

He was best known on the council for his role in planning – serving on the planning committee from 1968 and spending 16 years as its chairman.

 He was Mayor of Croydon in 1977-78.

In 1993, Mr Coatman was made an MBE for his services to local government, and he received a lifelong service award from the council in 2006.

He also served as a magistrate at Croydon Magistrates’ Court for 21 years from 1976.

Outside of council business, Mr Coatman was founder president of both the Rotary Club of Croydon South and the Croydon Mayors’ Association.

He had also been a member of the Croydon South Probus Club and the Old Whitgiftian Association and a longstanding member of the court of the Whitgift Foundation.

His interests included classic cars, he was  a member of the A40 Farina Club and the history of Croydon, and he was a member of the Croydon Corps of Drums.

 

coatman john

John Coatman. Leader, Urban Saints Youth Group, Croydon – MBE for services to Young People. (London, CR0)

 

standrews

Coatman was head teacher at St Andrew’s until he retired in 1997 and was awarded with an MBE by The Queen in 2012 for his services to young people.

Life-long youth worker given MBE

A FORMER head teacher who has spent his life working with Croydon’s youth has been recognised for his services to young people.

John Coatman, who taught at St Andrew’s School in Warrington Road, has been appointed an MBE.

Mr Coatman joined youth group the Croydon Crusaders, now known as Urban Saints, in 1949 aged eight and rose to represent the club on a national and international level.

 John Coatman

John is very active “for his years”, keeps fit and loves to travel the world – he’s always looking for travel companions who can keep up with him.

Since retiring he has dedicated his time to the youth club and has worked with more than 100,000 young people leading expeditions to Austria, a project which has secured European Union funding, and on countless Duke of Edinburgh Award trips.

Imperial College LondonJohn Coatman, BSc Civil Engineering 1962

link

link

Ten English Days or TED – by John Coatman, on behalf of the leadership team:

Coatman TED Austria

The expedition is being run as part of the work of Croydon Crusaders. Crusaders is a registered charity and the expedition is a charitable activity supporting the work of a charity in Austria. Please ask for information about gift aid.
EU GRANTS
In 2001, 2002, 2003, 2004 and 2005 we had generous grants towards the project from the European Union and we may be applying again this year.
This will be my seventh year leading the TED expedition so I know a great deal about where we are going and what we will be doing. For the first 3 years the trip was part of the Crusoe (Crusaders Overseas Expeditions) programme organised by Crusaders. From 2003 the same expedition has been run under my own Croydon Crusaders Group. Apart from that, all is the same and it is a great success. The 2006 trip is open to any Christian young person aged 15 to 25 who wants to serve God on a working holiday. For legal reasons, by applying they become members of Croydon Crusaders. I promise a great deal of fun in one of the most beautiful parts of Europe in a building that you will find tobe very hospitable and lovely. You will live in luxury but I also promise that you will work hard!

https://web.archive.org/web/20160823154816/http://www.youthblog.org/tedaustria2006.pdf

b2zkx5aciaafnbm

One of our loyal readers, John Coatman of The Croydon Crusaders, decided to pop in this morning and say hello!

The Pass is a magazine inspiring the UK’s Group Travel Organisers.

2011 Croydon Council consultant – John Coatman Crusadershttps://www.croydon.gov.uk/sites/default/files/articles/downloads/appendices1-3.pdf

coatman com ck

Nature of business (SIC) – 7020 Letting of own property

https://companycheck.co.uk/director/906652625/MR-JOHN-ANTHONY-COATMAN/companies


WALLINGTON CRUSADER HALL

Crusader Hall in Carshalton, England

Charitable Objects

“To Be Used For All Or Any Of The Purposes Of The Wallington Crusaders’ Bible Class For Public And Private Schoolboys And Young Men In Such Manner As The Leader Of Learders For The Time Being Thereof Shall Think Fit Within The Limits Of The Trusts Hereinafter Declared And Subject To Such Terms And Obligations As May Be Agreed Between The Trustees And The Wallington Crusaders’ Bible Class Aforesaid.”

Operations

Operation Location(s) Domestic
Surrey
Sutton

Trustees

Name

CHRISTIAN AND SPORTING ACTIVITIES MOSTLY FOR YOUNG PEOPLE WALLINGTON 253811

253811 MR BOB HEDDERLY, MR DERRICK CHARLES LEWIN 462944 MR NOEL GODFREY CARPENTER 467551 ROBERT VERNON HEDDERLY 468174 IVAN RATNAYAKE 3266458 JOHN COATMAN 3266459


The South East Regional Steering Group

 The South East Regional Steering Group consists of Berni, Phil, Liz, Richard, and …

John Coatman took early retirement after being a headteacher for 19 years to work for Crusaders/Urban Saints.

John was asked to be General Director for 2 years and has been involved in almost every aspect of the movement over the 60 years he’s been a member of the Croydon group.

 



 

cr1970chtimes08_21x_zps3eca9245

1970 Cliff had just returned from spending two weeks at a Christian Crusader camp. Cliff has entertained many young people on a boat that he moors on the Norfolk Broads

 …………………………………….

Cliff Richard led an armada of five motor cruisers along the Norfolk Broads…Last night with 27 boys from the Crusaders’ Union...in his six-berth Pomander ...

cliff2b-2bnorfolk2bbroads2b

cr1972dexp04_04x_zps256ad2f4

cr1966chtimes11_18x_zps31ab0c54

link

 

cliff2bbroads

 

WHAT IS AN URBAN SAINTS GROUP ANYWAY? There was a bumper crop of Urban Saints family members included in the 2012 New Year’s Honours list by Her Majesty The Queen.

This included MBEs for John Coatman (for his work with young people in Croydon, including the Wallington Urban Saints group), Dr Avice Hall & Stephen Hammersley (for their work in education, the community and their own local groups, in St Albans and Harpenden respectively). Former Crusaders Director, Dr Alan Kerbey, received an OBE for his work with young people in education and another former staff team member, Colin Henry, was recognised for with a MBE, for services to education in his role as Chair of Governors at Christ’s College in Guildford.

URBAN SAINTS is the operating name of The Crusaders’ Union, a company limited by guarantee and registered in England & Wales, company number 07771037, charity number 1144923

https://companycheck.co.uk/company/07771037/THE-CRUSADERS-UNION/companies-house-data

http://docslide.us/documents/engage-spring-2012-56f388fd581ab.html


l-r-president-of-crusaders-steve-chalke-sir-cliff-richard

2006
Crusaders, the youth missionary movement, hosted “An Evening with Sir Cliff Richard” recently in Central London to celebrate its centenary.

Alongside Steve Chalke, the President of Crusaders, Sir Cliff shared his personal life and faith, as well as performing a couple of songs from his repertoire.

Sir Cliff shared openly about his early days as a young performer, his big break, his very public conversion to Christ and the significant role played by Crusader leaders in his early Christian journey.

He spoke fondly of his time with Crusaders, of whom Sir Cliff is now Patron

http://www.christiantoday.com/article/sir.cliff.richard.shares.faith.at.crusaders.centenary/8014.htm

 

School children ‘given experimental drugs without their parents’ consent in 1960s Home Office-approved trial’

EXPERIMENTAL drug trials on school children were approved by Home Office doctors in the 1960s, it has been revealed.

Disruptive boys were given an anticonvulsant drug to see if it would help to control their behaviour while a proposal to give girls a powerful sedative was also considered.

In the disturbing revelations, exposed in National Archive files, parents were not consulted with consent left to managers.

richmond hill school b & w

Richmond Hill Approved School

The anticonvulsant drug trial was performed at the Richmond Hill Approved School in North Yorkshire, which housed male students aged 15-17 years-old.

The school for boys was established at a Victorian building on the site in 1961 after The Green Howards moved from its regimental headquarters and continued until 1973, when approved schools were replaced by community homes.

One of the documents was dated late 1967 and signed off by Dr JR Hawkings. He wanted to give some of them a drug called Beclamide

The proposal at the girls school had been considered for all students at the Springhead Park Approved School in Rothwell, which cared for 14 and 15-year-olds.

The drug that would have been trialled was Haloperidol, which is a powerful sedative now used as an anti-psychotic.

All three doctors involved in the drug trial plans are now deceased.

Home Office psychiatrist Dr Pamela Mason approved of the drug trials, saying she recommended “maximum support” for the project.

As the Richmond Hill trial got under way, a second trial was proposed, again by a school psychiatrist, at Springhead Park Approved School for girls in Rothwell near Leeds.

This was a sister school to the better known Duncroft in Surrey, a small institution for girls of higher intelligence.

In November 1968, Dr Joyce Galbraith wrote to Dr Mason at the Home Office “in strict confidence”.

She suggested giving Haloperidol to every girl in the school, for 18 weeks.

Again, Dr Mason supported the plan.

The files also show that Shelagh Sunner, headmistress of the school between 1966 and 1982, did not support the trial.

Bob Hammal, a teacher at Richmond Hill between 1968 and 1972, said he did not know about the trial at the time and is appalled.

link

http://www.bbc.com/news/uk-37149029http://www.bbc.com/news/uk-37149029

https://www.thesun.co.uk/news/1652873/home-office-docs-agreed-seedy-secret-drug-trials-on-restless-borstal-boys-in-60s-files-reveal/


P.O.I.

 

joyce galbraith

Dr Joyce Galbraith, a psychiatrist working at Springhead Park (Dr Joyce Galbraith, the archivist of the York Medical Society)

Dr JR Hawkings, a psychiatrist working at Richmond Hill

Dr Pamela G Mason Home Office psychiatrist

 

^ In cahoots  with  Henry Hunter of Balderton Hospital?  

and Dr Kenneth Milner of Aston Hall Hospital

“In Nottinghamshire, there were a series of lunatic asylums used to house wayward children. Those that refused to conform to schooling or the structure of family life. Doctors that thought nothing wrong in testing new anti-psychotic drugs and new treatment methods on the inmates…”

“This work was led, from what I can gather, by Dr Henry Hunter of Balderton Hospital in Newark, Notts. Funded by the Sheffield Health Authority, he accessed patients from numerous asylums around the region.

In turn, the doctors from these asylums trawled the children’s homes and secure units, looking for viable subjects for upcoming research or drug trials.”

“Over the years, Dr Hunter, Superintendent of Balderton saw fit to “borrow” patients from other facilities in the area.
Whittington Hall Hospital
Nottingham County and Borough Lunatic Asylum
Harmston Hall Hospital
Glenfrith Hospital
Aston Hall

Treatments included Chloropromazine, Trifluoperazine, Sodium Amytal, Ether, sensory deprivation.”



Police launch investigation into historic abuse claims at Derbyshire children’s hospital Aston Hall

FORMER child patients at a hospital at the centre of abuse allegations have told how they were drugged and thrown into padded rooms “to find out why they were misbehaving”.

“They said they wanted to find out where things had gone wrong when I was a kid, treatments at night time, at eight or nine o’clock. When we saw the car pulling up, we were petrified. We would scream. We were normal healthy children. There was nothing wrong with us. I don’t know why we were there.”

Det Insp Simon Tunnicliffe, head of Operation Hydrant, said: “A number of people have contacted the police wanting to talk about their experiences at Aston Hall.


mental-650095

The psychiatrist and hospital chief superintendent Dr Kenneth Milner (right), is alleged to have injected children with the truth serum sodium amytal before sexually abusing them. 

link

thehorrors

 

Kenneth Oswald Milner was born on June 26, 1909, and educated at Wakefield Grammar School and Leeds University, graduating with honours in 1933 and gained his medical doctorate at the university in 1939.

It said he served as a medical officer in HM Prison Service at Broadmoor Hospital and later as deputy medical superintendent at Rampton Hospital.

This was before being appointed physician superintendent at Aston Hall Hospital in 1947, where he remained until 1975.

http://www.express.co.uk/news/uk/652148/police-investigating-abuse-allegations-Aston-Hall-Derby-Operation-Hydrant-truth-serum

http://www.derbytelegraph.co.uk/just-troubled-teenager-ended-aston-hall-forget/story-28810446-detail/story.html


Establishment Physician – Dr Pamela Mason

 

Pamela Georgina Walsh Mason married first to David Paltenghi and

then to Director/Producer Jan Darnley-Smith in 1965

pamela georgina mason  paltenghi

MASON Pamela Georgina Walsh, Medical Officer; Psychiatrist, m. (1) David Paltenghi. 1949, dec. 1961, 2 sons, (2) Jan Darnley-Smith, 1 965. Education: Christ’s Hospital School, Royal Free School of Medicine. University of London; MRCS.

 

jan darnley-smith

Career

Dr Pamela Mason Senior Principal Medical Officer at the Department of Health and Social Security

pam mason holloway

Visiting Psychiatrist, Holloway Prison, 1962-67 (When Myra Hindley was there)

link

pam mason queen

 1984-87 Pamela Mason (Hon Physician to HM The Queen)

link

1987

MASON, Pamela Georgina Walsh 34 Goodwood Ct., Devonshire St., London W1N ILSMB BS Lond. … Late: Hon. Phys. HM the Queen; Sen Pnncip. Med. Off. DHSS; Cons. Psychiat. Childr Dept. Home Office

link


1967

 

Pamela Mason MB, BS, DPM Consultant Psychiatrist to the Home Office Children’s Department and Visiting Psychiatrist to Duncroft Approved School.

 

 


Social Work Today – Volume 1 – Page 21

https://books.google.com/books?id=h1VFAQAAIAAJ
1970 – ‎Snippet view

Peter Righton of the National Institute for Social Work Training spoke on the relationship between residential and community-based … Dr Pamela Mason, who is psychiatric adviser to the Home Office children’s department, speaking about …

https://www.google.com/search?tbm=bks&hl=en&q=dr+pamela+mason+and+righton



via WW:

All of this was government run and controlled.

 


duncroft savile mason

Jimmy Savile visited Duncroft Approved School for Girls in the 1970s, pictured here, in 1974, with staff members and students

 

Dr Pamela Mason 

Consultant Psychiatrist to the Home Office Children’s Department

and

Visiting Psychiatrist to Duncroft Approved School.

Pamela Mason, who supported the drugging of these children in Richmond Hill Approved School and in Springhead Park Approved School, without parental consent, was the Home Office visiting psychiatrist at Duncroft Approved School where  Jimmy Savile visited and had his own room.

Duncroft, a ‘paedophile sweet shop’…

Savile abused 23 girls at a school for emotionally disturbed teenagers where he was given ‘unrestricted and largely unsupervised’ access to youngsters, a report revealed.

The paedophile DJ carried out at least 46 sexual offences Duncroft School.

He was even allowed to stay overnight and abused girls across the property and in vehicles parked outside, including his Rolls-Royce.

The abuse even took place in the principal’s office

He is also recorded to have twice stayed at Norman Lodge, a hostel in the grounds used as a place of transition for girls who had gained employment, and also visited the intensive care unit twice.

http://www.dailymail.co.uk/news/article-3060559/Jimmy-Savile-abused-23-youngsters-Duncroft-School-emotionally-disturbed-teenage-girls.html

78706595_prince_phil_83670c

Former pupils recall that other visitors included the popular character actor James Robertson Justice and  the Conservative politician, Home Secretary (1957–62)  Rab Butler.

http://www.dailymail.co.uk/news/article-2220802/Meirion-Jones-BBC-war-astonishing-claims-reporter-aunt-saw-Savile-abuse-school.html

link

link

Dan Davies writes about the Duncroft home in his book about Savile:

“Many of the 25 or so girls in its care at any one time came from comfortable backgrounds and included the daughters of ambassadors and BBC producers. As a Home Office-approved school, funding came from Social Services.

Regular guests at their parties included the actor James Robertson Justice, who was one of Britain’s leading film stars in the 1940s and 1950s and reportedly a close friend of the Duke of Edinburgh. Princesses Marina and Alexandra are said to have attended.

Among the former Duncroft girls to have come forward, one has said she was put in the isolation unit for ‘two or three days’ after loudly protesting when Savile groped her in a caravan on the school grounds. ‘For years we tried to report him,’ another confided to me. ‘We even had a mass breakout to Staines police station.’

link

 

 

article-2220802-15785516000005dc-383_320x307

Police cover up Savile’s claims to be friends with Queen’s cousin: Paedophile ‘visited (Duncroft) school at centre of abuse allegations with Princess Alexandra’

article-2550472-1b261e3100000578-94_634x411

  • Paedophile Jimmy Savile mentioned first trip to Duncroft  school at centre of abuse claims
  • He said he was with Princess Alexandra, a patron of the school
  • Made claims during police interview, the transcription of which was edited
  • Information was removed by Surrey Police but has now been unveiled

jimmy-savile-sir-ogilvy-363573

Sir Angus Ogilvy, Princess Alexandra’s husband (left) with Jimmy Savile. All mention of the former DJ’s claims to friendship with the royal was initially omitted from police transcripts

In his 1974 life story Savile wrote: “Princess Alex is a patron of a hostel for girls in care. At this place I’m a cross between a term-time boyfriend and a fixer of special trips out.”

wald-duncroft-collect4.JPG

Jimmy Savile was a frequent guest at garden parties at Duncroft Approved School for Girls  and had his own room there

prince charles savile duncroft cover up poster

The Daily Star Sunday has asked the Information Commissioner’s Office (ICO) to investigate the redactions and consider the arguments any outside bodies made.

As we revealed in May, Government papers showing links between Savile and Prince Charles were redacted.

http://www.dailystar.co.uk/news/latest-news/346148/Royal-cover-up-Police-censor-Jimmy-Savile-interview-transcript


Duncroft – Closed Records for 85 years

duncroft20file20closed_zpsndzr0oh9

Duncroft  – 01/01/1963 – 31/12/1975  

Reports of visits by Home Office inspectors

This record is closed

Closed For 85 years
Opening date: 01 January 2061

 

http://discovery.nationalarchives.gov.uk/details/r/C6099703


via WW

The Walton Hop was situated only five miles from Jimmy Savile’s haunt the infamous Duncroft Approved School.

 Girls were also  allowed to attend the Walton Hop which was within walking distance and were sometimes provided with ‘escorts’

Walton Hop was  the hunting ground for convicted abusers such as Chris Denning, Jonathan King and Tom Patten – the latter of Bay City Rollers infamy.

The management must have been aware of this, permissions granted and ‘escorts’ arranged?

How was it that  the underage patients knew about the abuses, as did other visitors and yet, according to the statement Mind has issued, it would appear that staff and indeed Mind has no knowledge of this?

link

Home Office:

Sir Charles Cunningham 1957–1966

Sir Philip Allen 1966–1972Chairman of the charity Mencap from 1982 to 1988

http://www.telegraph.co.uk/news/obituaries/1570841/Lord-Allen-of-Abbeydale.html

 


1968, Dr Joyce Galbraith suggested giving Haloperidol to every girl in the school, for 18 weeks.

Background on Springhead Park School for Girls

A major aspect of the cost of maintaining Springhead Park, Sheffield, and of many other CHEs, was that of the employment of large numbers of staff. This raised the weekly fees to a level that deterred many local authorities from using the service.

In Springhead Park, a CHE for 30 girls, there were a Principal, two Deputies, a Head of Education, three full-time teachers, two Group Leaders and a team of residential social workers, a field social worker, a bursar, two office staff, a cook, a handyman, a gardener and domestic staff. It is hardly surprising that at the time of its closure in 1986 the weekly charge was £423 per week per girl. Part of the explanation for the policy of providing a high child/ staff ratio was the belief that change in the child could be best achieved through effective interpersonal relationships.

http://www.thetcj.org/child-care-history-policy/the-reality-of-closure

springhead20home1_zpsd9kb0jkm

Springhead Park School for Girls age 14-16yrs – provided domestic training and instruction in gardening. 

The establishment also had facilities for the treatment of venereal disease!

 

springhead202_zpsbokhinca


 


http://www.childrenshomes.org.uk/RothwellAS/

richmond and springhead natl arch

 

 1965 Jan 01-1966 Dec 31 Springhead Park Approved School, Rothwell, near Leeds, Yorkshire: opening of the school by Her Royal Highness Princess Marina and speech by the minister of state

Springhead Park Approved School, Rothwell, near Leeds, Yorkshire: reports of visits

1965 Jan 01-1974 Dec 31  

 

This record is closed

Closed For 78 years
Opening date: 01 January 2053

http://discovery.nationalarchives.gov.uk/details/r/C11133104

 

springhead barnados
1975 MIND’s Springhead Park School for Girls  was being considered  for take-over by Barnardos
http://mandatenow.org.uk/wp-content/uploads/2015/04/Operation-Outreach-29-4-2015-11186-link.pdf 

 

Richmond Hill School, Richmond:

richmond hill school 1

 

1950 Jan 01-1965 Dec 31

Richmond Hill Approved School, Richmond, Yorkshire: complaint of irregular punishment

http://discovery.nationalarchives.gov.uk/browse/r/h/C11133102

Richmond Hill Approved School, Richmond, Yorkshire: complaint of indecency

This record is closed

1965 Jan 01-1968 Dec 31

Closed For 93 years
Opening date: 01 January 2062

http://discovery.nationalarchives.gov.uk/details/r/C11133103

richmond20hill20school202_zpsvga0ksey

 


 

Kendall House: Girls drugged and abused at Church of England-run home

13 July 2016

Girls at a church-run children’s home were routinely drugged, locked up and physically, emotionally and sexually abused, a review has found.

Hundreds of girls were sent to Kendall house in Gravesend in the 1960s, 70s and 80s, before it closed in 1986.

It found girls were heavily sedated and placed in straitjackets.

The review found girls as young as 11 were “routinely and often without any initial medical assessment, given antidepressants, sedatives and anti-psychotic medication”.

Drugs were administered in dosages exceeding usual prescribed adult levels to control girls’ behaviour, placing them in a constant stupor, and restricting their ability to communicate, the report said.

The review found: “The effects of the drugs also increased their vulnerability to emotional, physical and in a smaller number of cases, sexual abuse”.

Concerns about the medication regime at Kendall House were raised in the 1970s and 80s by residents, their parents, by some social workers and some employees. “All were either ignored, rebuked, ridiculed or belittled by those in the position of authority in the home,” the report said.

Two former residents reported being raped on the premises in the late 70s inside the “locked isolation room”, one allegedly by a male visitor to the home when sedated, the other, allegedly, by several male visitors on different occasions.

Many of the women, including Teresa Cooper, say they were also sexually abused at the home, sometimes while they were unconscious from the drugs.

“I woke up to people abusing me more than once and I think it’s possible I was abused by men from outside the home as well as staff,” she said.

stream_img

The Home Office consultant psychiatrist in charge, Dr Marenthiran Perinpanayagam , has said in the past that the drugs used by the staff at the home were safe and did not have side effects.

link

link

link

link

link

 

How many kids in care used as drug experiments? must investigate drug companies. What have GSK to fear?

 

Misc

 

pamela mason holloway

1985 Dr Pamela Mason – Holloway Prison/ David Mellor

http://pb.rcpsych.org/content/pbrcpsych/9/12/247.full.pdfd Hill

https://books.google.com/books?id=h1VFAQAAIAAJ&dq=Home+Office+Pamela+Mason&focus=searchwithinvolume&q=+Mason

 

1970  Responsibility for Springhead Park School –  NAMH

1970  Responsibility for Richmond Hill – Local Committee

link

 

Church of England CSA VIP Cover ups… Bishop Garth Moore, Bishop Michael Fisher and Bishop Peter Ball etc


 There has been no apology from Justin Welby, the archbishop of Canterbury, to whom Joe reports writing 18 letters after the church began examining his case. He had one reply, from a correspondence secretary, assuring him that “the archbishop would hold him in his prayers”.

Dozens of Church of England officials ignored sex abuse victim ‘for decades’ despite being told of horrific abuse at hands of paedophile clergyman Revd Garth Moore

‘I told so many bishops‘: survivor tells of system that protected priest

15 March 2016

For almost 40 years, Joe has struggled to be heard by the Church of England over the sexual abuse that has blighted his life. The depression, anxiety and occasional suicidal thoughts that have dogged him since he was a teenager were, he says, as much the product of the church’s failure to listen to and act on his anguish as the original assault in 1976.

One of the earliest senior members that he told about the abuse  was Michael Fisher, the highly regarded leader of the Society of St Francis and later the suffragan bishop of St Germans in Cornwall.

Bishop Michael Fisher, who was then in his 60s and died in 2003, was acquainted with Bishop Garth Moore and was a close associate of Peter Ball, the former bishop of Lewes, who was jailed last October for sexual abuse.

According to Joe, then aged 18, Fisher “drew the full story out of me in confession. Immediately afterwards, he led me into an intensely romantic friendship with him”…kissing and caressing …This was not the right response to a young man who was seeking help,” says Joe. 

When Joe was 15, Rev Garth Moore, the chancellor of the dioceses of Southwark, Durham and Gloucester and the vicar of St Mary’s Abchurch in the City of London, was a family friend. According to Moore’s obituary, published in 1990 in the Ecclesiastical Law Journal, he was “the foremost canonist of his generation in the Church of England”.

Rev Garth Moore was a very senior figure in the establishment.

St Mary’s Abchurch in the City of London.

St Mary’s Abchurch in the City of London

http://www.theguardian.com/world/2016/mar/15/i-told-so-many-bishops-survivor-tells-of-system-that-protected-priest

Archbishop Carey accused of failing to refer to police detailed ’92 allegations against Peter Ball.

George Carey, who was archbishop of Canterbury at the time when police were investigating claims of sexual abuse by Ball, wrote in support of Ball to the director of public prosecutions and the chief constable of Gloucester police in February 1993.

http://www.theguardian.com/world/2015/dec/31/archbishop-and-mps-wrote-in-support-of-accused-bishop-foi-request-reveals

screen-shot-2015-10-17-at-18-57-481

Diplomat Robert Alston (right –  brother of  convicted paedophile, Richard Alston – left- partner of PIE’s Peter Righton and friend of PIE’s Charles Napier), was on the staff of Archbishop George Carey

http://www.world-traders.org/profileAlston.phphttp://www.world-traders.org/profileAlston.php

http://www.theguardian.com/world/2015/dec/31/archbishop-and-mps-wrote-in-support-of-accused-bishop-foi-request-reveals

 

 photo nott and queen_zpsombovitc.jpg

Another bishop who protected Peter Ball:
Peter Nott, Bishop of Norwich

 photo nott_zpsd1ilpaal.jpg

Sophie Rhys-Jones – One of her mum’s oldest friends- the former Bishop of Norwich Peter Nott

Sophie’s father was a master at Sherborne School


The former Heads of the CSA inquiry have something in common – The Church of England

Elizabeth Butler Sloss and Dame Fiona Woolf

Butler-Sloss Church of England hand picked.

She wanted to exclude some of the survivor’s allegations against Bishop Peter Ball, in a bid to protect the Church of England.

He says she told him she “cared very much about the Church”.

 http://www.bbc.com/news/uk-politics-28274882
More on Sloss:
Butler-Sloss was appointed by the government to chair the child sex abuse inquiry but she stood down after it was claimed that there was a conflict of interest because her brother, the late Sir Michael Havers, was Attorney General during the alleged cover-up of a previous pedophile scandal.

Butler-Sloss ‘kept claims of bishop Peter Ball’s abuse quiet

Child rapist jailed despite support of Lady Butler-Sloss
Lady Butler-Sloss criticised for giving evidence for defence in child rape trial

Elizabeth Butler Sloss is related to the  Sainsbury family

“The Hon. Sarah Sainsbury, daughter of John Davan Sainsbury, married to Hon. Robert Butler-Sloss, son of Elizabeth Butler-Sloss, Baroness Butler-Sloss

en.wikipedia.org/wiki/Sainsbury_family

Sainsbury Family were involved, along with bishop Peter Ball, in Derry Mainwaring Knight Satanist trial

The biggest contributor was Mrs. Sainsbury, who wrote checks totaling $116,000. Next came the chief magistrate and former high sheriff of East Sussex, a wealthy farmer named Michael Warren, who is reported to have given nearly $80,000.

Lord Hampden, Anthony David Brand Deputy Lord-Lieutenant for East Sussex contributed a Rolls-Royce with state-of-the-art communications equipment

The local bishop, the Right Reverend Peter Ball, of Lewes, a monk of whom the judge said, “You may think he is a little unwordly,” also agrees. “Father Peter,”… endorsed Mr Baker’s fund-raising with a note

http://www.nytimes.com/1986/05/04/world/devil-did-it-a-british-man-nets-313000.html

Derry Mainwaring Knight’s trial  … shocking testimony that would blow the lid off Satanic doings at the highest levels of English society.

He “outed” two Tory politicians (William Whitelaw, Enoch Powell) and one Labour MP (Leo Abse) as cult members.
He declared he would have no need to bilk money out of churchgoers, because he was a successful pimp.

Fomer Head of the CSA inquiry Dame Fiona Woolf


Fiona Woolf – Also, Church of England
Woolf  is a member of the Parochial Church Council of St Clement Eastcheap
A parochial church council (PCC) is the executive committee of a Church of England parish

https://ianpace.files.wordpress.com/2014/10/mail-261014-woolf-aide-linked-to-magic-circle-gay-sex-ring-claim.jpg?w=465&h=620

Marie Staunton/NCCL/PIE

Harriet Harman’s successor as legal officer, Marie Staunton, openly defended the affiliation in an astonishingly frank statement of September 1983, which reflected the continued hold of the sexual rights agenda.

The NCCL is campaigning to lower the age of consent to 14. An affiliate group like the Paedophile Information Exchange would agree with our policy.’

 photo staunton_zpswb4uplgu.jpg

Like so many others in NCCL/PIE  saga, Ms Staunton — now a CBE — has gone on to have an elevated public career, enjoying spells as the British director of Amnesty International and deputy director of Unicef in the UK, and head of the international charity Plan International. She is now chair of the overseas  charity Raleigh International.

 Dame Fiona Woolf DBE is a trustee of Raleigh International

Another of her Raleigh trustees is Former Unilever Vice President Patty O’Hayer

Leon Brittan had been a non-executive director of Unilever 2004 – 2010

raleighinternational.org/about-us/trustees-and-governance/

 Raleigh International and Save the Children (Patron Princess Anne) work together

a UK-originated youth and sustainable development not-for-profit organisation

Revealed: who is getting the most money at Britain’s biggest aid charities

2012 £90,001 to 100,000 Marie Staunton, chief executive

Marie Staunton, a trained human rights lawyer, was chief executive of Plan UK for a decade until late 2012. She had previously worked for as a deputy director at Unicef, a director at Amnesty International as as acting general secretary at Liberty.

Ms Staunton writes a blog on the Huffington Post and is also the British independent member on the management board of the EU Fundamental Rights Agency, which monitors racism and xenophobia across Europe.

http://www.telegraph.co.uk/news/politics/10223961/Revealed-who-is-getting-the-most-money-at-Britains-biggest-aid-charities.html


Our history

Prince Charles 1978

1978 – Operation Drake

Colonel John Blashford-Snell and HRH Prince Charles launched Operation Drake, running youth projects from ships circumnavigating the globe

http://raleighinternational.org/about-raleigh/our-history

August 2014

The Freemasons’ Grand Charity donate £50,000 to Raleigh International, in support of disadvantaged young people

http://raleighinternational.org/news-centre/press-releases

Raleigh International chosen as beneficiary of Lord Mayor’s Appeal

November 9th 2013

Raleigh International today announced that it is one of four charities which will benefit from funds raised during the 2013-2014 Lord Mayor’s Appeal. Alderman Fiona Woolf, CBE, elected today as Lord Mayor of London, is a Trustee of Raleigh International and has chosen Raleigh as one of the beneficiaries in the official role’s annual charity appeal.

http://raleighinternational.org/images/Raleigh International chosen as beneficiary of Lord Mayors Appeal.pdf


Enoch Powell and Jimmy Savile

Enoch Powell accused of satanic sex abuse

  • Late Tory MP was one of the most prominent politicians of the 20th century
  • He has been named in Church of England review into historic sex abuse

  • Claims relate to allegations of satanic rituals often involving abuse of kids
  • Powell’s name was given to police by Bishop of Durham Paul Butler

Powell is one of several high-profile names passed to Scotland Yard by Bishop of Durham Paul Butler, who is leading the review.

The Bishop has also handed detectives the name of Leo Abse, the flamboyant Welsh MP who died in 2008 aged 91.

Last night the Church of England confirmed that both names had been passed on to detectives from Operation Fernbridge, a Metropolitan Police inquiry into an alleged Westminster VIP paedophile network.

The Right Rev Butler was given the politicians’ names by Dominic Walker, former Bishop of Monmouth, who heard the allegations when he was a vicar counselling in the 1980s.

Mr Walker told senior clerics that Abse was named by three abuse survivors whom he counselled when he was a vicar in Brighton in the 1980s.

He also passed on the names of two former Conservative cabinet ministers, who have not yet been publicly linked to the scandal. Mr Walker was questioned by the Right Rev Butler after the discovery of a book from 1991 in which he described counselling sessions with adult survivors.

‘A number of survivors independently gave the name of a particular MP being involved,’ he said, adding. ‘I don’t believe there was any collusion in their stories.’

A Church of England spokesman said: ‘The name Enoch Powell was passed to Operation Fernbridge on the instruction of Bishop Paul Butler.’

http://www.dailymail.co.uk/news/article-3017207/Enoch-Powell-accused-satanic-sex-abuse-Bishop-Durham-gave-Met-detectives.html


Enoch Powell and Harvey Proctor –

Enoch Powell was an idol of Harvey Proctor

Harvey Proctor’s solicitors were Denby & Co – Sir Richard Denby AND Peter Jonathan Denby.

 

It is through Enoch Powell that another intriguing strand in the life of Harvey Proctor appears. This is his personal friendship with missing lawyer Peter Denby who used to work as an assistant to Enoch Powell.

Peter Jonathan Denby, a former aide to Enoch Powell and friend of Conservative Member of Parliament Harvey Proctor

https://spotlightonabuse.wordpress.com/2014/10/16/harvey-proctor-cottonrose-ltd-and-the-conservative-party/


Later he telephoned Proctor and left a message on his answering machine, saying: “I know I’m wanted but I can’t give myself up yet.” Proctor said he was “worried about him.”

While on the run after holding cops at gunpoint, Denby contacted Swinton Circle Bee Carthew, Powell … and Harvey Proctor!

Crafty muvva

He & Denby had just attempted (unsuccessfully) to sue the BBC. Elm Guest House very much happened & Leon Brittan was named, not by police, media etc, but by residents. The Times were alerted to it many years ago & chose to ignore. Lengthy coverup.

tinyurl.com/pgja7jp

karmic kick

According to Chief Supt Anthony Stevens

The incident was more likely to have stemmed from another crime that had gone wrong.

Dame Alun Roberts ‏@ciabaudo

Jonathan Denby, Proctor’s solicitor, got off lightly for his crimes and is now running a hotel in the Lake District.

Fifty Shades of Grey known for its graphic sexual nature replaces bible at hotel and brings backlash for Damson Dene Hotel owner Jonathan Denby

link

Dame Alun Roberts ‏@ciabaudo

Sir Richard Denby, a former president of the Law Society like Fiona Woolf, lived in Leon Brittan’s old Yorkshire constituency?

Plus Savile & Jaconelli in Scarborough & all those Tories at Swinton College

Jonathan Denby and Barbara Hewson are first cousins.

Barbara Hewson, Leading Barrister, Says Age Of Consent Should Be 13 And Criticises Operation Yewtree

http://www.huffingtonpost.co.uk/2013/05/09/barbara-hewson-says-age-of-consent-should-be-13_n_3242798.html

 karmic kick

(Barbara) Hewson and her crew have been rabid about smearing Dickens and debunking the dossiers since the start of this.

Other interesting family links – Barbara Hewson’s mother, Kathleen Joan Denby, worked at Bletchley Park

link

link


 Barbara Hewson and Sloss/Havers links:

Barbara Hewson  sits on board (Justice Journal editorial advisory board) with Elizabeth Butler Sloss’ nephew Philip Havers QC:

Philip Havers QC – nephew of Elizabeth Butler-Sloss

justice journal hewson havers 2

justice journal hewson havers 2

 

Justice.org

Our people – England & Wales

helenakennedywomenyearluncharrivalsngq2o9nefirl

Chair of Council, Baroness Helena Kennedy of the Shaws QC

Council

hrh_hk

camillaparkerbowleseleanorcattonwinswgdynvkk9tjl

View image on Twitter


The Master and Fellows are delighted to announce that Baroness Elizabeth Butler-Sloss has been elected an Honorary Fellow of Corpus.

Baroness Elizabeth Butler-Sloss has many close connections with Corpus.  Her father, Sir Cecil Havers, was an Old Member, as were her brothers, Michael (m 1946) who became Lord Chancellor in 1986, and David Havers (also m 1946).  More recently, her son Robert (m 1981), and her nephew, Philip Havers QC (m 1969) have kept the Corpus link alive.

link


Misc

 photo har3_zpsc479171f.jpg

Harriet Harman & Marie Staunton CBE in Ghana

Rev Fisher was a Bishop to Her Majesty’s Prisons 1985


 

Church of England warned bishops not to apologise too fully to sex abuse victims  

“The approach to survivors is often a corporate model and this document supports that – it shows a church led by lawyers and insurers, you get the impression that these people are really their masters.

“A diocese is deferential to their bishop and the bishop is deferential to a bunch of lawyers.

“The Church will say ‘our hands are tied’ but they are paying the people who are tying their hands.

Survivors said it showed there was a culture of denial, dishonesty and “blanking” victims in ways which had heightened their pain and ultimately failed to tackle the roots of the abuse crisis.

It follows a damning independent review of the Church’s handling of sadistic abuse by Garth Moore, a priest and top canon lawyer, in the 1970s.

It highlighted how the teenager – known as “Joe” – revealed his ordeal to a string of leading clerics, three of them later ordained as bishops, who then claimed not to remember anything.

http://www.telegraph.co.uk/news/2016/08/21/church-of-england-warned-bishops-not-to-apologise-too-fully-to-s/

 

https://www.churchtimes.co.uk/media/5199289/garth-moore.jpg

Rev Garth Moore was a Speaker at Butlins Holiday Camp at Skegness


Butler Sloss’ brother Havers/ Sir Peter Hayman etc

Denby investigated for accepting a bribe from the Iranian State shipping Line?

troy

Peter Hayman heavily involved in shipping lines. CEO of Seatrade


The North Yorkshire aspect and Operation Spade

The North Yorkshire Enquirer believes that one of the paedophiles named in the dossier handed to Whitby MP Leon Brittan, when he was Home Secretary, by Mr Dickens in 1983, was Britain’s most successful and longest offending paedophile and rapist Peter Jaconelli, who was exposed by the NYE team.

It is entirely credible that Jaconelli was one of the prominent persons mentioned in the dossier that Mr Dickens passed to the Home Office. It is also possible that the dossier had information on Jimmy Savile, who was equally well-known for offending openly in Whitby, in joint enterprise with Jaconelli.

The West Yorkshire Police investigation into why it failed to arrest Savile was widely castigated as a whitewash.  So was the North Yorkshire Police investigation. NYE investigation here. As with the Home Office and MI5, intelligence files appeared to have conveniently disappeared

nyenquirer.uk/child-abuse-wanlesswhittam-report-published/

Satanists On The Prince’s Land

Daily Express (28th August, 2006)

http://www.westcoast-news.org/story-satanists.htm

https://goodnessandharmony.wordpress.com/2016/05/21/church-of-england-csa-vip-cover-ups-bishop-garth-moore-bishop-michael-fisher-and-bishop-peter-ball-etc/

Cambridge-educated deputy head of St. Benedict’s Catholic private school jailed for horrific stash of porn images featuring children as young as two

 

 photo patten patron_zpstu8at6wv.jpg

BBC chairman Chris Patten is facing claims he helped cover up key evidence about the Jimmy Savile sex abuse scandal.

http://www.dailymail.co.uk/news/article-2521976/BBC-chairman-Chris-Patten-Patten-accused-cover-BBC-Savile-probe-blunder.html

Lord Patten, previously from the paedophile-infested BBC is Patron of the paedophile-infested school where Allott has worked since 2004

The school has been dogged by scandal after one teacher was convicted of nearly four decades of sexual abuse of children and another priest is still on the run from a child abuse charge.

The school and its linked Benedictine monastery, Ealing Abbey, was condemned four years ago for a ‘lengthy and cumulative failure’ to protect pupils in its care from child abuse.


Who on earth would feel safe their children were safe at that school?

No statement from patron Chris Patten on the abysmal governance at his school.

Patron:

One that supports, protects, or champions someone or something.  

A noble or wealthy person in ancient Rome who granted favor and protection to someone in exchange for certain services.

 photo st bene_zpsjakuhppb.jpg

Allott – Hi flyer, Cambridge-educated, former Tory councillor, member of David Cameron’s “Big Society” initiative is a member of “paedophile ring”


1/6/2016

Update

Patrick Rock, former aide to David Cameron, has been convicted of five counts of making indecent images of children.

link


Wonder if Peter Allott has any connections with Patrick Rock ?… another of David Cameron’s policy people charged by police over child abuse images and who has also worked under Chris Patten


Cameron brought Rock back into Downing Street in 2011, appointing him deputy head of the influential No 10 policy unit.

http://www.theguardian.com/uk-news/2014/mar/04/patrick-rock-tory

Rock was deputy head of David Cameron’s policy unit at the time of his arrest and they have known each other since the late 1990s.

Patrick Rock became an advisor to various Ministers during the 1990s, including Michael Howard and also Chris Patten

Patrick Rock is due back in court this month – big secret as to the exact date – no mention in msm.


At the time of his arrest, Allott was the deputy head teacher at St Benedict’s


He was identified after intelligence was received that an individual had been using video conferencing facilities to share indecent images of children with other paedophiles around the UK.


Judge Peter Hillen said :

…engaged in public service and political service. Someone who has engaged in charity work. Someone who was a high flyer

  ‘It was at the drug parties that you became aware of, and addicted to, indecent images of children. I use the phrase of a PAEDOPHILE RING, that’s precisely what that was.


Allott, a former Tory councillor, who served on the Perivale ward from 2006-2010

Peter Allott, 37, worked at £15,000-a-year school in London but now jailed for 33 months

When detectives from the National Crime Agency’s specialist child abuse team arrested Allott in December last year, they found nearly 700 illegal images and videos of children and extreme pornography.


The deputy head of a scandal-hit Catholic private school was jailed today after admitting getting hooked on child pornography blowing £600 a week on paedophile drug parties.

The Cambridge–educated deputy headteacher became addicted to child sex images and Class A drugs after being introduced to both at ‘chemsex’ parties organised on gay dating app Grindr.

He amassed nearly 400 horrific images of children as young as two, which he kept on his iPhone and on a hard drive in his office at the £15,000-a-year St Benedict’s School.

The private school in Ealing, West London, which counts comedian Julian Clary, Tory peer Chris Patten and actor Andy Serkis amongst its alumni, has been dogged by scandal after one teacher was convicted of nearly four decades of sexual abuse of children and another priest is still on the run from a child abuse charge.

The school and its linked Benedictine monastery, Ealing Abbey, was condemned four years ago for a ‘lengthy and cumulative failure’ to protect pupils in its care from child abuse.

The  scandal led to five monks and three former teachers being linked to child abuse.

 Allott was working at the school at the time of the abuse

Allott, originally from Barnsley, swapped images with a notorious paedophile, who used the internet name ‘Londonpaedo’ through Zoo. The internet sharing facility allows for an online conference call where perverts could chat and exchange images.

He studied history and politics at Hull University and gained a second degree in theology at the University of Durham. 

He became an economic and politics teacher at St Benedict’s when aged 25, and was elected to Ealing Council for the Conservatives in 2006. 

After a stint studying in Cambridge, Allott returned to St Benedict’s and was at the time of his arrest studying for a doctorate. 


Paedophile Peter Allott left for a year in 2011 to work as a research associate for a project on the Prime Minister David Cameron’s “Big Society” initiative and Catholic social teaching at Cambridge University.

Allot’s published work on Cambridge website

<script><script><script><script><script><script><script> <script><script><script><script><script><script><script><script><script>

 photo allot_zpsnv9qshwi.jpg

http://www.polis.cam.ac.uk/about-us/publications-from-polis-1/publications-from-polis-2013


Allott, taught at St Benedict’s  from 2004  and was promoted to deputy head in 2012


Allott, a former Tory councillor, who served on the Perivale ward from 2006-2010…engaged in public service and political service. Someone who has engaged in charity work. Someone who was a high flyer.

Michael Shaw, for the prosecution when asked about the fate of the children in the images, he said: ‘I would be surprised if some of them were still alive.’

Allott admitted possessing 25 ‘grossly offensive’ images on a hard drive and sharing the images with other offenders

http://www.stbenedicts.org.uk/governors

http://www.dailystar.co.uk/news/latest-news/480283/Ealing-private-school-st-benedicts-deputy-charged-child-abuse


https://goodnessandharmony.wordpress.com/2016/05/06/cambridge-educated-deputy-head-of-st-benedicts-catholic-private-school-jailed-for-horrific-stash-of-porn-images-featuring-children-as-young-as-two/

 

Murdered Bodies on Royal Estates/Prince Philip and Jimmy Savile/Records Sealed for 100 years

Truthseeker1 ‏@thewakeupcall09

Why are the records of murdered 7 year old Christine Butcher closed till 2047 ?

Unsolved murder of Christine Vivian Butcher (7 years) at Windsor, Berkshire, on 8 July 1951.

This record is closed

Closed For 74 years
Opening date: 01 January 2047

http://discovery.nationalarchives.gov.uk/details/r/C10887911

Was there a member of the royal family involved?  Why would those files from a murder in 1951 be closed for so long?

Who is being protected?  What is being covered up?


July 1951

Boxer Sugar Ray Robinson, a 3-to-1 favourite, trained in the shadow of Windsor Castle.

A strange thing happened the day prior to the bout: a young girl named Christine Butcher, aged only seven years, went missing while venturing off to visit Robinson at his camp only 30 metres away, kicking off a feverish police search.

En route to the weigh-in on Windmill Street in London, the streets were so choked with people that Robinson’s Cadillac was literally pushing its way through the crowd. Traffic was stopped in all directions at Piccadilly Circus, with reports stating it was the biggest crowd of people to take to the streets of London since V Day — the day when the Allied powers celebrated victory over the Axis powers six years earlier. Robinson was a half-hour late to the weigh-in because of the traffic.

An A.P. report out of Windsor read: “Christine had a doll that she imagined looked like Sugar Ray. She set off yesterday to show the doll to the champion. No one has reported seeing her since.” It was little more than an afterthought among the more pressing news, like how much heavier than the champion Turpin would scale, but it would later become haunting.

As the two men were toiling inside the ring, an investigation was underway;

The body of young Christine Butcher had been found not far from Windsor and “a white man in a grey suit” was sought for questioning. Her murder kicked off six weeks of similar crimes.

She was murdered on Sunday 8th July 1951 and found on 10th July.

<script><script><script><script><script><script><script> <script><script><script><script><script><script><script><script><script>

 photo ed55cac1-63b9-4746-b905-d8e5b4abfa34_zpsdmtbqnos.jpg

It’s interesting that Christine was on her way to meet Sugar Ray Robinson:

Robinson was a high-ranking mason, and was for a time in a relationship (some sites say married) to Mary Ann Degrimston, co-founder of the (CIA-linked) satanic Process Church, which famously interviewed Savile for the “Sex” issue of their magazine.

Degrimston later worked as an escort in London and may have been involved with the Profumo scandal.

link

Sugar Ray Robinson was a Prince Hall Freemason

http://www.masonrytoday.com/index.php?new_month=5&new_day=3&new_year=2015

http://www.theguardian.com/music/2014/jul/02/secret-jazz-freemason-history-duke-ellington-sun-ra


The body of 7 yr-old Christine Butcher (who had been violated before and after her murder) was found in Stephen’s Field of Windsor Park

Stephen’s Field is in the grounds of the castle.

 The Festival of Britain floats on their way to Stephen’s Field...In September 1951 at the time of the procession everyone in Windsor knew where it was because just two months earlier, on 10th July, the body of 7-year old Christine Butcher was found there. The papers were full of it. The crime was never solved.

 

The Windsor Forest Bowmen (Patron Prince Philip) give their location as St Stephen’s Field, Home Park.

They say that it is at the far end of Romney Lock Road, past the rugby club and cricket club, next to some very large trees.

theroyalwindsorforum.yuku.com/topic/1368/St-Stephens-Field-including-1951-Festival-of-Britain?page=2#.VxQsw3pGQpo

Windsor Forest Bowmen

Windsor Forest Bowmen was formed in 1951 and was granted Royal Patronage with His Royal Highness the Duke of Edinburgh, Prince Philip, accepting the appointment of Club Patron.

We are a target archery club catering for Recurve, Compound and Longbow. We also cater for traditional (hunter type) and barebow styles as some of the club members branch out into field archery. We enter winter and summer postal shoots as well as going to various competitions in the local area and sometimes further afield.

We are fortunate to have sole use of St Stephen’s Field, part of the Windsor Home Park Recreation Ground for our shooting activities; Windsor Castle providing a fitting backdrop.

www.vanzyl.co.uk/wfb/abouttheclub.htm

webcache.googleusercontent.com/search?q=cache:xEBN74km7mkJ:www.boxingmonthly.com/stories/robinson-turpin-i/+&cd=3&hl=en&ct=clnk&gl=us

The 1951 Festival of Britain celebrations… St Stephen’s Field, where the procession in 1951 ended up

Here is a facsimile of the programme for the local parade celebrating the Festival of Britain in September 1951 following a summer of events around the country. It was a major event by all accounts, with all the local schools, military and clubs taking part.

Royal Windsor Parade – Stephen’s Field 1951

^ Lots of youth organisations involved e.g. Girl Guides Association

and the Windsor Archery Club, Windsor and Eton Amateur Boxing Club, Star and Garter Riding School participating


Savile’s whereabouts in 1951

He competed as Oscar ‘The Duke’ Savile Aug 1951 Tour of of Britain cycle race

1951 – Age 24, Company director, Leeds Olympic,

4th Ayr-Carlisle 1951, known as “The Duke”

2nd Edinburgh-Newcastle 1950,

link

link

1951 Film: A Boy, a Girl and a Bike with Diana Dors  and Honor Blackman

Jimmy Savile also had a part in  A Boy, a Girl and a Bike

A Boy, a Girl and a Bike. Jimmy Savile can be seen on the right of the picture - just next to the man in the flat cap and smoking a pipe.

Jimmy Savile can be seen on the right of the picture – just next to the man in the flat cap and smoking a pipe in

A Boy, a Girl and a Bike.

http://www.yorkshirepost.co.uk/what-s-on/cinema/sir-jimmy-a-bike-blue-skies-hot-dinners-and-the-dream-time-1-3937514

Speaking in 2006, aged 80, Jimmy Savile was remembering his first brush with showbiz. It was spring 1948, and director Ralph Smart was on location in Skipton making the romantic drama A Boy, a Girl and a Bike, starring Diana Dors and Honor Blackman.

Dors by Diana p. 77 in Love Sweet Love she talks of filming at Hebden Bridge

The film is regularly screened at the Hebden Bridge Picture House to a full house.

link

Savile was a regular visitor to Hebden Bridge.

Sir Jimmy Savile during a visit to St John's church, Cragg Vale

Sir Jimmy Savile used to stay in a caravan at nearby Cragg Vale but was never interviewed by police.

Calls for investigation into murder of girl, 13, who was dumped in a canal in 1994 just miles from where shamed Jimmy Savile used to take holidays

  • Lindsay Jo Rimer was murdered in Hebden Bridge, West Yorkshire
  • But the case remains unsolved after 19 years
  • It has emerged that Savile would often holiday just miles from her home

Police have said they do not know Savile’s movements in November 1994

He made no public appearances that month and was not making programmes for the BBC.

Lindsay’s family lived at Lower Rough Head Farm, near Savile’s holiday spot before moving into Cambridge Street, Hebden Bridge, before her disappearance.

http://www.hebdenbridgetimes.co.uk/news/local/vicar-backs-police-investigation-into-possible-jimmy-savile-links-to-hebden-bridge-and-schoolgirl-murder-of-lindsay-rimer-1-6167522

http://www.dailymail.co.uk/news/article-2468322/Calls-investigation-murder-girl-13-dumped-canal-1994-just-miles-shamed-Jimmy-Savile-used-holidays.html


Diana Dors’ wild parties

Glimpsing orgies at 11 and offered drugs aged five, Diana Dors’ son reveals how wild parties were the norm in his childhood home

http://www.dailymail.co.uk/femail/article-2296497/Diana-Dors-son-Jason-Dors-Lake-reveals-wild-parties-norm-childhood-home.html

Diana Dors and Stephen Ward

https://forum.davidicke.com/showpost.php?p=1061804030&postcount=76958

What did Max Clifford witness at Diana Dors’ libidinous parties?

Max Clifford told Southwark Crown Court that he attended the sex parties in his ‘younger days’.

http://www.dailymail.co.uk/news/article-2592006/So-did-Max-Clifford-witness-Diana-Dors-libidinous-parties.html


Diana Dors held wild parties and drugs were offered to her 5 year old son at one. Bob Monkhouse was a regular attender … drug and sex orgies …in the 60s and beyond.

http://www.dailymail.co.uk/femail/ar…hood-home.html

https://forum.davidicke.com/showpost.php?p=1061804030&postcount=76958


Actress Honor Blackman lends support to the Liberal Party as she joins Johnnie Savile, brother of broadcaster Jimmy and candidate for Battersea North, London, on a canvassing tour of the constituency.

Honor Backman and Johnnie Savile

23rd February 1974: Actress Honor Blackman lends support to the Liberal Party as she joins Johnnie Savile, brother of broadcaster Jimmy and candidate for Battersea North, London, on a canvassing tour of the constituency.

http://liberalengland.blogspot.com/2012/11/jimmy-saviles-brother-was-liberal.html

https://forum.davidicke.com/showthread.php?t=222773&page=3029


Diana Dors and Prince Philip also involved in Profumo affair

Prince Philip and a delicate question: Why HAS ‘sensational’ Profumo file been buried for another 30 years?

More than 50 years after the scandal, there is clamour to release a file

http://www.dailymail.co.uk/news/article-2550297/Uncovered-The-secret-two-way-mirror-gave-bedside-view-Profumo-affair-flat.html

Prince Philip with Jimmy Savile wearing a Tea-rific shirt

During 1974 and 1975 Savile was holding annual fundraising events ‘Tea-rific’ for NAYC and while writing his autobiography (published in 1974) referred to himself as Vice-President to Angus Ogilvy’s President.

 


British Boys Boxing World

Prince Philip Patron of FEDERATION OF LONDON BOYS’ CLUB BOXING

 

<script><script><script><script><script><script><script>

<script><script><script><script><script><script><script>

 photo boxing philip_zpsyix6wt0c.jpg

The Duke of Edinburgh, who has become patron of the Federation of London Boys Clubs, watched their boxing finals at the Royal Albert Hall.

Julian Gibbs Vice-Chairman of the London Federation of Boys Clubs in 1971

On 22 October 1974

Gibbs had hosted a fundraising and networking evening for  PIE-linked Albany Trust, attended by Rev. Michael Butler, David Barnard and Antony Grey.

https://bitsofbooksblog.wordpress.com/tag/sir-harold-haywood/

Julian Gibbs

1951-53 2nd Battn. Green Jackets, 2nd Lieutenant. 1953-55 Queen’s Westminster Rifles (T.A) Lieutenant.

(^2nd Battn. Green Jacketssame battalion as Lord Edwin Bramall )

(Julian Gibbs on the Livery of the Grocers’ Company 1961. Vice-Chairman London Federation of Boys Clubs 1971. Chairman of the PM Club since 1970. Governor of the Royal Victoria Hall (Old Vic) since 1974. Vice-President of the Insurance Institute of London 1972.

Clubs: Carlton, Beefsteak, Pratt’s.

Julian Gibbs’ mother:

Helen Margaret Leslie CBE

Various posts with the Girl Guide Association, including County Commissioner, Herts. (1938-46)

She gave special support to the National Society for the Prevention of Cruelty to Children NSPCC

link

link

http://www.aparchive.com/metadata/youtube/ac6724248bbe4f39912937eacfbbdc93

1973 Variety Club Run – all sorts involved…boxers, Savile etc…guest of honour Prince Philip

 photo philip savile_zpspgtuisdl.jpg

https://books.google.com/books?id=EuQ_CgAAQBAJ&pg=PT207&lpg=PT207&dq=jimmy+savile+broadmoor+patients+windsor&source=bl&ots=F6hsvqjdjy&sig=uj2Q5LwlxQgh67YM4Nd7qmnqw_A&hl=en&sa=X&ved=0ahUKEwjq-KK11JjMAhXDeT4KHZ5VCGMQ6AEIXjAJ#v=onepage&q=jimmy%20savile%20broadmoor%20patients%20windsor&f=false



“Savile did whatever he wanted at Broadmoor and nobody could stop him.”

As accusations against the shamed star last night continued to mount, the Daily Mirror can also reveal

 Savile arranged for 60 patients, including convicted murderers, to be granted early release.

But for the patients who remained, Savile used his trusted status at the hospital in Crowthorne, Berks, to organise day trips for patients to the Queen’s back garden at Windsor Great Park and aboard a luxury boat on the Thames.

He also invited bands into the hospital grounds, then home to patients including Yorkshire Ripper Peter Sutcliffe and gangland boss Ronnie Kray, to stage exclusive concerts.

A former employee at Broadmoor, who knew Savile but asked not to be named, said: “He had access to all areas.

http://www.mirror.co.uk/news/uk-news/jimmy-savile-child-abuse-sexual-1380981

‘Child perverts soon become child killers’: Jimmy Savile was questioned by police over Yorkshire Ripper murders

Savile was questioned by detectives comes after it was reported that the body of Sutcliffe’s third victim Irene Richardson was discovered just yards from Savile’s flat.

http://www.independent.co.uk/news/uk/crime/child-perverts-soon-become-child-killers-jimmy-savile-was-questioned-by-police-over-yorkshire-ripper-8290236.html


Broadmoor

HC Deb 11 July 1985 vol 82 cc533-4W 533W  §

Mr. Peter Bruinvels asked the Secretary of State for Social Services

(1) if he will take steps to prevent patients at Broadmoor from being allowed out on visits; (2) why patients from Broadmoor were recently allowed to visit Windsor; and if he will make a statement.

§ Mr. Kenneth Clarke

Visits outside Broadmoor hospital and the other special hospitals are an important element in patient rehabilitation programmes. The visit to Windsor to which my hon. Friend refers took place in July 1984 without any complaint from anyone at the time. Decisions on patient outings or other visits are matters for the clinical judgment of responsible medical officers. In the case of restricted patients, absences from the hospital require the approval of my right hon. and learned Friend, the Home Secretary. ( Leon Brittan – 1985) Patients taking part in group outings are escorted continuously by nurses from the hospitals. I am quite satisfied that there is no unacceptable degree of risk to the public from such visits.

The Royal Windsor Horse Show and the Windsor Rose Show take place within the Windsor Park.

link

link

Broadmoor paedophile ring (In 1986 & 1997)

Savile had been working as a volunteer at Broadmoor since the 1970s and would have been working there at the time of the 1986 allegations

Savile – Broadmoor & Necrophilia

https://spotlightonabuse.wordpress.com/2013/12/06/there-was-evidence-of-a-broadmoor-paedophile-ring-in-1986/


Sugar Ray Robinson and the Process Church

Let’s play 6 degrees of separation with Annie Besant, Charles Leadbetter, Charles Manson, Mary Ann MacLean, Mary Tyler Moore and Sugar Ray Robinson… the connections are diabetes, animal rights, cults and people who travel with an entourage.

“Sugar Ray Robinson was the pioneer of boxing’s bigger-than-life entourages, including a secretary, barber, masseur, voice coach, a coterie of trainers, beautiful women, a dwarf mascot and lifelong manager George Gainford. When Robinson returned to Paris in 1962—where he was a national hero—to get him to cross the seas the French had to promise to bring over his masseur, his hairdresser, a guy who whistled while he trained, and his trademark pink Cadillac.

The Process Church of the Final Judgement was founded by Mary Ann MacLean and Robert DeGrimston Moore. Several sources report her as having once been married to Sugar Ray Robinson

link

https://goodnessandharmony.files.wordpress.com/2016/08/8de73-jsinterview.jpg?w=436&h=606

The satanic Process Church, which famously interviewed Savile for the “Sex” issue of their magazine

A Strange Hub: What Were UFOs, The Process Church, Roman Polanski, David Litvinoff, the Krays, Eric Clapton, Jimmy Savile, & Whitley Strieber Up To in 1968 London?

Savile was interviewed for a 1969 issue of The Process magazine, the “Sex” issue. The piece was called “The Natural Life of Jimmy Savile.”) This places Savile in the same circle as the Krays, the Cammells, the Claptons, and The Process

A Strange Hub: What Were UFOs, The Process Church, Roman Polanski, David Litvinoff, the Krays, Eric Clapton, Jimmy Savile, & Whitley Strieber Up To in 1968 London?


Savile told hospital staff he performed sex acts on corpses in Leeds mortuary

Former TV presenter said he posed with bodies in lewd positions and stole glass eyes, Broadmoor nurse tells investigators

Jimmy Savile told hospital staff he interfered with patients’ corpses, taking grotesque photographs and stealing glass eyes for jewellery, over two decades at the mortuary of Leeds general infirmary.

The late Top of the Pops presenter had free access to the mortuary from the late 1970s to the mid-1990s, an official investigation has found, concluding that Savile’s interest in the deceased was “not within accepted boundaries”.

Savile was said to have been best friends with the chief mortician of Leeds general infirmary, who is now dead, and had regular unsupervised access to the mortuary from the late 70s until the mid-90s.

Massive Cover-ups – Prince Philip

There are at least 27 D-Notices in place to prevent details of Philip’s sordid predilections getting into the public domain. The notices last for a staggering 100 years.

According to the Mirror:

SECRET files about Prince Philip’s private life are to remain locked behind closed doors for 100 years.

Most confidential Cabinet documents relating to relating to the royals and government are covered by the “30-year rule”.

But at least 27 royal files in the vaults of the Public Records Office at Kew, West London and many of , are considered so delicate they are labelled: “Closed for 100 years“.

More than 10 concern astonishing MI5 and Scotland Yard reports on the Duke Of Edinburgh’s private life.

As an explosive new biography of the Queen hints that the Greek-born Prince was unfaithful to the Queen, we can reveal that Buckingham Palace courtiers and security chiefs were once so concerned about Philip’s non- royal activities that they ordered round-the-clock surveillance.

They feared the Royal Family would be compromised and that there would be a constitutional crisis if news leaked out of how the Prince was behaving.

He was known to be “letting his hair down” with celebrities of the day at weekly meetings of the Thursday Club above exclusive Wheeler’s Restaurant in Soho.

One senior detective, now retired, who was attached to the Prince’s protection team, said: “It’s true we had to report back on where we had been and who had been present.”

But he refused to discuss the Prince’s private visits.It is not known what details of Prince Philip’s private life were made known to the Queen or the Privy Council. But it will not be until the years 2052 to 2060 that they will be released – if then.”

https://thecolemanexperience.wordpress.com/2014/02/02/prince-philip-filthy-secrets-princess-diana-jimmy-savile-and-the-100-year-d-notice/


Jimmy Savile Takes Young Girl To Prince Philip in Buckingham Palace.

 


Another murdered girl is found on the grounds of  a different royal family estate – Sandringham – the castle where convicted establishment paedophile Jeffrey Epstein visited and hunted.

 photo sandringham murder_zpshter0vvt.jpg

Murdered girl found near royal stud farm

British police said that a young woman’s body was found in the forest at Sandringham and that they are treating it as a murder case.

Queen Elizabeth II and her family gathered in rural splendor to celebrate Christmas and New Year’s.

Sandringham has long been one of the queen’s favorite residences, especially during the holidays.

The royal family also typically enjoys horseback riding and shooting parties at Sandringham

Buckingham Palace officials are staying mum about the murder case.

http://www.nbcnews.com/id/45850427/ns/world_news-europe/t/murder-inquiry-after-female-remains-found-uk-queens-estate/#.VxToYnpGQpo

It is one mile from the entrance to Sandringham House and half a mile from the Sandringham Stud where the Queen breeds racehorses.

Prince Philip normally leads shooting parties on the estate and has previously been seen with his gun in the field next to the wooded area.

http://www.dailymail.co.uk/news/article-2081529/Sandringham-house-Human-remains-dog-walker-Queens-estate.html

An inquest into the death of Lithuanian teenager Alisa Dmitrijeva will take place more than two and a half years after her body was found on the Sandringham Estate

The last positive sighting of her was in Friar’s Street, King’s Lynn at 12.15am on Wednesday 31 August 2011, where she was seen in a green Lexus car with two men.

Despite extensive enquiries and tests, police have been unable to confirm exactly how or when Alisa died.

They are also appealing for anyone with information about her black LG GM360 phone which is also missing.

The last signal her phone gave out was at the nearby Sandringham estate.

Despite the inquest today the case of Alisa’s death does remain open

http://www.itv.com/news/anglia/2014-09-15/inquest-into-death-of-latvian-teenager-found-on-royal-estate/

WHAT IS WITH THE ROYAL FAMILY & DEAD BODIES?

https://spidercatweb.wordpress.com/2015/10/02/what-is-with-the-royal-family-dead-bodies/

Prince Philip loves “blood-sports”

The now-frowned upon custom of a royal hunt was, at the time, a popular past-time amongst royals and wealthy

In 1961, Prince Philip went ahead with the hunt despite protests from British and Indian politicians.

On the same trip he is said to have killed a crocodile and six mountain sheep.

Critics of the Duke’s fondness for hunting claim he has shot at least 30,000 pheasants in Britain alone and has also killed deer, rabbit, wild duck, pigeon and partridge.

http://www.express.co.uk/news/royal/595424/Queen-Prince-Philip-pose-dead-tiger-50-years-before-Cecil-lion-controversy


Visit: Epstein was hosted by Prince Andrew at Sandringham,The Queen's home in Norfolk

Visit: Paedophile Jeffrey Epstein was hosted by Prince Andrew at Sandringham,The Queen’s home in Norfolk

Jeffrey Epstein ‘kept a diary of his under-aged victims

The Duke of York’s billionaire paedophile friend kept a secret journal, described as “The Holy Grail” by lawyers, which listed his alleged under-aged victims and the celebrity guests he entertained at his Florida mansion.

Jeffrey Epstein and Ghislaine Maxwell at Sandringham in 2000 Photo: ALBANPIX


Jeffrey Epstein and Ghislaine Maxwell were among guests on this pheasant shoot, attended by Andrew (right), at Sandringham, Norfolk, after the Prince and the US businessman became friends

link

The billionaire financier, who attended The Queen’s birthday party in 2000, was sentenced to 18 months in prison in 2008

Prince Andrew’s billionaire convicted paedophile friend, Jeffrey Epstein, given permission to land his private jet at RAF base for visit to Sandringham

The flight log of Epstein’s Gulfstream revealed it touched down at RAF Marham on December 7, 2000, before he was hosted by the Andrew at the Queen’s Norfolk residence.

Civil aviation authorities called the situation ‘unusual’.

He is alleged to have used his fleet of private aircraft to traffic under-aged girls around the world for sex.

Entries in the Gulfstream’s flight log reveal he regularly flew alone with Virginia Roberts, who has claimed she was used as a ‘sex slave’ by Epstein from the age of 15. Roberts was photographed with the Duke.

www.dailymail.co.uk/news/article-1364742/Jeffrey-Epstein-Prince-Andrews-billionaire-paedophile-friend-visit-Sandringham.html

The Palace has declined to say, for example, why Andrew was in the company of a 17-year-old masseuse working for Epstein at Maxwell’s home.

The Palace also refuses to answer questions about Andrew’s friendship with Epstein, or confirm the several occasions the two men appear to have partied together.

Those reported encounters between Epstein and Andrew, some of which appear to be corroborated by flight logs for Epstein’s private planes, which have been reviewed by the Guardian, stretch back more than a decade.

They include parties at Windsor Castle and Sandringham, the Queen’s Norfolk estate,

an exclusive dinner in St Tropez and a holiday in Thailand…

Indeed, the Palace has never offered a public explanation for Andrew’s most controversial meeting with Epstein, which occurred in New York in 2011. That was two years after Epstein had been released from prison. He was, by then, a registered sex offender, and though some celebrities were still willing to be seen with him, he’d been abandoned by many of the more influential figures he previously called his friends.

www.theguardian.com/world/2015/jan/10/jeffrey-epstein-decade-scandal-prince-andrew

SANDRINGHAM AND JEFFREY EPSTEIN

aangirfan.blogspot.com/2012/01/sandringham-and-jeffrey-epstein.html


Goddard inquiry: Outrage as bishop Peter Ball jailed for sex offences given public funding for legal team

Pictured above: 2006 Peter Ball former Bishop of Lewes with his good friends Prince Charles and Camilla at a memorial for her father Bruce Shand


 

Disgraced bishop, friend to members of the royal family, jailed for a string of sex offences, Peter Ball has been given public funding for a legal team at the Government’s child sex abuse inquiry.

The decision to pay for lawyers, costing taxpayers up to £200 an hour, to defend the reputation of Peter Ball, the former Bishop of Gloucester and of Lewes, has outraged his victims.

Ball is the first convicted sex offender to be granted taxpayer funds, setting a precedent that could pave the way for dozens of paedophiles to get the same deal.

He received the legal funding because he “may be subject to explicit criticism by the inquiry”.

A lawyer close to the inquiry said: “I was really surprised Ball was given funding. The issue is about how he was allowed to get away with it by the Church not about his offending. He has already been investigated and pleaded guilty.”

http://www.telegraph.co.uk/news/2016/07/30/goddard-inquiry-outrage-as-bishop-jailed-for-sex-offences-given/

Lowell Goddard chair of the IICSA – her ex-husband, Sir Johnny Scott was a close friend of Camilla’s.

more here: https://goodnessandharmony.wordpress.com/2016/07/12/update-on-peter-ball-establishment-cover-up-ball-investigated-in-2008-for-being-part-of-a-suspected-paedophile-ring/

ball at wedding

2005 The wedding of Prince Charles and Camilla Shand attended by Bishop Peter Ball

Peter Ball ‘preached at the funeral of Camilla’s father’s in 2006, which indicates his standing in their household.’

img0102

It is quite Eye Opening Info, that Lord Mountbatten, Charles’ mentor, who introduced Jimmy Savile to the Royal Family, used to have Charles and Camilla visiting regularly in the early 70s around the time that Judge Goddard was in Britain with Camilla’s friend (Johnny Scott)

rebecca scott lewes

Lowell Goddard’s daughter Rebecca Scott was born in Lewes District in the county of Sussex  20/3/1970.

link

Through her marriage to Sir Johnny Scott, the current head of the Home Office‘s ‘independent’ inquiry into child abuse, Judge Lowell Goddard, has links with Camilla and Prince Charles
12d00b81200e86a1a1cf84ec21354463
Camilla met Charles at a polo match in 1970.
Sir Johnny Scott (IICSA Chair Lowell Goddard’s ex-husband and father of her child Rebecca Scott) grew up with Camilla, Duchess of Cornwall,
scott sir johnny

Both their parents (Johnny Scott’s & Camilla’s) were involved in the Southdown hunt;

Camilla’s father, Bruce Shand,the Master and

Walter Scott (Johnny Scott’s Father), Lowell Goddard’s former father-in-law, the chairman

 

01as-rufq

Major BRUCE SHAND MC With his daughter CAMILLA

Camilla Parker-Bowles father was Master of the Southdown Hunt. Vice Lord-Lieutenant East Sussex 1974-92

b9b2gfviiauefer

Lowell Goddard’s former father-in-law, Sir Walter Scott was Chairman of the Southdown Hunt. In 1975 he was Deputy Lieutenant East Sussex.

 

link

link

https://twitter.com/ciabaudo

b9md1d4iyaak_vm

johhny scott 2

link

 

IICSA Lowell Goddard’s daughter Rebecca Scott sits on a charity called Catwalk with royal family member Zara Phillips. 

https://www.catwalk.org.nz/project/rebecca-scott/

Ms Phillips, the Queen’s granddaughter and the daughter of Princess Anne, is a patron of the trust.

Lowell Goddard is a significant supporter of the CatWalk Spinal Cord Injury Trust

link

rebecca scott zara catwalk

Catwalk Trust: Back row – Lisa Chittick, Charlotte Gendall, Georgie Falloon, Sharleen Workman, Zara Phillips, Rebecca Scott, Greer Draper, Paula Petrie
Front row – Leanne Parker, Catriona Williams, Pip McCarroll

https://webcache.googleusercontent.com/search?q=cache:k4fu4zIzil8J:https://www.facebook.com/thecatwalktrust/photos/a.201931616529119.64759.104081226314159/784428134946128/+&cd=9&hl=en&ct=clnk&gl=us

Peter Ball was friends with many members of the royal family, not just Prince Charles & Camilla – Princess Margaret, the Queen Mum and Queen Elizabeth too

The Queen supported Bishop of Lewes Peter Ball after his police caution. In 1994, when she was distributing Royal Maundy money in Truro, Ball was there with his brother, who was Truro’s bishop.

After lunch in the Chapter House, the Queen, who had been on the high table with local dignitaries, went across to Ball, held out her hand and said in the clearest of voices: ‘My love and encouragement, Bishop.’

link

queen scott cousin rebecca

Ceremonial: The Crown of Scotland is carried by The Duke of Hamilton – Rebecca Scott’s cousin

more here: https://goodnessandharmony.wordpress.com/2016/07/12/update-on-peter-ball-establishment-cover-up-ball-investigated-in-2008-for-being-part-of-a-suspected-paedophile-ring/

hon-lowell-goddard-dnzm

NZ judge confused by UK laws

31 July 2016

The New Zealand judge heading the UK’s historical child abuse inquiry has shocked barristers by admitting that she is confused by English law.

Dame Justice Goddard is set to earn around £5million (NZ$9.17m) as chairwoman of the inquiry after being appointed by Theresa May.

Some lawyer have expressed their concerns about the delays and Dame Justice Goddard’s handling of the inquiry.

During the preliminary hearings last week, she admitted she was ‘unsure of local law’, when police attempted to block details of an investigation going public, according to The Times.

http://m.nzherald.co.nz/world/news/article.cfm?c_id=2&objectid=11684655

comnjwbweaard7x


Dame Lowell Goddard, the head of Britain’s inquiry into child abuse, has spent more than 70 days working abroad or on holiday in her first year in the role.

 

4 August 2016

The inquiry has been beset by delays and controversies since it was first announced by the then home secretary Theresa May.

Baroness Butler-Sloss, stood down in July 2014 amid questions over the role played by her late brother, Lord Havers, who was attorney general in the 1980s.

Her replacement Dame Fiona Woolf resigned following a barrage of criticism over her “establishment links”, most notably in relation to former home secretary Leon Brittan, who died in 2015.

Mrs May officially reconstituted the probe under Justice Goddard in March 2015

http://www.nwemail.co.uk/news/national/article/Child-abuse-inquiry-head-spent-44-days-working-abroad-in-a-year-e12ffada-0f17-43ba-b9c4-d174faae3ebd-ds

Diplomatic Connections and PIE / Diplomat Robert Alston – brother of Richard Alston (part 1)

 Brothers: Richard Alston  – convicted child rapist (left) – Diplomat Robert Alston (right) pictured above

Richard Alstonformer school teacher and long term partner of the founder of PIE (Peter Righton) –  has been sentenced to 21 months in prison for molesting an 11-year-old boy.

https://theneedleblog.files.wordpress.com/2013/04/image.png?w=474

Charles Napier and Peter Righton

The court heard that Peter Righton and Richard Alston’s friend Charles Napier – now a convicted paedophile – would also be present when the boy was abused.

Brothers:  Charles Napier, the half-brother of senior Conservative MP John Whittingdale and cousin to DIPLOMAT  Peter Hayman’s wife, was jailed for 13 years for carrying out hundreds of sexual assaults on young boys.

High level PIE member and diplomat – Sir Peter Hayman with wife Miss Rosemary Eardley Blomefield (cousin of Charles Napier)

The subsequent police investigation revealed a correspondence of an obscene nature between Sir Peter Hayman and a number of other persons. The papers involved an obsession about the systematic killing by sexual torture of young people and children.

His (Hayman’s) wife stood by him in his dark days.”

Thatcher stopped Peter Hayman being named as paedophile-link civil servant

https://i2.wp.com/i.dailymail.co.uk/i/pix/2012/04/29/article-2137076-0607AD630000044D-271_306x423.jpg

Elizabeth Butler Sloss chosen by Theresa May to head CSA Inquiry despite the fact that her brother, Sir Michael Havers tried to stop Tory MP Geoffrey Dickens from using parliamentary privilege to name diplomat Sir Peter Hayman as a paedophile.

Sloss has protected 2 child rapists – Peter Ball and her housekeeper’s son (2x)

………………………………………………………………………………………………………………………………………………….

In November 2012, the Mirror reported on Charles Napier who appears to be a central player in the paedophile scandal engulfing the U.K.

…The probe led police to the kitchen of a flat in South London where they found a letter from ‘Napier – who had a child assault conviction 20 years before – boasting of his life in Cairo as a”British Council teacher.

He bragged of easy access to young boys and how he could send obscene images back to Britain in diplomatic bags.(Charles Napier joined the British Council after his 1972 conviction.

(Henniker was Director of the British Council 1968-72).

Many questions remain unanswered including who were Napier’s referees for his employment with the British Council?

The scandal erupted again when Labour MP Tom Watson raised the matter with David Cameron in the House of Commons suggesting a network of paedophiles working in the UK had links to high levels of Government.

…………………………………………………………………………………………………

Robert Alston was educated at Ardingly College and New College, Oxford. He is Chairman of Governors at Ardingly College.

Paul Righton attended Ardingly College from 1940 to 1944

Righton’s Ardingly College obituary – with mention of Richard D Alston (G1953-63)

Peter Righton obituary

Ardingly College – the school has its own Masonic Lodge – Ardingly College Lodge

Robert Alston:

Left: Chairman of the Romney Marsh Skills Festival, Robert Alston together with the Master, Graham Bishop

He became a Freeman of the World Traders (on the firm recommendation of Past Master Peter Gadsden) in 2000, and progressed through the Company to the Mastership in 2007-8. For him highlights of his year were the Sheep Drive across London Bridge in aid of the Lord Mayor’s charities (the brainchild of his wife Pat, also a Liveryman of the Company), and leading a delegation of World Traders to accompany Lord Mayor David Lewis on his official visit to Oman.

Alston served as British Ambassador to Oman between (1986–1990), and as British High Commissioner to New Zealand and the Cook Islands (1986-1990), non-resident High Commissioner to Samoa, and Governor of the Pitcairn Islands between (1994–1998)
He served overseas in Afghanistan, France, Iran, Belgium (in the British Delegation to NATO) also in Belfast on secondment to the Northern Ireland Office.

Companion of the Order of St Michael and St George (CMG) – 1987

He did National Service with the Royal Sussex Regiment.

From 1961 to 1998 he was a member of the Diplomatic Service.

The Middle East (as a Persian speaker) and defence, security and proliferation issues were the principal themes of his career.

 

https://i0.wp.com/www.timesofoman.com/uploads/imported_images/2015/06/12/dtl_20_12_2013_5_2_51.jpg

Ambassadors to OmanLaing* (left) 2002-2005 & Robert Alston 1986-1990

Stuart Laing found himself under a shroud of controversy in late February 2011 when accompanying a trade delegation to the Middle East, led by the British Prime Minister David Cameron, that contained several delegates from UK defence companies including BAE Systems and Thales Group. Laing attended in his official capacity as Deputy Vice Chancellor of Cambridge University along with the heads of other British universities such as Imperial College London and University College London. Objections were raised that, as such weapons and devices of public order control had recently been used by the governments of Egypt and Libya, it was irresponsible for the University to be involved in such a trip.

Since retiring from the Diplomatic Service Alston has been involved with

education (as Chairman of the Council of Ardingly College from 2005-10 and Chairman of the Governing Body of the Marsh Academy New Romney fro 2007-13);

the Church (on the staff of Archbishop George Carey* from 1999-2002;

the Commonwealth Institute and its successor the Commonwealth Education Trust;

the Pilgrims, where he serves as a member of the Executive Committee; and the County of Kent as a Kent Ambassador and a Deputy Lieutenant from 2007-13.

Diplomat Robert Alston was on the staff of Archbishop George Carey

*Ball was not charged when the allegations of abuse against him first emerged in 1993. Instead the police and senior figures in the Crown Prosecution Service (CPS), then led by the late Barbara Mills, agreed to issue Ball with a caution.

https://i2.wp.com/i3.mirror.co.uk/incoming/article6593003.ece/ALTERNATES/s615b/PAY-Archive-photo-dated-1992-of-Rev-Peter-Ball-and-Prince-Charles.jpg

Peter Ball was not charged and this was done with the knowledge of the then archbishop of Canterbury, George Carey.

Ball proceeded to resign as bishop and went to live in a property lent to him by his friend the Prince of Wales.

George Carey and Prince Charles

http://www.dailymail.co.uk/news/article-3252352/Former-school-teacher-partner-Paedophile-Information-Exchange-founder-sentenced-21-months-prison-molesting-11-year-old-boy-70s.html

https://en.wikipedia.org/wiki/Stuart_Laing_%28diplomat%29

http://www.world-traders.org/profileAlston.php

http://www.theguardian.com/uk-news/2015/sep/08/bishop-peter-ball-victims-accuse-c-of-e-police-and-cps-of-sexual-abuse-cover-up

http://ca.wow.com/wiki/Robert_Alston

https://thecolemanexperience.wordpress.com/2013/03/09/the-british-council-charles-napier-and-the-diplomatic-bag/

companycheck.co.uk/director/913897094

Sir Peter Hayman – High level member and activist of P.I.E

https://ianpace.wordpress.com/2014/03/06/two-obituaries-of-peter-hayman-senior-diplomat-mi6-officer-and-pie-member/

http://www.dailymail.co.uk/news/article-2885152/Tory-MP-s-half-brother-known-Napier-Rapier-pupils-jailed-13-years-HUNDREDS-sex-assaults.html

ianpace.wordpress.com/2014/07/16/peter-righton-obituary-in-ardingly-college-magazine/

http://www.ardinglycollegelodge.org.uk/

Follow

Get every new post delivered to your Inbox.